6EBXA

Structure determination of a dimeric form of erabutoxin b, crystallized from thiocyanate solution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of a dimeric form of erabutoxin-b, crystallized from a thiocyanate solution.
pubmed doi rcsb
source organism Laticauda semifasciata
molecule tags Toxin
molecule keywords ERABUTOXIN B
total genus 11
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 6ebxA00
1FFJA 5EBXA 4OM4A 2MJ0A 1NEAA 2VLWA 2HLRA 4FAOC 1ZADA 1V6PA 1UG4A 1CHVS 1IDIA 5DO6A 1IDLA 1IQ9A 2ABXA 1ERGA 1CTXA 1F8UB 4OM5A 1LXHA 1BTEA 1CODA 1I02A 1H0JA 2H5FA 1CDQA 4HQPF 4BIKB 3FEVA 3U73U 2MFAA 2H64C 1RGJA 1NYSA 1FRAA 2LA1A 2CRTA 1IKCA 4XJJA 1LSIA 1HAAA 1B41B 2H7ZB 2I9BE 2L5SA 2UX2A 2QC1A 5DU1A 1BXPA 1CCQA 1CREA 2CDXA 1HC9B 1ES7B 2J8BA 1KBTA 1REWC 1TXAA 1KS6A 2PJYC 1S4YA 3U74U 3NEQA 3KFDI 1RL5A 1IDGA 2MJYA 2GOOB 1FSCA 2BTXA 1CDRA 1KC4A 2N99A 1TFSA 4EY8B 4QTIU 2PJYB 1CDTA 2FD6U 2JVEA 4IYEA 1TXBA 1CB9A 1LXGA 2UWRA 3BT2U 2CCXA 1FSSB 1NYUA 2K3GA 3BT1U 1DRSA 3QB4B 1KU6B 1LJZA 1MR6A 1KXIA 2BHIA 4AEAA 2QJAC 1ABTA 1KBSA 1QKEA 2H7ZA 1QKDA 1ONJA 3LAQU 3ERAA 1JBDA 2L03A 1VB0A 1HAJA 2LCRA 3EVSC 2JQPA 1LX5B 1QM7A 2ERAA 1M9ZA 1KFHA 4UY2C 1JGKA 4RUDA 1HOYA 2MHYA 4LFTA 2QJ9C 1CRFA 1CXNA 2H62D 2NBTA 1CXOA 4P7UA 1NORA 2CTXA 2MUOA 1KL8A 1CDSA 2MUPA 2GOOC 2OFSA 2H64B 1XT3A 5DZ5A 1COEA 4DO8A 3EBXA 1FASA 4BDTB 1G6MA 1IDHA 1CVOA 4FAOE 1W6BA 4ZQYA 3PLCA 2H62C 3HH7A 2X8BB 1HC9A 3NH7A 3VTSA 5IMYC 1YWHA 1ERAA 1KTZB 2H8UA 2MJ4A 1NTNA 3NDSA 1JE9A 1FF4A 6EBXA 1F94A 1NXBA 1L4WA 1NTXA 2QJBC 1TGXA 5IMTD 1MAHF 3KFDE 1PLOA 1IK8A 1IJCA 2HLQA 2CRSA 1KBAA
chains in the Genus database with same CATH superfamily
1FFJA 5EBXA 4OM4A 2MJ0A 1NEAA 2VLWA 2HLRA 4FAOC 1ZADA 1V6PA 1UG4A 1CHVS 1IDIA 5DO6A 1IDLA 1IQ9A 2ABXA 1ERGA 1CTXA 1F8UB 4OM5A 1LXHA 1BTEA 1CODA 1I02A 1H0JA 2H5FA 1CDQA 4HQPF 4BIKB 3FEVA 3U73U 2MFAA 2H64C 1RGJA 1NYSA 1FRAA 2LA1A 2CRTA 1IKCA 4XJJA 1LSIA 1HAAA 1B41B 2H7ZB 2I9BE 2L5SA 2UX2A 2QC1A 5DU1A 1BXPA 1CCQA 1CREA 2CDXA 1HC9B 1ES7B 2J8BA 1KBTA 1REWC 1TXAA 1KS6A 2PJYC 1S4YA 3U74U 3NEQA 3KFDI 1RL5A 1IDGA 2MJYA 2GOOB 1FSCA 2BTXA 1CDRA 1KC4A 2N99A 1TFSA 4EY8B 4QTIU 2PJYB 1CDTA 2FD6U 2JVEA 4IYEA 1TXBA 1CB9A 1LXGA 2UWRA 3BT2U 2CCXA 1FSSB 1NYUA 2K3GA 3BT1U 1DRSA 3QB4B 1KU6B 1LJZA 1MR6A 1KXIA 2BHIA 4AEAA 2QJAC 1ABTA 1KBSA 1QKEA 2H7ZA 1QKDA 1ONJA 3LAQU 4KSNA 3ERAA 1JBDA 2L03A 1VB0A 1HAJA 2LCRA 3EVSC 2JQPA 1LX5B 1QM7A 2ERAA 1M9ZA 1KFHA 4UY2C 1JGKA 4RUDA 1HOYA 2MHYA 4LFTA 2QJ9C 1CRFA 1CXNA 2H62D 2NBTA 1CXOA 4P7UA 1NORA 2CTXA 2MUOA 1KL8A 1CDSA 2MUPA 2GOOC 2OFSA 2H64B 1XT3A 5DZ5A 1COEA 4DO8A 3EBXA 1FASA 4BDTB 1G6MA 1IDHA 1CVOA 4FAOE 1W6BA 4ZQYA 3PLCA 2H62C 3HH7A 2X8BB 1HC9A 3NH7A 3VTSA 5IMYC 1YWHA 1ERAA 1KTZB 2H8UA 2MJ4A 1NTNA 3NDSA 1JE9A 1FF4A 6EBXA 1F94A 1NXBA 1L4WA 1NTXA 2QJBC 1TGXA 5IMTD 1MAHF 3KFDE 1PLOA 1IK8A 1IJCA 2HLQA 2CRSA 1KBAA
chains in the Genus database with same CATH topology
1FFJA 5EBXA 4OM4A 2MJ0A 1NEAA 2VLWA 2HLRA 4FAOC 1ZADA 1V6PA 1UG4A 1CHVS 1IDIA 5DO6A 1IDLA 1IQ9A 2ABXA 1ERGA 1CTXA 1F8UB 4OM5A 1LXHA 1BTEA 1CODA 1I02A 1H0JA 2H5FA 1CDQA 4HQPF 4BIKB 3FEVA 3U73U 2MFAA 2H64C 1RGJA 1NYSA 1FRAA 2LA1A 2CRTA 1IKCA 4XJJA 1LSIA 1HAAA 1B41B 2H7ZB 2I9BE 2L5SA 2UX2A 2QC1A 5DU1A 1BXPA 1CCQA 1CREA 2CDXA 1HC9B 1ES7B 2J8BA 1KBTA 1REWC 1TXAA 1KS6A 2PJYC 1S4YA 3U74U 3NEQA 3KFDI 1RL5A 1IDGA 2MJYA 2GOOB 1FSCA 2BTXA 1CDRA 1KC4A 2N99A 1TFSA 4EY8B 4QTIU 2PJYB 1CDTA 2FD6U 2JVEA 4IYEA 1TXBA 1CB9A 1LXGA 2UWRA 3BT2U 2CCXA 1FSSB 1NYUA 2K3GA 3BT1U 1DRSA 3QB4B 1KU6B 1LJZA 1MR6A 1KXIA 2BHIA 4AEAA 2QJAC 1ABTA 1KBSA 1QKEA 2H7ZA 1QKDA 1ONJA 3LAQU 4KSNA 3ERAA 1JBDA 2L03A 1VB0A 1HAJA 2LCRA 3EVSC 2JQPA 1LX5B 1QM7A 2ERAA 1M9ZA 1KFHA 4UY2C 1JGKA 4RUDA 1HOYA 2MHYA 4LFTA 2QJ9C 1CRFA 1CXNA 2H62D 2NBTA 1CXOA 4P7UA 1NORA 2CTXA 2MUOA 1KL8A 1CDSA 2MUPA 2GOOC 2OFSA 2H64B 1XT3A 5DZ5A 1COEA 4DO8A 3EBXA 1FASA 4BDTB 1G6MA 1IDHA 1CVOA 4FAOE 1W6BA 4ZQYA 3PLCA 2H62C 3HH7A 2X8BB 1HC9A 3NH7A 3VTSA 5IMYC 1YWHA 1ERAA 1KTZB 2H8UA 2MJ4A 1NTNA 3NDSA 1JE9A 1FF4A 6EBXA 1F94A 1NXBA 1L4WA 1NTXA 2QJBC 1TGXA 5IMTD 1MAHF 3KFDE 1PLOA 1IK8A 1IJCA 2HLQA 2CRSA 1KBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFJ A;  5EBX A;  4OM4 A;  2MJ0 A;  1NEA A;  2VLW A;  2HLR A;  4FAO C;  1ZAD A;  1V6P A;  1UG4 A;  1CHV S;  1IDI A;  5DO6 A;  1IDL A;  1IQ9 A;  2ABX A;  1ERG A;  1CTX A;  1F8U B;  4OM5 A;  1LXH A;  1BTE A;  1COD A;  1I02 A;  1H0J A;  2H5F A;  1CDQ A;  4HQP F;  4BIK B;  3FEV A;  3U73 U;  2MFA A;  2H64 C;  1RGJ A;  1NYS A;  1FRA A;  2LA1 A;  2CRT A;  1IKC A;  4XJJ A;  1LSI A;  1HAA A;  1B41 B;  2H7Z B;  2I9B E;  2L5S A;  2UX2 A;  2QC1 A;  5DU1 A;  1BXP A;  1CCQ A;  1CRE A;  2CDX A;  1HC9 B;  1ES7 B;  2J8B A;  1KBT A;  1REW C;  1TXA A;  1KS6 A;  2PJY C;  1S4Y A;  3U74 U;  3NEQ A;  3KFD I;  1RL5 A;  1IDG A;  2MJY A;  2GOO B;  1FSC A;  2BTX A;  1CDR A;  1KC4 A;  2N99 A;  1TFS A;  4EY8 B;  4QTI U;  2PJY B;  1CDT A;  2FD6 U;  2JVE A;  4IYE A;  1TXB A;  1CB9 A;  1LXG A;  2UWR A;  3BT2 U;  2CCX A;  1FSS B;  1NYU A;  2K3G A;  3BT1 U;  1DRS A;  3QB4 B;  1KU6 B;  1LJZ A;  1MR6 A;  1KXI A;  2BHI A;  4AEA A;  2QJA C;  1ABT A;  1KBS A;  1QKE A;  2H7Z A;  1QKD A;  1ONJ A;  3LAQ U;  3ERA A;  1JBD A;  2L03 A;  1VB0 A;  1HAJ A;  2LCR A;  3EVS C;  2JQP A;  1LX5 B;  1QM7 A;  2ERA A;  1M9Z A;  1KFH A;  4UY2 C;  1JGK A;  4RUD A;  1HOY A;  2MHY A;  4LFT A;  2QJ9 C;  1CRF A;  1CXN A;  2H62 D;  2NBT A;  1CXO A;  4P7U A;  1NOR A;  2CTX A;  2MUO A;  1KL8 A;  1CDS A;  2MUP A;  2GOO C;  2OFS A;  2H64 B;  1XT3 A;  5DZ5 A;  1COE A;  4DO8 A;  3EBX A;  1FAS A;  4BDT B;  1G6M A;  1IDH A;  1CVO A;  4FAO E;  1W6B A;  4ZQY A;  3PLC A;  2H62 C;  3HH7 A;  2X8B B;  1HC9 A;  3NH7 A;  3VTS A;  5IMY C;  1YWH A;  1ERA A;  1KTZ B;  2H8U A;  2MJ4 A;  1NTN A;  3NDS A;  1JE9 A;  1FF4 A;  6EBX A;  1F94 A;  1NXB A;  1L4W A;  1NTX A;  2QJB C;  1TGX A;  5IMT D;  1MAH F;  3KFD E;  1PLO A;  1IK8 A;  1IJC A;  2HLQ A;  2CRS A;  1KBA A; 
#chains in the Genus database with same CATH topology
 1FFJ A;  5EBX A;  4OM4 A;  2MJ0 A;  1NEA A;  2VLW A;  2HLR A;  4FAO C;  1ZAD A;  1V6P A;  1UG4 A;  1CHV S;  1IDI A;  5DO6 A;  1IDL A;  1IQ9 A;  2ABX A;  1ERG A;  1CTX A;  1F8U B;  4OM5 A;  1LXH A;  1BTE A;  1COD A;  1I02 A;  1H0J A;  2H5F A;  1CDQ A;  4HQP F;  4BIK B;  3FEV A;  3U73 U;  2MFA A;  2H64 C;  1RGJ A;  1NYS A;  1FRA A;  2LA1 A;  2CRT A;  1IKC A;  4XJJ A;  1LSI A;  1HAA A;  1B41 B;  2H7Z B;  2I9B E;  2L5S A;  2UX2 A;  2QC1 A;  5DU1 A;  1BXP A;  1CCQ A;  1CRE A;  2CDX A;  1HC9 B;  1ES7 B;  2J8B A;  1KBT A;  1REW C;  1TXA A;  1KS6 A;  2PJY C;  1S4Y A;  3U74 U;  3NEQ A;  3KFD I;  1RL5 A;  1IDG A;  2MJY A;  2GOO B;  1FSC A;  2BTX A;  1CDR A;  1KC4 A;  2N99 A;  1TFS A;  4EY8 B;  4QTI U;  2PJY B;  1CDT A;  2FD6 U;  2JVE A;  4IYE A;  1TXB A;  1CB9 A;  1LXG A;  2UWR A;  3BT2 U;  2CCX A;  1FSS B;  1NYU A;  2K3G A;  3BT1 U;  1DRS A;  3QB4 B;  1KU6 B;  1LJZ A;  1MR6 A;  1KXI A;  2BHI A;  4AEA A;  2QJA C;  1ABT A;  1KBS A;  1QKE A;  2H7Z A;  1QKD A;  1ONJ A;  3LAQ U;  4KSN A;  3ERA A;  1JBD A;  2L03 A;  1VB0 A;  1HAJ A;  2LCR A;  3EVS C;  2JQP A;  1LX5 B;  1QM7 A;  2ERA A;  1M9Z A;  1KFH A;  4UY2 C;  1JGK A;  4RUD A;  1HOY A;  2MHY A;  4LFT A;  2QJ9 C;  1CRF A;  1CXN A;  2H62 D;  2NBT A;  1CXO A;  4P7U A;  1NOR A;  2CTX A;  2MUO A;  1KL8 A;  1CDS A;  2MUP A;  2GOO C;  2OFS A;  2H64 B;  1XT3 A;  5DZ5 A;  1COE A;  4DO8 A;  3EBX A;  1FAS A;  4BDT B;  1G6M A;  1IDH A;  1CVO A;  4FAO E;  1W6B A;  4ZQY A;  3PLC A;  2H62 C;  3HH7 A;  2X8B B;  1HC9 A;  3NH7 A;  3VTS A;  5IMY C;  1YWH A;  1ERA A;  1KTZ B;  2H8U A;  2MJ4 A;  1NTN A;  3NDS A;  1JE9 A;  1FF4 A;  6EBX A;  1F94 A;  1NXB A;  1L4W A;  1NTX A;  2QJB C;  1TGX A;  5IMT D;  1MAH F;  3KFD E;  1PLO A;  1IK8 A;  1IJC A;  2HLQ A;  2CRS A;  1KBA A; 
#chains in the Genus database with same CATH homology
 1FFJ A;  5EBX A;  4OM4 A;  2MJ0 A;  1NEA A;  2VLW A;  2HLR A;  4FAO C;  1ZAD A;  1V6P A;  1UG4 A;  1CHV S;  1IDI A;  5DO6 A;  1IDL A;  1IQ9 A;  2ABX A;  1ERG A;  1CTX A;  1F8U B;  4OM5 A;  1LXH A;  1BTE A;  1COD A;  1I02 A;  1H0J A;  2H5F A;  1CDQ A;  4HQP F;  4BIK B;  3FEV A;  3U73 U;  2MFA A;  2H64 C;  1RGJ A;  1NYS A;  1FRA A;  2LA1 A;  2CRT A;  1IKC A;  4XJJ A;  1LSI A;  1HAA A;  1B41 B;  2H7Z B;  2I9B E;  2L5S A;  2UX2 A;  2QC1 A;  5DU1 A;  1BXP A;  1CCQ A;  1CRE A;  2CDX A;  1HC9 B;  1ES7 B;  2J8B A;  1KBT A;  1REW C;  1TXA A;  1KS6 A;  2PJY C;  1S4Y A;  3U74 U;  3NEQ A;  3KFD I;  1RL5 A;  1IDG A;  2MJY A;  2GOO B;  1FSC A;  2BTX A;  1CDR A;  1KC4 A;  2N99 A;  1TFS A;  4EY8 B;  4QTI U;  2PJY B;  1CDT A;  2FD6 U;  2JVE A;  4IYE A;  1TXB A;  1CB9 A;  1LXG A;  2UWR A;  3BT2 U;  2CCX A;  1FSS B;  1NYU A;  2K3G A;  3BT1 U;  1DRS A;  3QB4 B;  1KU6 B;  1LJZ A;  1MR6 A;  1KXI A;  2BHI A;  4AEA A;  2QJA C;  1ABT A;  1KBS A;  1QKE A;  2H7Z A;  1QKD A;  1ONJ A;  3LAQ U;  4KSN A;  3ERA A;  1JBD A;  2L03 A;  1VB0 A;  1HAJ A;  2LCR A;  3EVS C;  2JQP A;  1LX5 B;  1QM7 A;  2ERA A;  1M9Z A;  1KFH A;  4UY2 C;  1JGK A;  4RUD A;  1HOY A;  2MHY A;  4LFT A;  2QJ9 C;  1CRF A;  1CXN A;  2H62 D;  2NBT A;  1CXO A;  4P7U A;  1NOR A;  2CTX A;  2MUO A;  1KL8 A;  1CDS A;  2MUP A;  2GOO C;  2OFS A;  2H64 B;  1XT3 A;  5DZ5 A;  1COE A;  4DO8 A;  3EBX A;  1FAS A;  4BDT B;  1G6M A;  1IDH A;  1CVO A;  4FAO E;  1W6B A;  4ZQY A;  3PLC A;  2H62 C;  3HH7 A;  2X8B B;  1HC9 A;  3NH7 A;  3VTS A;  5IMY C;  1YWH A;  1ERA A;  1KTZ B;  2H8U A;  2MJ4 A;  1NTN A;  3NDS A;  1JE9 A;  1FF4 A;  6EBX A;  1F94 A;  1NXB A;  1L4W A;  1NTX A;  2QJB C;  1TGX A;  5IMT D;  1MAH F;  3KFD E;  1PLO A;  1IK8 A;  1IJC A;  2HLQ A;  2CRS A;  1KBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...