4BIKB

Structure of a disulfide locked mutant of intermedilysin with human cd59
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
77
structure length
77
Chain Sequence
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords INTERMEDILYSIN
publication title Structural Basis for Recognition of the Pore- Forming Toxin Intermedilysin by Human Complement Receptor Cd59
pubmed doi rcsb
source organism Streptococcus intermedius
total genus 18
structure length 77
sequence length 77
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4bikB00
1CODA 1UG4A 4RUDA 2LCRA 2UWRA 1NTXA 1MR6A 2J8BA 1HAAA 1NYSA 1FSSB 2I9BE 1DRSA 4UY2C 1KC4A 1REWC 3FEVA 1V6PA 1I02A 2H64C 2JVEA 4AEAA 2CDXA 3EBXA 2H64B 1CXNA 1IDHA 1IK8A 2MJ4A 1CXOA 1NORA 2ABXA 1KFHA 3BT1U 1LXHA 1CHVS 4OM4A 1NXBA 1ES7B 1ERGA 5EBXA 1F94A 2CCXA 1TFSA 2H62D 1KBSA 2H5FA 2MFAA 2GOOC 1W6BA 2H62C 3QB4B 4IYEA 2QJAC 2GOOB 1BTEA 5DO6A 1CB9A 1CDRA 1ONJA 1IDGA 2VLWA 1TXBA 2HLQA 2OFSA 3EVSC 3LAQU 3NH7A 4XJJA 1CVOA 1VB0A 2QJ9C 3NDSA 1QM7A 3HH7A 5DU1A 2BTXA 1S4YA 4DO8A 1TGXA 1KTZB 3VTSA 5IMTD 1BXPA 2CTXA 1RL5A 1CDTA 2CRTA 2MUPA 1ERAA 2H7ZB 1B41B 1KXIA 1KBTA 2K3GA 2X8BB 3ERAA 1JGKA 2ERAA 1JBDA 1LXGA 4ZQYA 1HC9B 3PLCA 4BIKB 2QC1A 2HLRA 2UX2A 1F8UB 1YWHA 1HOYA 1CCQA 1IDIA 1NTNA 2QJBC 1TXAA 1H0JA 1FSCA 2LA1A 3KFDE 1CDSA 1L4WA 1LJZA 1LSIA 2MUOA 3U74U 1QKEA 3BT2U 2FD6U 2H8UA 1HAJA 3U73U 4QTIU 4FAOC 1FASA 1LX5B 1HC9A 1NEAA 2NBTA 1IDLA 2N99A 1KU6B 4HQPF 1KL8A 5DZ5A 1COEA 6EBXA 1KS6A 2PJYC 1IJCA 1QKDA 1CRFA 1FRAA 2MHYA 2PJYB 2L5SA 4LFTA 4FAOE 1ZADA 4OM5A 1CREA 1NYUA 1KBAA 5IMYC 1G6MA 1PLOA 2MJ0A 1MAHF 1FF4A 3NEQA 1JE9A 1CDQA 4BDTB 3KFDI 2H7ZA 1RGJA 1CTXA 1IKCA 1IQ9A 2BHIA 2JQPA 1ABTA 4EY8B 1XT3A 2CRSA 4P7UA 2MJYA 1M9ZA 2L03A 1FFJA
chains in the Genus database with same CATH superfamily
1CODA 1UG4A 4RUDA 2LCRA 2UWRA 1NTXA 1MR6A 2J8BA 1HAAA 1NYSA 1FSSB 2I9BE 1DRSA 4UY2C 1KC4A 1REWC 3FEVA 1V6PA 1I02A 2H64C 2JVEA 4AEAA 2CDXA 3EBXA 2H64B 1CXNA 1IDHA 1IK8A 2MJ4A 1CXOA 1NORA 2ABXA 1KFHA 3BT1U 1LXHA 1CHVS 4OM4A 1NXBA 1ES7B 1ERGA 5EBXA 1F94A 2CCXA 1TFSA 2H62D 1KBSA 2H5FA 2MFAA 2GOOC 1W6BA 2H62C 3QB4B 4IYEA 2QJAC 2GOOB 1BTEA 5DO6A 1CB9A 1CDRA 1ONJA 1IDGA 2VLWA 1TXBA 2HLQA 2OFSA 3EVSC 3LAQU 3NH7A 4XJJA 1CVOA 1VB0A 2QJ9C 3NDSA 1QM7A 3HH7A 5DU1A 2BTXA 1S4YA 4DO8A 1TGXA 1KTZB 3VTSA 5IMTD 1BXPA 2CTXA 1RL5A 1CDTA 2CRTA 2MUPA 1ERAA 2H7ZB 1B41B 1KXIA 1KBTA 2K3GA 2X8BB 3ERAA 1JGKA 2ERAA 1JBDA 1LXGA 4ZQYA 1HC9B 3PLCA 4BIKB 2QC1A 2HLRA 2UX2A 1F8UB 1YWHA 1HOYA 1CCQA 1IDIA 1NTNA 2QJBC 1TXAA 1H0JA 1FSCA 2LA1A 3KFDE 1CDSA 1L4WA 1LJZA 1LSIA 2MUOA 3U74U 1QKEA 3BT2U 2FD6U 2H8UA 1HAJA 3U73U 4QTIU 4FAOC 1FASA 1LX5B 1HC9A 1NEAA 2NBTA 1IDLA 2N99A 1KU6B 4HQPF 1KL8A 5DZ5A 1COEA 6EBXA 1KS6A 4KSNA 2PJYC 1IJCA 1QKDA 1CRFA 1FRAA 2MHYA 2PJYB 2L5SA 4LFTA 4FAOE 1ZADA 4OM5A 1CREA 1NYUA 1KBAA 5IMYC 1G6MA 1PLOA 2MJ0A 1MAHF 1FF4A 3NEQA 1JE9A 1CDQA 4BDTB 3KFDI 2H7ZA 1RGJA 1CTXA 1IKCA 1IQ9A 2BHIA 2JQPA 1ABTA 4EY8B 1XT3A 2CRSA 4P7UA 2MJYA 1M9ZA 2L03A 1FFJA
chains in the Genus database with same CATH topology
1CODA 1UG4A 4RUDA 2LCRA 2UWRA 1NTXA 1MR6A 2J8BA 1HAAA 1NYSA 1FSSB 2I9BE 1DRSA 4UY2C 1KC4A 1REWC 3FEVA 1V6PA 1I02A 2H64C 2JVEA 4AEAA 2CDXA 3EBXA 2H64B 1CXNA 1IDHA 1IK8A 2MJ4A 1CXOA 1NORA 2ABXA 1KFHA 3BT1U 1LXHA 1CHVS 4OM4A 1NXBA 1ES7B 1ERGA 5EBXA 1F94A 2CCXA 1TFSA 2H62D 1KBSA 2H5FA 2MFAA 2GOOC 1W6BA 2H62C 3QB4B 4IYEA 2QJAC 2GOOB 1BTEA 5DO6A 1CB9A 1CDRA 1ONJA 1IDGA 2VLWA 1TXBA 2HLQA 2OFSA 3EVSC 3LAQU 3NH7A 4XJJA 1CVOA 1VB0A 2QJ9C 3NDSA 1QM7A 3HH7A 5DU1A 2BTXA 1S4YA 4DO8A 1TGXA 1KTZB 3VTSA 5IMTD 1BXPA 2CTXA 1RL5A 1CDTA 2CRTA 2MUPA 1ERAA 2H7ZB 1B41B 1KXIA 1KBTA 2K3GA 2X8BB 3ERAA 1JGKA 2ERAA 1JBDA 1LXGA 4ZQYA 1HC9B 3PLCA 4BIKB 2QC1A 2HLRA 2UX2A 1F8UB 1YWHA 1HOYA 1CCQA 1IDIA 1NTNA 2QJBC 1TXAA 1H0JA 1FSCA 2LA1A 3KFDE 1CDSA 1L4WA 1LJZA 1LSIA 2MUOA 3U74U 1QKEA 3BT2U 2FD6U 2H8UA 1HAJA 3U73U 4QTIU 4FAOC 1FASA 1LX5B 1HC9A 1NEAA 2NBTA 1IDLA 2N99A 1KU6B 4HQPF 1KL8A 5DZ5A 1COEA 6EBXA 1KS6A 4KSNA 2PJYC 1IJCA 1QKDA 1CRFA 1FRAA 2MHYA 2PJYB 2L5SA 4LFTA 4FAOE 1ZADA 4OM5A 1CREA 1NYUA 1KBAA 5IMYC 1G6MA 1PLOA 2MJ0A 1MAHF 1FF4A 3NEQA 1JE9A 1CDQA 4BDTB 3KFDI 2H7ZA 1RGJA 1CTXA 1IKCA 1IQ9A 2BHIA 2JQPA 1ABTA 4EY8B 1XT3A 2CRSA 4P7UA 2MJYA 1M9ZA 2L03A 1FFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COD A;  1UG4 A;  4RUD A;  2LCR A;  2UWR A;  1NTX A;  1MR6 A;  2J8B A;  1HAA A;  1NYS A;  1FSS B;  2I9B E;  1DRS A;  4UY2 C;  1KC4 A;  1REW C;  3FEV A;  1V6P A;  1I02 A;  2H64 C;  2JVE A;  4AEA A;  2CDX A;  3EBX A;  2H64 B;  1CXN A;  1IDH A;  1IK8 A;  2MJ4 A;  1CXO A;  1NOR A;  2ABX A;  1KFH A;  3BT1 U;  1LXH A;  1CHV S;  4OM4 A;  1NXB A;  1ES7 B;  1ERG A;  5EBX A;  1F94 A;  2CCX A;  1TFS A;  2H62 D;  1KBS A;  2H5F A;  2MFA A;  2GOO C;  1W6B A;  2H62 C;  3QB4 B;  4IYE A;  2QJA C;  2GOO B;  1BTE A;  5DO6 A;  1CB9 A;  1CDR A;  1ONJ A;  1IDG A;  2VLW A;  1TXB A;  2HLQ A;  2OFS A;  3EVS C;  3LAQ U;  3NH7 A;  4XJJ A;  1CVO A;  1VB0 A;  2QJ9 C;  3NDS A;  1QM7 A;  3HH7 A;  5DU1 A;  2BTX A;  1S4Y A;  4DO8 A;  1TGX A;  1KTZ B;  3VTS A;  5IMT D;  1BXP A;  2CTX A;  1RL5 A;  1CDT A;  2CRT A;  2MUP A;  1ERA A;  2H7Z B;  1B41 B;  1KXI A;  1KBT A;  2K3G A;  2X8B B;  3ERA A;  1JGK A;  2ERA A;  1JBD A;  1LXG A;  4ZQY A;  1HC9 B;  3PLC A;  4BIK B;  2QC1 A;  2HLR A;  2UX2 A;  1F8U B;  1YWH A;  1HOY A;  1CCQ A;  1IDI A;  1NTN A;  2QJB C;  1TXA A;  1H0J A;  1FSC A;  2LA1 A;  3KFD E;  1CDS A;  1L4W A;  1LJZ A;  1LSI A;  2MUO A;  3U74 U;  1QKE A;  3BT2 U;  2FD6 U;  2H8U A;  1HAJ A;  3U73 U;  4QTI U;  4FAO C;  1FAS A;  1LX5 B;  1HC9 A;  1NEA A;  2NBT A;  1IDL A;  2N99 A;  1KU6 B;  4HQP F;  1KL8 A;  5DZ5 A;  1COE A;  6EBX A;  1KS6 A;  2PJY C;  1IJC A;  1QKD A;  1CRF A;  1FRA A;  2MHY A;  2PJY B;  2L5S A;  4LFT A;  4FAO E;  1ZAD A;  4OM5 A;  1CRE A;  1NYU A;  1KBA A;  5IMY C;  1G6M A;  1PLO A;  2MJ0 A;  1MAH F;  1FF4 A;  3NEQ A;  1JE9 A;  1CDQ A;  4BDT B;  3KFD I;  2H7Z A;  1RGJ A;  1CTX A;  1IKC A;  1IQ9 A;  2BHI A;  2JQP A;  1ABT A;  4EY8 B;  1XT3 A;  2CRS A;  4P7U A;  2MJY A;  1M9Z A;  2L03 A;  1FFJ A; 
#chains in the Genus database with same CATH topology
 1COD A;  1UG4 A;  4RUD A;  2LCR A;  2UWR A;  1NTX A;  1MR6 A;  2J8B A;  1HAA A;  1NYS A;  1FSS B;  2I9B E;  1DRS A;  4UY2 C;  1KC4 A;  1REW C;  3FEV A;  1V6P A;  1I02 A;  2H64 C;  2JVE A;  4AEA A;  2CDX A;  3EBX A;  2H64 B;  1CXN A;  1IDH A;  1IK8 A;  2MJ4 A;  1CXO A;  1NOR A;  2ABX A;  1KFH A;  3BT1 U;  1LXH A;  1CHV S;  4OM4 A;  1NXB A;  1ES7 B;  1ERG A;  5EBX A;  1F94 A;  2CCX A;  1TFS A;  2H62 D;  1KBS A;  2H5F A;  2MFA A;  2GOO C;  1W6B A;  2H62 C;  3QB4 B;  4IYE A;  2QJA C;  2GOO B;  1BTE A;  5DO6 A;  1CB9 A;  1CDR A;  1ONJ A;  1IDG A;  2VLW A;  1TXB A;  2HLQ A;  2OFS A;  3EVS C;  3LAQ U;  3NH7 A;  4XJJ A;  1CVO A;  1VB0 A;  2QJ9 C;  3NDS A;  1QM7 A;  3HH7 A;  5DU1 A;  2BTX A;  1S4Y A;  4DO8 A;  1TGX A;  1KTZ B;  3VTS A;  5IMT D;  1BXP A;  2CTX A;  1RL5 A;  1CDT A;  2CRT A;  2MUP A;  1ERA A;  2H7Z B;  1B41 B;  1KXI A;  1KBT A;  2K3G A;  2X8B B;  3ERA A;  1JGK A;  2ERA A;  1JBD A;  1LXG A;  4ZQY A;  1HC9 B;  3PLC A;  4BIK B;  2QC1 A;  2HLR A;  2UX2 A;  1F8U B;  1YWH A;  1HOY A;  1CCQ A;  1IDI A;  1NTN A;  2QJB C;  1TXA A;  1H0J A;  1FSC A;  2LA1 A;  3KFD E;  1CDS A;  1L4W A;  1LJZ A;  1LSI A;  2MUO A;  3U74 U;  1QKE A;  3BT2 U;  2FD6 U;  2H8U A;  1HAJ A;  3U73 U;  4QTI U;  4FAO C;  1FAS A;  1LX5 B;  1HC9 A;  1NEA A;  2NBT A;  1IDL A;  2N99 A;  1KU6 B;  4HQP F;  1KL8 A;  5DZ5 A;  1COE A;  6EBX A;  1KS6 A;  4KSN A;  2PJY C;  1IJC A;  1QKD A;  1CRF A;  1FRA A;  2MHY A;  2PJY B;  2L5S A;  4LFT A;  4FAO E;  1ZAD A;  4OM5 A;  1CRE A;  1NYU A;  1KBA A;  5IMY C;  1G6M A;  1PLO A;  2MJ0 A;  1MAH F;  1FF4 A;  3NEQ A;  1JE9 A;  1CDQ A;  4BDT B;  3KFD I;  2H7Z A;  1RGJ A;  1CTX A;  1IKC A;  1IQ9 A;  2BHI A;  2JQP A;  1ABT A;  4EY8 B;  1XT3 A;  2CRS A;  4P7U A;  2MJY A;  1M9Z A;  2L03 A;  1FFJ A; 
#chains in the Genus database with same CATH homology
 1COD A;  1UG4 A;  4RUD A;  2LCR A;  2UWR A;  1NTX A;  1MR6 A;  2J8B A;  1HAA A;  1NYS A;  1FSS B;  2I9B E;  1DRS A;  4UY2 C;  1KC4 A;  1REW C;  3FEV A;  1V6P A;  1I02 A;  2H64 C;  2JVE A;  4AEA A;  2CDX A;  3EBX A;  2H64 B;  1CXN A;  1IDH A;  1IK8 A;  2MJ4 A;  1CXO A;  1NOR A;  2ABX A;  1KFH A;  3BT1 U;  1LXH A;  1CHV S;  4OM4 A;  1NXB A;  1ES7 B;  1ERG A;  5EBX A;  1F94 A;  2CCX A;  1TFS A;  2H62 D;  1KBS A;  2H5F A;  2MFA A;  2GOO C;  1W6B A;  2H62 C;  3QB4 B;  4IYE A;  2QJA C;  2GOO B;  1BTE A;  5DO6 A;  1CB9 A;  1CDR A;  1ONJ A;  1IDG A;  2VLW A;  1TXB A;  2HLQ A;  2OFS A;  3EVS C;  3LAQ U;  3NH7 A;  4XJJ A;  1CVO A;  1VB0 A;  2QJ9 C;  3NDS A;  1QM7 A;  3HH7 A;  5DU1 A;  2BTX A;  1S4Y A;  4DO8 A;  1TGX A;  1KTZ B;  3VTS A;  5IMT D;  1BXP A;  2CTX A;  1RL5 A;  1CDT A;  2CRT A;  2MUP A;  1ERA A;  2H7Z B;  1B41 B;  1KXI A;  1KBT A;  2K3G A;  2X8B B;  3ERA A;  1JGK A;  2ERA A;  1JBD A;  1LXG A;  4ZQY A;  1HC9 B;  3PLC A;  4BIK B;  2QC1 A;  2HLR A;  2UX2 A;  1F8U B;  1YWH A;  1HOY A;  1CCQ A;  1IDI A;  1NTN A;  2QJB C;  1TXA A;  1H0J A;  1FSC A;  2LA1 A;  3KFD E;  1CDS A;  1L4W A;  1LJZ A;  1LSI A;  2MUO A;  3U74 U;  1QKE A;  3BT2 U;  2FD6 U;  2H8U A;  1HAJ A;  3U73 U;  4QTI U;  4FAO C;  1FAS A;  1LX5 B;  1HC9 A;  1NEA A;  2NBT A;  1IDL A;  2N99 A;  1KU6 B;  4HQP F;  1KL8 A;  5DZ5 A;  1COE A;  6EBX A;  1KS6 A;  4KSN A;  2PJY C;  1IJC A;  1QKD A;  1CRF A;  1FRA A;  2MHY A;  2PJY B;  2L5S A;  4LFT A;  4FAO E;  1ZAD A;  4OM5 A;  1CRE A;  1NYU A;  1KBA A;  5IMY C;  1G6M A;  1PLO A;  2MJ0 A;  1MAH F;  1FF4 A;  3NEQ A;  1JE9 A;  1CDQ A;  4BDT B;  3KFD I;  2H7Z A;  1RGJ A;  1CTX A;  1IKC A;  1IQ9 A;  2BHI A;  2JQP A;  1ABT A;  4EY8 B;  1XT3 A;  2CRS A;  4P7U A;  2MJY A;  1M9Z A;  2L03 A;  1FFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...