6EBXA

Structure determination of a dimeric form of erabutoxin b, crystallized from thiocyanate solution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ERABUTOXIN B
publication title Structure determination of a dimeric form of erabutoxin-b, crystallized from a thiocyanate solution.
pubmed doi rcsb
source organism Laticauda semifasciata
total genus 11
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 6ebxA00
4HQPF 4AEAA 2H62C 1KXIA 2BTXA 1DRSA 3BT1U 2CDXA 3NEQA 1NYSA 2HLQA 1F94A 1CDSA 3EVSC 1V6PA 1KFHA 1LXHA 1B41B 1NTXA 1FFJA 1KBAA 1CHVS 2ERAA 2N99A 1NYUA 2MUPA 1MR6A 1ONJA 4RUDA 1LJZA 1RGJA 3LAQU 3ERAA 2K3GA 3VTSA 1RL5A 1LSIA 2LA1A 1JBDA 1QKDA 1LX5B 2QJBC 2UWRA 1IDLA 2LCRA 2MJ4A 2X8BB 1KU6B 4LFTA 2I9BE 2MJ0A 1IJCA 1CCQA 1KC4A 1L4WA 2H62D 2OFSA 1CVOA 5DZ5A 2BHIA 3NDSA 1M9ZA 2CCXA 1HAAA 2CRTA 1CDRA 1H0JA 2GOOC 5DU1A 2VLWA 1FF4A 3U73U 1KS6A 2CRSA 2MUOA 5IMTD 1KBSA 1QKEA 1TXBA 1BXPA 1JGKA 1ERGA 5EBXA 1CRFA 1I02A 1IDGA 1TGXA 2GOOB 2H7ZA 2PJYC 1FRAA 4OM5A 1REWC 1CODA 4P7UA 2H8UA 4XJJA 1QM7A 4FAOC 2PJYB 1HC9A 1IQ9A 1CDTA 1UG4A 1W6BA 2H64B 1NTNA 1CB9A 1KBTA 1XT3A 2J8BA 1IKCA 3NH7A 1FSSB 2CTXA 3U74U 1CTXA 2H7ZB 2L5SA 1PLOA 2FD6U 3PLCA 1ES7B 2MFAA 1G6MA 3EBXA 1ABTA 1LXGA 5IMYC 3FEVA 4BDTB 4EY8B 1CREA 1KTZB 1MAHF 4BIKB 4QTIU 1CDQA 1KL8A 2H64C 2JQPA 4OM4A 1TFSA 2QJAC 3QB4B 4DO8A 1COEA 2QC1A 2JVEA 1TXAA 1HOYA 2MHYA 4FAOE 6EBXA 2L03A 2MJYA 1FASA 2QJ9C 1YWHA 3HH7A 1HAJA 2UX2A 3KFDI 2NBTA 3BT2U 4ZQYA 1JE9A 1BTEA 3KFDE 4UY2C 5DO6A 1FSCA 1IDIA 1NORA 2H5FA 1VB0A 2ABXA 1CXOA 1ZADA 1S4YA 4IYEA 1HC9B 1CXNA 2HLRA 1IK8A 1ERAA 1NXBA 1IDHA 1NEAA 1F8UB
chains in the Genus database with same CATH superfamily
4HQPF 4AEAA 2H62C 1KXIA 2BTXA 1DRSA 3BT1U 2CDXA 3NEQA 1NYSA 2HLQA 1F94A 1CDSA 3EVSC 1V6PA 1KFHA 1LXHA 1B41B 1NTXA 1FFJA 1KBAA 1CHVS 2ERAA 2N99A 1NYUA 2MUPA 1MR6A 1ONJA 4RUDA 1LJZA 1RGJA 3LAQU 3ERAA 2K3GA 3VTSA 1RL5A 1LSIA 2LA1A 1JBDA 1QKDA 1LX5B 2QJBC 2UWRA 1IDLA 2LCRA 2MJ4A 2X8BB 1KU6B 4LFTA 2I9BE 2MJ0A 1IJCA 1CCQA 1KC4A 1L4WA 2H62D 2OFSA 1CVOA 5DZ5A 2BHIA 3NDSA 1M9ZA 2CCXA 1HAAA 2CRTA 1CDRA 1H0JA 2GOOC 5DU1A 2VLWA 1FF4A 3U73U 1KS6A 2CRSA 2MUOA 5IMTD 1KBSA 1QKEA 1TXBA 1BXPA 1JGKA 1ERGA 5EBXA 1CRFA 1I02A 1IDGA 1TGXA 2GOOB 2H7ZA 2PJYC 1FRAA 4OM5A 1REWC 1CODA 4P7UA 2H8UA 4XJJA 1QM7A 4FAOC 2PJYB 1HC9A 1IQ9A 1CDTA 1UG4A 1W6BA 2H64B 1NTNA 1CB9A 1KBTA 1XT3A 2J8BA 1IKCA 3NH7A 1FSSB 2CTXA 3U74U 1CTXA 2H7ZB 2L5SA 1PLOA 2FD6U 3PLCA 1ES7B 2MFAA 1G6MA 3EBXA 1ABTA 1LXGA 5IMYC 3FEVA 4BDTB 4EY8B 1CREA 1KTZB 1MAHF 4BIKB 4QTIU 1CDQA 1KL8A 2H64C 2JQPA 4OM4A 1TFSA 2QJAC 3QB4B 4DO8A 1COEA 2QC1A 2JVEA 1TXAA 1HOYA 2MHYA 4FAOE 6EBXA 2L03A 2MJYA 1FASA 2QJ9C 1YWHA 3HH7A 1HAJA 2UX2A 3KFDI 2NBTA 3BT2U 4ZQYA 1JE9A 1BTEA 3KFDE 4UY2C 5DO6A 1FSCA 1IDIA 1NORA 2H5FA 1VB0A 2ABXA 1CXOA 1ZADA 1S4YA 4IYEA 4KSNA 1HC9B 1CXNA 2HLRA 1IK8A 1ERAA 1NXBA 1IDHA 1NEAA 1F8UB
chains in the Genus database with same CATH topology
4HQPF 4AEAA 2H62C 1KXIA 2BTXA 1DRSA 3BT1U 2CDXA 3NEQA 1NYSA 2HLQA 1F94A 1CDSA 3EVSC 1V6PA 1KFHA 1LXHA 1B41B 1NTXA 1FFJA 1KBAA 1CHVS 2ERAA 2N99A 1NYUA 2MUPA 1MR6A 1ONJA 4RUDA 1LJZA 1RGJA 3LAQU 3ERAA 2K3GA 3VTSA 1RL5A 1LSIA 2LA1A 1JBDA 1QKDA 1LX5B 2QJBC 2UWRA 1IDLA 2LCRA 2MJ4A 2X8BB 1KU6B 4LFTA 2I9BE 2MJ0A 1IJCA 1CCQA 1KC4A 1L4WA 2H62D 2OFSA 1CVOA 5DZ5A 2BHIA 3NDSA 1M9ZA 2CCXA 1HAAA 2CRTA 1CDRA 1H0JA 2GOOC 5DU1A 2VLWA 1FF4A 3U73U 1KS6A 2CRSA 2MUOA 5IMTD 1KBSA 1QKEA 1TXBA 1BXPA 1JGKA 1ERGA 5EBXA 1CRFA 1I02A 1IDGA 1TGXA 2GOOB 2H7ZA 2PJYC 1FRAA 4OM5A 1REWC 1CODA 4P7UA 2H8UA 4XJJA 1QM7A 4FAOC 2PJYB 1HC9A 1IQ9A 1CDTA 1UG4A 1W6BA 2H64B 1NTNA 1CB9A 1KBTA 1XT3A 2J8BA 1IKCA 3NH7A 1FSSB 2CTXA 3U74U 1CTXA 2H7ZB 2L5SA 1PLOA 2FD6U 3PLCA 1ES7B 2MFAA 1G6MA 3EBXA 1ABTA 1LXGA 5IMYC 3FEVA 4BDTB 4EY8B 1CREA 1KTZB 1MAHF 4BIKB 4QTIU 1CDQA 1KL8A 2H64C 2JQPA 4OM4A 1TFSA 2QJAC 3QB4B 4DO8A 1COEA 2QC1A 2JVEA 1TXAA 1HOYA 2MHYA 4FAOE 6EBXA 2L03A 2MJYA 1FASA 2QJ9C 1YWHA 3HH7A 1HAJA 2UX2A 3KFDI 2NBTA 3BT2U 4ZQYA 1JE9A 1BTEA 3KFDE 4UY2C 5DO6A 1FSCA 1IDIA 1NORA 2H5FA 1VB0A 2ABXA 1CXOA 1ZADA 1S4YA 4IYEA 4KSNA 1HC9B 1CXNA 2HLRA 1IK8A 1ERAA 1NXBA 1IDHA 1NEAA 1F8UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HQP F;  4AEA A;  2H62 C;  1KXI A;  2BTX A;  1DRS A;  3BT1 U;  2CDX A;  3NEQ A;  1NYS A;  2HLQ A;  1F94 A;  1CDS A;  3EVS C;  1V6P A;  1KFH A;  1LXH A;  1B41 B;  1NTX A;  1FFJ A;  1KBA A;  1CHV S;  2ERA A;  2N99 A;  1NYU A;  2MUP A;  1MR6 A;  1ONJ A;  4RUD A;  1LJZ A;  1RGJ A;  3LAQ U;  3ERA A;  2K3G A;  3VTS A;  1RL5 A;  1LSI A;  2LA1 A;  1JBD A;  1QKD A;  1LX5 B;  2QJB C;  2UWR A;  1IDL A;  2LCR A;  2MJ4 A;  2X8B B;  1KU6 B;  4LFT A;  2I9B E;  2MJ0 A;  1IJC A;  1CCQ A;  1KC4 A;  1L4W A;  2H62 D;  2OFS A;  1CVO A;  5DZ5 A;  2BHI A;  3NDS A;  1M9Z A;  2CCX A;  1HAA A;  2CRT A;  1CDR A;  1H0J A;  2GOO C;  5DU1 A;  2VLW A;  1FF4 A;  3U73 U;  1KS6 A;  2CRS A;  2MUO A;  5IMT D;  1KBS A;  1QKE A;  1TXB A;  1BXP A;  1JGK A;  1ERG A;  5EBX A;  1CRF A;  1I02 A;  1IDG A;  1TGX A;  2GOO B;  2H7Z A;  2PJY C;  1FRA A;  4OM5 A;  1REW C;  1COD A;  4P7U A;  2H8U A;  4XJJ A;  1QM7 A;  4FAO C;  2PJY B;  1HC9 A;  1IQ9 A;  1CDT A;  1UG4 A;  1W6B A;  2H64 B;  1NTN A;  1CB9 A;  1KBT A;  1XT3 A;  2J8B A;  1IKC A;  3NH7 A;  1FSS B;  2CTX A;  3U74 U;  1CTX A;  2H7Z B;  2L5S A;  1PLO A;  2FD6 U;  3PLC A;  1ES7 B;  2MFA A;  1G6M A;  3EBX A;  1ABT A;  1LXG A;  5IMY C;  3FEV A;  4BDT B;  4EY8 B;  1CRE A;  1KTZ B;  1MAH F;  4BIK B;  4QTI U;  1CDQ A;  1KL8 A;  2H64 C;  2JQP A;  4OM4 A;  1TFS A;  2QJA C;  3QB4 B;  4DO8 A;  1COE A;  2QC1 A;  2JVE A;  1TXA A;  1HOY A;  2MHY A;  4FAO E;  6EBX A;  2L03 A;  2MJY A;  1FAS A;  2QJ9 C;  1YWH A;  3HH7 A;  1HAJ A;  2UX2 A;  3KFD I;  2NBT A;  3BT2 U;  4ZQY A;  1JE9 A;  1BTE A;  3KFD E;  4UY2 C;  5DO6 A;  1FSC A;  1IDI A;  1NOR A;  2H5F A;  1VB0 A;  2ABX A;  1CXO A;  1ZAD A;  1S4Y A;  4IYE A;  1HC9 B;  1CXN A;  2HLR A;  1IK8 A;  1ERA A;  1NXB A;  1IDH A;  1NEA A;  1F8U B; 
#chains in the Genus database with same CATH topology
 4HQP F;  4AEA A;  2H62 C;  1KXI A;  2BTX A;  1DRS A;  3BT1 U;  2CDX A;  3NEQ A;  1NYS A;  2HLQ A;  1F94 A;  1CDS A;  3EVS C;  1V6P A;  1KFH A;  1LXH A;  1B41 B;  1NTX A;  1FFJ A;  1KBA A;  1CHV S;  2ERA A;  2N99 A;  1NYU A;  2MUP A;  1MR6 A;  1ONJ A;  4RUD A;  1LJZ A;  1RGJ A;  3LAQ U;  3ERA A;  2K3G A;  3VTS A;  1RL5 A;  1LSI A;  2LA1 A;  1JBD A;  1QKD A;  1LX5 B;  2QJB C;  2UWR A;  1IDL A;  2LCR A;  2MJ4 A;  2X8B B;  1KU6 B;  4LFT A;  2I9B E;  2MJ0 A;  1IJC A;  1CCQ A;  1KC4 A;  1L4W A;  2H62 D;  2OFS A;  1CVO A;  5DZ5 A;  2BHI A;  3NDS A;  1M9Z A;  2CCX A;  1HAA A;  2CRT A;  1CDR A;  1H0J A;  2GOO C;  5DU1 A;  2VLW A;  1FF4 A;  3U73 U;  1KS6 A;  2CRS A;  2MUO A;  5IMT D;  1KBS A;  1QKE A;  1TXB A;  1BXP A;  1JGK A;  1ERG A;  5EBX A;  1CRF A;  1I02 A;  1IDG A;  1TGX A;  2GOO B;  2H7Z A;  2PJY C;  1FRA A;  4OM5 A;  1REW C;  1COD A;  4P7U A;  2H8U A;  4XJJ A;  1QM7 A;  4FAO C;  2PJY B;  1HC9 A;  1IQ9 A;  1CDT A;  1UG4 A;  1W6B A;  2H64 B;  1NTN A;  1CB9 A;  1KBT A;  1XT3 A;  2J8B A;  1IKC A;  3NH7 A;  1FSS B;  2CTX A;  3U74 U;  1CTX A;  2H7Z B;  2L5S A;  1PLO A;  2FD6 U;  3PLC A;  1ES7 B;  2MFA A;  1G6M A;  3EBX A;  1ABT A;  1LXG A;  5IMY C;  3FEV A;  4BDT B;  4EY8 B;  1CRE A;  1KTZ B;  1MAH F;  4BIK B;  4QTI U;  1CDQ A;  1KL8 A;  2H64 C;  2JQP A;  4OM4 A;  1TFS A;  2QJA C;  3QB4 B;  4DO8 A;  1COE A;  2QC1 A;  2JVE A;  1TXA A;  1HOY A;  2MHY A;  4FAO E;  6EBX A;  2L03 A;  2MJY A;  1FAS A;  2QJ9 C;  1YWH A;  3HH7 A;  1HAJ A;  2UX2 A;  3KFD I;  2NBT A;  3BT2 U;  4ZQY A;  1JE9 A;  1BTE A;  3KFD E;  4UY2 C;  5DO6 A;  1FSC A;  1IDI A;  1NOR A;  2H5F A;  1VB0 A;  2ABX A;  1CXO A;  1ZAD A;  1S4Y A;  4IYE A;  4KSN A;  1HC9 B;  1CXN A;  2HLR A;  1IK8 A;  1ERA A;  1NXB A;  1IDH A;  1NEA A;  1F8U B; 
#chains in the Genus database with same CATH homology
 4HQP F;  4AEA A;  2H62 C;  1KXI A;  2BTX A;  1DRS A;  3BT1 U;  2CDX A;  3NEQ A;  1NYS A;  2HLQ A;  1F94 A;  1CDS A;  3EVS C;  1V6P A;  1KFH A;  1LXH A;  1B41 B;  1NTX A;  1FFJ A;  1KBA A;  1CHV S;  2ERA A;  2N99 A;  1NYU A;  2MUP A;  1MR6 A;  1ONJ A;  4RUD A;  1LJZ A;  1RGJ A;  3LAQ U;  3ERA A;  2K3G A;  3VTS A;  1RL5 A;  1LSI A;  2LA1 A;  1JBD A;  1QKD A;  1LX5 B;  2QJB C;  2UWR A;  1IDL A;  2LCR A;  2MJ4 A;  2X8B B;  1KU6 B;  4LFT A;  2I9B E;  2MJ0 A;  1IJC A;  1CCQ A;  1KC4 A;  1L4W A;  2H62 D;  2OFS A;  1CVO A;  5DZ5 A;  2BHI A;  3NDS A;  1M9Z A;  2CCX A;  1HAA A;  2CRT A;  1CDR A;  1H0J A;  2GOO C;  5DU1 A;  2VLW A;  1FF4 A;  3U73 U;  1KS6 A;  2CRS A;  2MUO A;  5IMT D;  1KBS A;  1QKE A;  1TXB A;  1BXP A;  1JGK A;  1ERG A;  5EBX A;  1CRF A;  1I02 A;  1IDG A;  1TGX A;  2GOO B;  2H7Z A;  2PJY C;  1FRA A;  4OM5 A;  1REW C;  1COD A;  4P7U A;  2H8U A;  4XJJ A;  1QM7 A;  4FAO C;  2PJY B;  1HC9 A;  1IQ9 A;  1CDT A;  1UG4 A;  1W6B A;  2H64 B;  1NTN A;  1CB9 A;  1KBT A;  1XT3 A;  2J8B A;  1IKC A;  3NH7 A;  1FSS B;  2CTX A;  3U74 U;  1CTX A;  2H7Z B;  2L5S A;  1PLO A;  2FD6 U;  3PLC A;  1ES7 B;  2MFA A;  1G6M A;  3EBX A;  1ABT A;  1LXG A;  5IMY C;  3FEV A;  4BDT B;  4EY8 B;  1CRE A;  1KTZ B;  1MAH F;  4BIK B;  4QTI U;  1CDQ A;  1KL8 A;  2H64 C;  2JQP A;  4OM4 A;  1TFS A;  2QJA C;  3QB4 B;  4DO8 A;  1COE A;  2QC1 A;  2JVE A;  1TXA A;  1HOY A;  2MHY A;  4FAO E;  6EBX A;  2L03 A;  2MJY A;  1FAS A;  2QJ9 C;  1YWH A;  3HH7 A;  1HAJ A;  2UX2 A;  3KFD I;  2NBT A;  3BT2 U;  4ZQY A;  1JE9 A;  1BTE A;  3KFD E;  4UY2 C;  5DO6 A;  1FSC A;  1IDI A;  1NOR A;  2H5F A;  1VB0 A;  2ABX A;  1CXO A;  1ZAD A;  1S4Y A;  4IYE A;  4KSN A;  1HC9 B;  1CXN A;  2HLR A;  1IK8 A;  1ERA A;  1NXB A;  1IDH A;  1NEA A;  1F8U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...