4BIKB

Structure of a disulfide locked mutant of intermedilysin with human cd59
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
77
structure length
77
Chain Sequence
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Recognition of the Pore- Forming Toxin Intermedilysin by Human Complement Receptor Cd59
pubmed doi rcsb
source organism Streptococcus intermedius
molecule tags Immune system
molecule keywords INTERMEDILYSIN
total genus 18
structure length 77
sequence length 77
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4bikB00
2CRTA 1IJCA 1TGXA 4HQPF 1HOYA 1NYUA 2BTXA 2H62C 5IMTD 1JBDA 1KBTA 2X8BB 1RGJA 1COEA 4RUDA 1CHVS 2QJAC 1CDTA 2MFAA 1IKCA 2JVEA 2FD6U 3HH7A 1CTXA 2HLRA 5IMYC 1BTEA 2MUOA 4LFTA 1IDLA 2MUPA 2MJYA 4OM5A 1JE9A 1KTZB 2MJ4A 3PLCA 1KBAA 2NBTA 1LXHA 2LA1A 2LCRA 1F8UB 2ABXA 1FRAA 1CRFA 1LSIA 5DU1A 1NTNA 1NXBA 1CDRA 1YWHA 1IQ9A 1TXAA 3NEQA 2JQPA 2N99A 4FAOC 1KXIA 1KS6A 1CDQA 1XT3A 4P7UA 1UG4A 1NORA 2QJBC 4ZQYA 2L5SA 1S4YA 4IYEA 1ERGA 1DRSA 4XJJA 1F94A 2H7ZB 1FASA 1V6PA 2J8BA 1KC4A 5DO6A 2H64B 4OM4A 2H8UA 2CRSA 5EBXA 3EBXA 2GOOB 2I9BE 1CDSA 3BT1U 3QB4B 2MHYA 1LX5B 1ZADA 3U73U 2UX2A 4FAOE 1CCQA 1FSCA 1KFHA 3NH7A 4AEAA 1PLOA 6EBXA 1G6MA 1RL5A 3KFDI 4DO8A 1MR6A 1CREA 1NYSA 2PJYB 2CDXA 2HLQA 1KL8A 3ERAA 1IDHA 2PJYC 1TFSA 2K3GA 1KBSA 2QJ9C 1BXPA 1QKDA 2H7ZA 1HC9B 1LJZA 2ERAA 2H5FA 1HC9A 1ERAA 1FSSB 1REWC 4QTIU 1I02A 1ABTA 1IK8A 4UY2C 3FEVA 1ES7B 1IDGA 1VB0A 1H0JA 1FF4A 2GOOC 1MAHF 1CVOA 3BT2U 1CXOA 1KU6B 3KFDE 2MJ0A 2QC1A 1L4WA 2H64C 1B41B 2CCXA 1CXNA 2L03A 3VTSA 2H62D 2CTXA 1HAJA 1NEAA 3U74U 1W6BA 1ONJA 4EY8B 2BHIA 1FFJA 4BDTB 5DZ5A 1LXGA 3NDSA 2VLWA 1QM7A 1IDIA 3EVSC 1JGKA 1QKEA 1TXBA 1M9ZA 1CODA 2OFSA 2UWRA 4BIKB 1NTXA 1CB9A 3LAQU 1HAAA
chains in the Genus database with same CATH superfamily
2CRTA 1IJCA 1TGXA 4HQPF 1HOYA 1NYUA 2BTXA 2H62C 5IMTD 1JBDA 1KBTA 2X8BB 1RGJA 1COEA 4RUDA 1CHVS 4KSNA 2QJAC 1CDTA 2MFAA 1IKCA 2JVEA 2FD6U 3HH7A 1CTXA 2HLRA 5IMYC 1BTEA 2MUOA 4LFTA 1IDLA 2MUPA 2MJYA 4OM5A 1JE9A 1KTZB 2MJ4A 3PLCA 1KBAA 2NBTA 1LXHA 2LA1A 2LCRA 1F8UB 2ABXA 1FRAA 1CRFA 1LSIA 5DU1A 1NTNA 1NXBA 1CDRA 1YWHA 1IQ9A 1TXAA 3NEQA 2JQPA 2N99A 4FAOC 1KXIA 1KS6A 1CDQA 1XT3A 4P7UA 1UG4A 1NORA 2QJBC 4ZQYA 2L5SA 1S4YA 4IYEA 1ERGA 1DRSA 4XJJA 1F94A 2H7ZB 1FASA 1V6PA 2J8BA 1KC4A 5DO6A 2H64B 4OM4A 2H8UA 2CRSA 5EBXA 3EBXA 2GOOB 2I9BE 1CDSA 3BT1U 3QB4B 2MHYA 1LX5B 1ZADA 3U73U 2UX2A 4FAOE 1CCQA 1FSCA 1KFHA 3NH7A 4AEAA 1PLOA 6EBXA 1G6MA 1RL5A 3KFDI 4DO8A 1MR6A 1CREA 1NYSA 2PJYB 2CDXA 2HLQA 1KL8A 3ERAA 1IDHA 2PJYC 1TFSA 2K3GA 1KBSA 2QJ9C 1BXPA 1QKDA 2H7ZA 1HC9B 1LJZA 2ERAA 2H5FA 1HC9A 1ERAA 1FSSB 1REWC 4QTIU 1I02A 1ABTA 1IK8A 4UY2C 3FEVA 1ES7B 1IDGA 1VB0A 1H0JA 1FF4A 2GOOC 1MAHF 1CVOA 3BT2U 1CXOA 1KU6B 3KFDE 2MJ0A 2QC1A 1L4WA 2H64C 1B41B 2CCXA 1CXNA 2L03A 3VTSA 2H62D 2CTXA 1HAJA 1NEAA 3U74U 1W6BA 1ONJA 4EY8B 2BHIA 1FFJA 4BDTB 5DZ5A 1LXGA 3NDSA 2VLWA 1QM7A 1IDIA 3EVSC 1JGKA 1QKEA 1TXBA 1M9ZA 1CODA 2OFSA 2UWRA 4BIKB 1NTXA 1CB9A 3LAQU 1HAAA
chains in the Genus database with same CATH topology
2CRTA 1IJCA 1TGXA 4HQPF 1HOYA 1NYUA 2BTXA 2H62C 5IMTD 1JBDA 1KBTA 2X8BB 1RGJA 1COEA 4RUDA 1CHVS 4KSNA 2QJAC 1CDTA 2MFAA 1IKCA 2JVEA 2FD6U 3HH7A 1CTXA 2HLRA 5IMYC 1BTEA 2MUOA 4LFTA 1IDLA 2MUPA 2MJYA 4OM5A 1JE9A 1KTZB 2MJ4A 3PLCA 1KBAA 2NBTA 1LXHA 2LA1A 2LCRA 1F8UB 2ABXA 1FRAA 1CRFA 1LSIA 5DU1A 1NTNA 1NXBA 1CDRA 1YWHA 1IQ9A 1TXAA 3NEQA 2JQPA 2N99A 4FAOC 1KXIA 1KS6A 1CDQA 1XT3A 4P7UA 1UG4A 1NORA 2QJBC 4ZQYA 2L5SA 1S4YA 4IYEA 1ERGA 1DRSA 4XJJA 1F94A 2H7ZB 1FASA 1V6PA 2J8BA 1KC4A 5DO6A 2H64B 4OM4A 2H8UA 2CRSA 5EBXA 3EBXA 2GOOB 2I9BE 1CDSA 3BT1U 3QB4B 2MHYA 1LX5B 1ZADA 3U73U 2UX2A 4FAOE 1CCQA 1FSCA 1KFHA 3NH7A 4AEAA 1PLOA 6EBXA 1G6MA 1RL5A 3KFDI 4DO8A 1MR6A 1CREA 1NYSA 2PJYB 2CDXA 2HLQA 1KL8A 3ERAA 1IDHA 2PJYC 1TFSA 2K3GA 1KBSA 2QJ9C 1BXPA 1QKDA 2H7ZA 1HC9B 1LJZA 2ERAA 2H5FA 1HC9A 1ERAA 1FSSB 1REWC 4QTIU 1I02A 1ABTA 1IK8A 4UY2C 3FEVA 1ES7B 1IDGA 1VB0A 1H0JA 1FF4A 2GOOC 1MAHF 1CVOA 3BT2U 1CXOA 1KU6B 3KFDE 2MJ0A 2QC1A 1L4WA 2H64C 1B41B 2CCXA 1CXNA 2L03A 3VTSA 2H62D 2CTXA 1HAJA 1NEAA 3U74U 1W6BA 1ONJA 4EY8B 2BHIA 1FFJA 4BDTB 5DZ5A 1LXGA 3NDSA 2VLWA 1QM7A 1IDIA 3EVSC 1JGKA 1QKEA 1TXBA 1M9ZA 1CODA 2OFSA 2UWRA 4BIKB 1NTXA 1CB9A 3LAQU 1HAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRT A;  1IJC A;  1TGX A;  4HQP F;  1HOY A;  1NYU A;  2BTX A;  2H62 C;  5IMT D;  1JBD A;  1KBT A;  2X8B B;  1RGJ A;  1COE A;  4RUD A;  1CHV S;  2QJA C;  1CDT A;  2MFA A;  1IKC A;  2JVE A;  2FD6 U;  3HH7 A;  1CTX A;  2HLR A;  5IMY C;  1BTE A;  2MUO A;  4LFT A;  1IDL A;  2MUP A;  2MJY A;  4OM5 A;  1JE9 A;  1KTZ B;  2MJ4 A;  3PLC A;  1KBA A;  2NBT A;  1LXH A;  2LA1 A;  2LCR A;  1F8U B;  2ABX A;  1FRA A;  1CRF A;  1LSI A;  5DU1 A;  1NTN A;  1NXB A;  1CDR A;  1YWH A;  1IQ9 A;  1TXA A;  3NEQ A;  2JQP A;  2N99 A;  4FAO C;  1KXI A;  1KS6 A;  1CDQ A;  1XT3 A;  4P7U A;  1UG4 A;  1NOR A;  2QJB C;  4ZQY A;  2L5S A;  1S4Y A;  4IYE A;  1ERG A;  1DRS A;  4XJJ A;  1F94 A;  2H7Z B;  1FAS A;  1V6P A;  2J8B A;  1KC4 A;  5DO6 A;  2H64 B;  4OM4 A;  2H8U A;  2CRS A;  5EBX A;  3EBX A;  2GOO B;  2I9B E;  1CDS A;  3BT1 U;  3QB4 B;  2MHY A;  1LX5 B;  1ZAD A;  3U73 U;  2UX2 A;  4FAO E;  1CCQ A;  1FSC A;  1KFH A;  3NH7 A;  4AEA A;  1PLO A;  6EBX A;  1G6M A;  1RL5 A;  3KFD I;  4DO8 A;  1MR6 A;  1CRE A;  1NYS A;  2PJY B;  2CDX A;  2HLQ A;  1KL8 A;  3ERA A;  1IDH A;  2PJY C;  1TFS A;  2K3G A;  1KBS A;  2QJ9 C;  1BXP A;  1QKD A;  2H7Z A;  1HC9 B;  1LJZ A;  2ERA A;  2H5F A;  1HC9 A;  1ERA A;  1FSS B;  1REW C;  4QTI U;  1I02 A;  1ABT A;  1IK8 A;  4UY2 C;  3FEV A;  1ES7 B;  1IDG A;  1VB0 A;  1H0J A;  1FF4 A;  2GOO C;  1MAH F;  1CVO A;  3BT2 U;  1CXO A;  1KU6 B;  3KFD E;  2MJ0 A;  2QC1 A;  1L4W A;  2H64 C;  1B41 B;  2CCX A;  1CXN A;  2L03 A;  3VTS A;  2H62 D;  2CTX A;  1HAJ A;  1NEA A;  3U74 U;  1W6B A;  1ONJ A;  4EY8 B;  2BHI A;  1FFJ A;  4BDT B;  5DZ5 A;  1LXG A;  3NDS A;  2VLW A;  1QM7 A;  1IDI A;  3EVS C;  1JGK A;  1QKE A;  1TXB A;  1M9Z A;  1COD A;  2OFS A;  2UWR A;  4BIK B;  1NTX A;  1CB9 A;  3LAQ U;  1HAA A; 
#chains in the Genus database with same CATH topology
 2CRT A;  1IJC A;  1TGX A;  4HQP F;  1HOY A;  1NYU A;  2BTX A;  2H62 C;  5IMT D;  1JBD A;  1KBT A;  2X8B B;  1RGJ A;  1COE A;  4RUD A;  1CHV S;  4KSN A;  2QJA C;  1CDT A;  2MFA A;  1IKC A;  2JVE A;  2FD6 U;  3HH7 A;  1CTX A;  2HLR A;  5IMY C;  1BTE A;  2MUO A;  4LFT A;  1IDL A;  2MUP A;  2MJY A;  4OM5 A;  1JE9 A;  1KTZ B;  2MJ4 A;  3PLC A;  1KBA A;  2NBT A;  1LXH A;  2LA1 A;  2LCR A;  1F8U B;  2ABX A;  1FRA A;  1CRF A;  1LSI A;  5DU1 A;  1NTN A;  1NXB A;  1CDR A;  1YWH A;  1IQ9 A;  1TXA A;  3NEQ A;  2JQP A;  2N99 A;  4FAO C;  1KXI A;  1KS6 A;  1CDQ A;  1XT3 A;  4P7U A;  1UG4 A;  1NOR A;  2QJB C;  4ZQY A;  2L5S A;  1S4Y A;  4IYE A;  1ERG A;  1DRS A;  4XJJ A;  1F94 A;  2H7Z B;  1FAS A;  1V6P A;  2J8B A;  1KC4 A;  5DO6 A;  2H64 B;  4OM4 A;  2H8U A;  2CRS A;  5EBX A;  3EBX A;  2GOO B;  2I9B E;  1CDS A;  3BT1 U;  3QB4 B;  2MHY A;  1LX5 B;  1ZAD A;  3U73 U;  2UX2 A;  4FAO E;  1CCQ A;  1FSC A;  1KFH A;  3NH7 A;  4AEA A;  1PLO A;  6EBX A;  1G6M A;  1RL5 A;  3KFD I;  4DO8 A;  1MR6 A;  1CRE A;  1NYS A;  2PJY B;  2CDX A;  2HLQ A;  1KL8 A;  3ERA A;  1IDH A;  2PJY C;  1TFS A;  2K3G A;  1KBS A;  2QJ9 C;  1BXP A;  1QKD A;  2H7Z A;  1HC9 B;  1LJZ A;  2ERA A;  2H5F A;  1HC9 A;  1ERA A;  1FSS B;  1REW C;  4QTI U;  1I02 A;  1ABT A;  1IK8 A;  4UY2 C;  3FEV A;  1ES7 B;  1IDG A;  1VB0 A;  1H0J A;  1FF4 A;  2GOO C;  1MAH F;  1CVO A;  3BT2 U;  1CXO A;  1KU6 B;  3KFD E;  2MJ0 A;  2QC1 A;  1L4W A;  2H64 C;  1B41 B;  2CCX A;  1CXN A;  2L03 A;  3VTS A;  2H62 D;  2CTX A;  1HAJ A;  1NEA A;  3U74 U;  1W6B A;  1ONJ A;  4EY8 B;  2BHI A;  1FFJ A;  4BDT B;  5DZ5 A;  1LXG A;  3NDS A;  2VLW A;  1QM7 A;  1IDI A;  3EVS C;  1JGK A;  1QKE A;  1TXB A;  1M9Z A;  1COD A;  2OFS A;  2UWR A;  4BIK B;  1NTX A;  1CB9 A;  3LAQ U;  1HAA A; 
#chains in the Genus database with same CATH homology
 2CRT A;  1IJC A;  1TGX A;  4HQP F;  1HOY A;  1NYU A;  2BTX A;  2H62 C;  5IMT D;  1JBD A;  1KBT A;  2X8B B;  1RGJ A;  1COE A;  4RUD A;  1CHV S;  4KSN A;  2QJA C;  1CDT A;  2MFA A;  1IKC A;  2JVE A;  2FD6 U;  3HH7 A;  1CTX A;  2HLR A;  5IMY C;  1BTE A;  2MUO A;  4LFT A;  1IDL A;  2MUP A;  2MJY A;  4OM5 A;  1JE9 A;  1KTZ B;  2MJ4 A;  3PLC A;  1KBA A;  2NBT A;  1LXH A;  2LA1 A;  2LCR A;  1F8U B;  2ABX A;  1FRA A;  1CRF A;  1LSI A;  5DU1 A;  1NTN A;  1NXB A;  1CDR A;  1YWH A;  1IQ9 A;  1TXA A;  3NEQ A;  2JQP A;  2N99 A;  4FAO C;  1KXI A;  1KS6 A;  1CDQ A;  1XT3 A;  4P7U A;  1UG4 A;  1NOR A;  2QJB C;  4ZQY A;  2L5S A;  1S4Y A;  4IYE A;  1ERG A;  1DRS A;  4XJJ A;  1F94 A;  2H7Z B;  1FAS A;  1V6P A;  2J8B A;  1KC4 A;  5DO6 A;  2H64 B;  4OM4 A;  2H8U A;  2CRS A;  5EBX A;  3EBX A;  2GOO B;  2I9B E;  1CDS A;  3BT1 U;  3QB4 B;  2MHY A;  1LX5 B;  1ZAD A;  3U73 U;  2UX2 A;  4FAO E;  1CCQ A;  1FSC A;  1KFH A;  3NH7 A;  4AEA A;  1PLO A;  6EBX A;  1G6M A;  1RL5 A;  3KFD I;  4DO8 A;  1MR6 A;  1CRE A;  1NYS A;  2PJY B;  2CDX A;  2HLQ A;  1KL8 A;  3ERA A;  1IDH A;  2PJY C;  1TFS A;  2K3G A;  1KBS A;  2QJ9 C;  1BXP A;  1QKD A;  2H7Z A;  1HC9 B;  1LJZ A;  2ERA A;  2H5F A;  1HC9 A;  1ERA A;  1FSS B;  1REW C;  4QTI U;  1I02 A;  1ABT A;  1IK8 A;  4UY2 C;  3FEV A;  1ES7 B;  1IDG A;  1VB0 A;  1H0J A;  1FF4 A;  2GOO C;  1MAH F;  1CVO A;  3BT2 U;  1CXO A;  1KU6 B;  3KFD E;  2MJ0 A;  2QC1 A;  1L4W A;  2H64 C;  1B41 B;  2CCX A;  1CXN A;  2L03 A;  3VTS A;  2H62 D;  2CTX A;  1HAJ A;  1NEA A;  3U74 U;  1W6B A;  1ONJ A;  4EY8 B;  2BHI A;  1FFJ A;  4BDT B;  5DZ5 A;  1LXG A;  3NDS A;  2VLW A;  1QM7 A;  1IDI A;  3EVS C;  1JGK A;  1QKE A;  1TXB A;  1M9Z A;  1COD A;  2OFS A;  2UWR A;  4BIK B;  1NTX A;  1CB9 A;  3LAQ U;  1HAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...