2LCRA

Nmr structure of alk1 extracellular domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
97
structure length
97
Chain Sequence
DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Activin receptor-like kinase 1
publication title NMR Solution Structure of Alk1
rcsb
source organism Homo sapiens
total genus 11
structure length 97
sequence length 97
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2lcrA00
3PLCA 6EBXA 1KFHA 2PJYB 1KC4A 2JQPA 1I02A 1HC9B 1MR6A 1ES7B 1FSSB 2H64C 1F94A 4HQPF 2OFSA 1IJCA 4AEAA 1FFJA 1QKEA 1KXIA 1FF4A 1JBDA 4IYEA 1KBTA 1TGXA 3KFDI 1NXBA 1V6PA 2J8BA 1KS6A 1KBSA 4XJJA 3FEVA 2CCXA 1CXOA 2H7ZB 2VLWA 2H5FA 2BTXA 2LA1A 2CRTA 2ABXA 1CXNA 2MJ4A 1F8UB 2MHYA 2K3GA 1FASA 1NEAA 1LX5B 1IK8A 1CDSA 1UG4A 4BIKB 4ZQYA 1REWC 1CTXA 1HAJA 2MUPA 1JE9A 1JGKA 1FSCA 1DRSA 2CDXA 3BT1U 1NYUA 3BT2U 2FD6U 1IDGA 1LSIA 1NYSA 5DO6A 2LCRA 1BXPA 3NDSA 2QC1A 2CRSA 1ONJA 1YWHA 1CRFA 2UX2A 5IMYC 1XT3A 2X8BB 5DU1A 2H62C 2PJYC 1QKDA 1IDLA 3EBXA 1NTXA 3LAQU 2QJ9C 1HOYA 1HAAA 1FRAA 1TFSA 3NEQA 1IDIA 4P7UA 1CHVS 2H62D 4QTIU 4FAOC 1L4WA 3NH7A 4OM5A 1COEA 3EVSC 5EBXA 4DO8A 1IQ9A 5IMTD 1TXAA 4BDTB 3VTSA 1KTZB 2MFAA 2QJAC 1HC9A 1CDRA 4LFTA 1QM7A 2MUOA 1LXHA 2H8UA 1ERAA 2NBTA 3ERAA 1TXBA 2GOOB 1CREA 1CODA 1IDHA 1CCQA 1BTEA 2JVEA 1CVOA 1ERGA 1VB0A 2I9BE 1NORA 2QJBC 1M9ZA 1CDTA 3HH7A 4FAOE 2H7ZA 1H0JA 2L03A 2HLRA 1G6MA 2BHIA 1RGJA 1B41B 4UY2C 1KL8A 1MAHF 1CDQA 1W6BA 2GOOC 3U73U 4EY8B 2ERAA 5DZ5A 1LXGA 2MJ0A 3QB4B 2CTXA 2L5SA 2N99A 1KU6B 4RUDA 1ABTA 1LJZA 1IKCA 3U74U 2H64B 1NTNA 2HLQA 2MJYA 1S4YA 1ZADA 4OM4A 1CB9A 1PLOA 2UWRA 3KFDE 1RL5A 1KBAA
chains in the Genus database with same CATH superfamily
3PLCA 6EBXA 1KFHA 2PJYB 1KC4A 2JQPA 1I02A 1HC9B 1MR6A 1ES7B 1FSSB 2H64C 1F94A 4HQPF 2OFSA 1IJCA 4AEAA 1FFJA 1QKEA 1KXIA 1FF4A 1JBDA 4IYEA 1KBTA 1TGXA 3KFDI 1NXBA 1V6PA 2J8BA 1KS6A 1KBSA 4XJJA 3FEVA 2CCXA 1CXOA 2H7ZB 2VLWA 2H5FA 2BTXA 2LA1A 2CRTA 2ABXA 1CXNA 2MJ4A 1F8UB 2MHYA 2K3GA 1FASA 1NEAA 1LX5B 1IK8A 1CDSA 1UG4A 4BIKB 4ZQYA 1REWC 1CTXA 1HAJA 2MUPA 1JE9A 1JGKA 1FSCA 1DRSA 2CDXA 3BT1U 1NYUA 3BT2U 2FD6U 1IDGA 1LSIA 1NYSA 5DO6A 2LCRA 1BXPA 3NDSA 2QC1A 2CRSA 1ONJA 1YWHA 1CRFA 2UX2A 5IMYC 1XT3A 2X8BB 5DU1A 2H62C 2PJYC 1QKDA 1IDLA 3EBXA 1NTXA 3LAQU 2QJ9C 1HOYA 1HAAA 1FRAA 1TFSA 3NEQA 1IDIA 4P7UA 1CHVS 2H62D 4QTIU 4FAOC 1L4WA 3NH7A 4OM5A 1COEA 3EVSC 5EBXA 4DO8A 1IQ9A 5IMTD 1TXAA 4BDTB 3VTSA 1KTZB 4KSNA 2MFAA 2QJAC 1HC9A 1CDRA 4LFTA 1QM7A 2MUOA 1LXHA 2H8UA 1ERAA 2NBTA 3ERAA 1TXBA 2GOOB 1CREA 1CODA 1IDHA 1CCQA 1BTEA 2JVEA 1CVOA 1ERGA 1VB0A 2I9BE 1NORA 2QJBC 1M9ZA 1CDTA 3HH7A 4FAOE 2H7ZA 1H0JA 2L03A 2HLRA 1G6MA 2BHIA 1RGJA 1B41B 4UY2C 1KL8A 1MAHF 1CDQA 1W6BA 2GOOC 3U73U 4EY8B 2ERAA 5DZ5A 1LXGA 2MJ0A 3QB4B 2CTXA 2L5SA 2N99A 1KU6B 4RUDA 1ABTA 1LJZA 1IKCA 3U74U 2H64B 1NTNA 2HLQA 2MJYA 1S4YA 1ZADA 4OM4A 1CB9A 1PLOA 2UWRA 3KFDE 1RL5A 1KBAA
chains in the Genus database with same CATH topology
3PLCA 6EBXA 1KFHA 2PJYB 1KC4A 2JQPA 1I02A 1HC9B 1MR6A 1ES7B 1FSSB 2H64C 1F94A 4HQPF 2OFSA 1IJCA 4AEAA 1FFJA 1QKEA 1KXIA 1FF4A 1JBDA 4IYEA 1KBTA 1TGXA 3KFDI 1NXBA 1V6PA 2J8BA 1KS6A 1KBSA 4XJJA 3FEVA 2CCXA 1CXOA 2H7ZB 2VLWA 2H5FA 2BTXA 2LA1A 2CRTA 2ABXA 1CXNA 2MJ4A 1F8UB 2MHYA 2K3GA 1FASA 1NEAA 1LX5B 1IK8A 1CDSA 1UG4A 4BIKB 4ZQYA 1REWC 1CTXA 1HAJA 2MUPA 1JE9A 1JGKA 1FSCA 1DRSA 2CDXA 3BT1U 1NYUA 3BT2U 2FD6U 1IDGA 1LSIA 1NYSA 5DO6A 2LCRA 1BXPA 3NDSA 2QC1A 2CRSA 1ONJA 1YWHA 1CRFA 2UX2A 5IMYC 1XT3A 2X8BB 5DU1A 2H62C 2PJYC 1QKDA 1IDLA 3EBXA 1NTXA 3LAQU 2QJ9C 1HOYA 1HAAA 1FRAA 1TFSA 3NEQA 1IDIA 4P7UA 1CHVS 2H62D 4QTIU 4FAOC 1L4WA 3NH7A 4OM5A 1COEA 3EVSC 5EBXA 4DO8A 1IQ9A 5IMTD 1TXAA 4BDTB 3VTSA 1KTZB 4KSNA 2MFAA 2QJAC 1HC9A 1CDRA 4LFTA 1QM7A 2MUOA 1LXHA 2H8UA 1ERAA 2NBTA 3ERAA 1TXBA 2GOOB 1CREA 1CODA 1IDHA 1CCQA 1BTEA 2JVEA 1CVOA 1ERGA 1VB0A 2I9BE 1NORA 2QJBC 1M9ZA 1CDTA 3HH7A 4FAOE 2H7ZA 1H0JA 2L03A 2HLRA 1G6MA 2BHIA 1RGJA 1B41B 4UY2C 1KL8A 1MAHF 1CDQA 1W6BA 2GOOC 3U73U 4EY8B 2ERAA 5DZ5A 1LXGA 2MJ0A 3QB4B 2CTXA 2L5SA 2N99A 1KU6B 4RUDA 1ABTA 1LJZA 1IKCA 3U74U 2H64B 1NTNA 2HLQA 2MJYA 1S4YA 1ZADA 4OM4A 1CB9A 1PLOA 2UWRA 3KFDE 1RL5A 1KBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLC A;  6EBX A;  1KFH A;  2PJY B;  1KC4 A;  2JQP A;  1I02 A;  1HC9 B;  1MR6 A;  1ES7 B;  1FSS B;  2H64 C;  1F94 A;  4HQP F;  2OFS A;  1IJC A;  4AEA A;  1FFJ A;  1QKE A;  1KXI A;  1FF4 A;  1JBD A;  4IYE A;  1KBT A;  1TGX A;  3KFD I;  1NXB A;  1V6P A;  2J8B A;  1KS6 A;  1KBS A;  4XJJ A;  3FEV A;  2CCX A;  1CXO A;  2H7Z B;  2VLW A;  2H5F A;  2BTX A;  2LA1 A;  2CRT A;  2ABX A;  1CXN A;  2MJ4 A;  1F8U B;  2MHY A;  2K3G A;  1FAS A;  1NEA A;  1LX5 B;  1IK8 A;  1CDS A;  1UG4 A;  4BIK B;  4ZQY A;  1REW C;  1CTX A;  1HAJ A;  2MUP A;  1JE9 A;  1JGK A;  1FSC A;  1DRS A;  2CDX A;  3BT1 U;  1NYU A;  3BT2 U;  2FD6 U;  1IDG A;  1LSI A;  1NYS A;  5DO6 A;  2LCR A;  1BXP A;  3NDS A;  2QC1 A;  2CRS A;  1ONJ A;  1YWH A;  1CRF A;  2UX2 A;  5IMY C;  1XT3 A;  2X8B B;  5DU1 A;  2H62 C;  2PJY C;  1QKD A;  1IDL A;  3EBX A;  1NTX A;  3LAQ U;  2QJ9 C;  1HOY A;  1HAA A;  1FRA A;  1TFS A;  3NEQ A;  1IDI A;  4P7U A;  1CHV S;  2H62 D;  4QTI U;  4FAO C;  1L4W A;  3NH7 A;  4OM5 A;  1COE A;  3EVS C;  5EBX A;  4DO8 A;  1IQ9 A;  5IMT D;  1TXA A;  4BDT B;  3VTS A;  1KTZ B;  2MFA A;  2QJA C;  1HC9 A;  1CDR A;  4LFT A;  1QM7 A;  2MUO A;  1LXH A;  2H8U A;  1ERA A;  2NBT A;  3ERA A;  1TXB A;  2GOO B;  1CRE A;  1COD A;  1IDH A;  1CCQ A;  1BTE A;  2JVE A;  1CVO A;  1ERG A;  1VB0 A;  2I9B E;  1NOR A;  2QJB C;  1M9Z A;  1CDT A;  3HH7 A;  4FAO E;  2H7Z A;  1H0J A;  2L03 A;  2HLR A;  1G6M A;  2BHI A;  1RGJ A;  1B41 B;  4UY2 C;  1KL8 A;  1MAH F;  1CDQ A;  1W6B A;  2GOO C;  3U73 U;  4EY8 B;  2ERA A;  5DZ5 A;  1LXG A;  2MJ0 A;  3QB4 B;  2CTX A;  2L5S A;  2N99 A;  1KU6 B;  4RUD A;  1ABT A;  1LJZ A;  1IKC A;  3U74 U;  2H64 B;  1NTN A;  2HLQ A;  2MJY A;  1S4Y A;  1ZAD A;  4OM4 A;  1CB9 A;  1PLO A;  2UWR A;  3KFD E;  1RL5 A;  1KBA A; 
#chains in the Genus database with same CATH topology
 3PLC A;  6EBX A;  1KFH A;  2PJY B;  1KC4 A;  2JQP A;  1I02 A;  1HC9 B;  1MR6 A;  1ES7 B;  1FSS B;  2H64 C;  1F94 A;  4HQP F;  2OFS A;  1IJC A;  4AEA A;  1FFJ A;  1QKE A;  1KXI A;  1FF4 A;  1JBD A;  4IYE A;  1KBT A;  1TGX A;  3KFD I;  1NXB A;  1V6P A;  2J8B A;  1KS6 A;  1KBS A;  4XJJ A;  3FEV A;  2CCX A;  1CXO A;  2H7Z B;  2VLW A;  2H5F A;  2BTX A;  2LA1 A;  2CRT A;  2ABX A;  1CXN A;  2MJ4 A;  1F8U B;  2MHY A;  2K3G A;  1FAS A;  1NEA A;  1LX5 B;  1IK8 A;  1CDS A;  1UG4 A;  4BIK B;  4ZQY A;  1REW C;  1CTX A;  1HAJ A;  2MUP A;  1JE9 A;  1JGK A;  1FSC A;  1DRS A;  2CDX A;  3BT1 U;  1NYU A;  3BT2 U;  2FD6 U;  1IDG A;  1LSI A;  1NYS A;  5DO6 A;  2LCR A;  1BXP A;  3NDS A;  2QC1 A;  2CRS A;  1ONJ A;  1YWH A;  1CRF A;  2UX2 A;  5IMY C;  1XT3 A;  2X8B B;  5DU1 A;  2H62 C;  2PJY C;  1QKD A;  1IDL A;  3EBX A;  1NTX A;  3LAQ U;  2QJ9 C;  1HOY A;  1HAA A;  1FRA A;  1TFS A;  3NEQ A;  1IDI A;  4P7U A;  1CHV S;  2H62 D;  4QTI U;  4FAO C;  1L4W A;  3NH7 A;  4OM5 A;  1COE A;  3EVS C;  5EBX A;  4DO8 A;  1IQ9 A;  5IMT D;  1TXA A;  4BDT B;  3VTS A;  1KTZ B;  4KSN A;  2MFA A;  2QJA C;  1HC9 A;  1CDR A;  4LFT A;  1QM7 A;  2MUO A;  1LXH A;  2H8U A;  1ERA A;  2NBT A;  3ERA A;  1TXB A;  2GOO B;  1CRE A;  1COD A;  1IDH A;  1CCQ A;  1BTE A;  2JVE A;  1CVO A;  1ERG A;  1VB0 A;  2I9B E;  1NOR A;  2QJB C;  1M9Z A;  1CDT A;  3HH7 A;  4FAO E;  2H7Z A;  1H0J A;  2L03 A;  2HLR A;  1G6M A;  2BHI A;  1RGJ A;  1B41 B;  4UY2 C;  1KL8 A;  1MAH F;  1CDQ A;  1W6B A;  2GOO C;  3U73 U;  4EY8 B;  2ERA A;  5DZ5 A;  1LXG A;  2MJ0 A;  3QB4 B;  2CTX A;  2L5S A;  2N99 A;  1KU6 B;  4RUD A;  1ABT A;  1LJZ A;  1IKC A;  3U74 U;  2H64 B;  1NTN A;  2HLQ A;  2MJY A;  1S4Y A;  1ZAD A;  4OM4 A;  1CB9 A;  1PLO A;  2UWR A;  3KFD E;  1RL5 A;  1KBA A; 
#chains in the Genus database with same CATH homology
 3PLC A;  6EBX A;  1KFH A;  2PJY B;  1KC4 A;  2JQP A;  1I02 A;  1HC9 B;  1MR6 A;  1ES7 B;  1FSS B;  2H64 C;  1F94 A;  4HQP F;  2OFS A;  1IJC A;  4AEA A;  1FFJ A;  1QKE A;  1KXI A;  1FF4 A;  1JBD A;  4IYE A;  1KBT A;  1TGX A;  3KFD I;  1NXB A;  1V6P A;  2J8B A;  1KS6 A;  1KBS A;  4XJJ A;  3FEV A;  2CCX A;  1CXO A;  2H7Z B;  2VLW A;  2H5F A;  2BTX A;  2LA1 A;  2CRT A;  2ABX A;  1CXN A;  2MJ4 A;  1F8U B;  2MHY A;  2K3G A;  1FAS A;  1NEA A;  1LX5 B;  1IK8 A;  1CDS A;  1UG4 A;  4BIK B;  4ZQY A;  1REW C;  1CTX A;  1HAJ A;  2MUP A;  1JE9 A;  1JGK A;  1FSC A;  1DRS A;  2CDX A;  3BT1 U;  1NYU A;  3BT2 U;  2FD6 U;  1IDG A;  1LSI A;  1NYS A;  5DO6 A;  2LCR A;  1BXP A;  3NDS A;  2QC1 A;  2CRS A;  1ONJ A;  1YWH A;  1CRF A;  2UX2 A;  5IMY C;  1XT3 A;  2X8B B;  5DU1 A;  2H62 C;  2PJY C;  1QKD A;  1IDL A;  3EBX A;  1NTX A;  3LAQ U;  2QJ9 C;  1HOY A;  1HAA A;  1FRA A;  1TFS A;  3NEQ A;  1IDI A;  4P7U A;  1CHV S;  2H62 D;  4QTI U;  4FAO C;  1L4W A;  3NH7 A;  4OM5 A;  1COE A;  3EVS C;  5EBX A;  4DO8 A;  1IQ9 A;  5IMT D;  1TXA A;  4BDT B;  3VTS A;  1KTZ B;  4KSN A;  2MFA A;  2QJA C;  1HC9 A;  1CDR A;  4LFT A;  1QM7 A;  2MUO A;  1LXH A;  2H8U A;  1ERA A;  2NBT A;  3ERA A;  1TXB A;  2GOO B;  1CRE A;  1COD A;  1IDH A;  1CCQ A;  1BTE A;  2JVE A;  1CVO A;  1ERG A;  1VB0 A;  2I9B E;  1NOR A;  2QJB C;  1M9Z A;  1CDT A;  3HH7 A;  4FAO E;  2H7Z A;  1H0J A;  2L03 A;  2HLR A;  1G6M A;  2BHI A;  1RGJ A;  1B41 B;  4UY2 C;  1KL8 A;  1MAH F;  1CDQ A;  1W6B A;  2GOO C;  3U73 U;  4EY8 B;  2ERA A;  5DZ5 A;  1LXG A;  2MJ0 A;  3QB4 B;  2CTX A;  2L5S A;  2N99 A;  1KU6 B;  4RUD A;  1ABT A;  1LJZ A;  1IKC A;  3U74 U;  2H64 B;  1NTN A;  2HLQ A;  2MJY A;  1S4Y A;  1ZAD A;  4OM4 A;  1CB9 A;  1PLO A;  2UWR A;  3KFD E;  1RL5 A;  1KBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...