6EBXA

Structure determination of a dimeric form of erabutoxin b, crystallized from thiocyanate solution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERABUTOXIN B
publication title Structure determination of a dimeric form of erabutoxin-b, crystallized from a thiocyanate solution.
pubmed doi rcsb
source organism Laticauda semifasciata
molecule tags Toxin
total genus 11
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 6ebxA00
1ERGA 2MJ4A 2H7ZB 1W6BA 2PJYB 1CTXA 1NORA 2H62D 4EY8B 1M9ZA 1NXBA 3KFDI 3BT2U 1HOYA 4BDTB 3ERAA 2OFSA 1CRFA 2H64B 1QKEA 5DZ5A 1MR6A 1ES7B 1CDQA 1FRAA 1ZADA 1QM7A 1IDHA 1LXHA 1MAHF 1CVOA 1CREA 2UWRA 1JGKA 2NBTA 2UX2A 1XT3A 1NEAA 3U74U 1KTZB 1H0JA 1V6PA 2ERAA 2I9BE 2N99A 2CCXA 3NDSA 4RUDA 4ZQYA 1HC9B 1PLOA 4DO8A 1YWHA 1TGXA 2H5FA 2QC1A 1CXOA 1LSIA 1REWC 1QKDA 1RGJA 1JE9A 5EBXA 2QJAC 1KXIA 2VLWA 1CDSA 5IMTD 4AEAA 2CTXA 1HAAA 1IQ9A 2BHIA 1KU6B 1BTEA 2GOOC 2HLQA 4XJJA 3U73U 1F8UB 2LA1A 1F94A 1TFSA 3LAQU 1VB0A 3VTSA 1KBAA 2MUOA 1CB9A 2J8BA 4BIKB 1RL5A 1IJCA 1CDRA 1ABTA 2MJ0A 3NEQA 1IKCA 1IDGA 1CODA 1FSCA 1IK8A 4UY2C 6EBXA 1TXBA 2MJYA 4LFTA 2FD6U 2BTXA 1TXAA 2X8BB 1KL8A 1UG4A 2H7ZA 2QJ9C 5DU1A 1HAJA 2CDXA 1LXGA 1KC4A 2QJBC 2K3GA 3FEVA 2JQPA 2ABXA 1KBSA 1S4YA 4FAOE 1CHVS 1ONJA 1L4WA 2L03A 1FFJA 2GOOB 3EBXA 1BXPA 2PJYC 1LX5B 4HQPF 3QB4B 2MFAA 4P7UA 2CRSA 1I02A 2H62C 2L5SA 1KFHA 1ERAA 3KFDE 2CRTA 4FAOC 1JBDA 1KS6A 3NH7A 1HC9A 2H64C 1FF4A 1DRSA 1COEA 2MUPA 5IMYC 2JVEA 1IDLA 1FSSB 3HH7A 1LJZA 1FASA 1CCQA 1NTNA 2LCRA 2HLRA 1NTXA 2H8UA 4QTIU 4OM4A 5DO6A 2MHYA 4IYEA 3EVSC 1CDTA 3PLCA 1IDIA 1B41B 1KBTA 1NYSA 3BT1U 4OM5A 1CXNA 1NYUA 1G6MA
chains in the Genus database with same CATH superfamily
1ERGA 2MJ4A 2H7ZB 1W6BA 2PJYB 1CTXA 1NORA 2H62D 4EY8B 1M9ZA 1NXBA 3KFDI 3BT2U 1HOYA 4BDTB 3ERAA 2OFSA 1CRFA 2H64B 1QKEA 5DZ5A 1MR6A 1ES7B 1CDQA 1FRAA 1ZADA 1QM7A 1IDHA 1LXHA 1MAHF 1CVOA 1CREA 2UWRA 1JGKA 2NBTA 2UX2A 1XT3A 1NEAA 3U74U 1KTZB 1H0JA 1V6PA 2ERAA 2I9BE 2N99A 2CCXA 3NDSA 4RUDA 4ZQYA 1HC9B 1PLOA 4DO8A 1YWHA 1TGXA 2H5FA 2QC1A 1CXOA 1LSIA 1REWC 1QKDA 1RGJA 1JE9A 5EBXA 2QJAC 1KXIA 2VLWA 1CDSA 5IMTD 4AEAA 2CTXA 1HAAA 1IQ9A 2BHIA 1KU6B 1BTEA 2GOOC 2HLQA 4XJJA 3U73U 1F8UB 2LA1A 1F94A 1TFSA 3LAQU 1VB0A 3VTSA 1KBAA 2MUOA 1CB9A 2J8BA 4BIKB 1RL5A 1IJCA 1CDRA 1ABTA 2MJ0A 3NEQA 1IKCA 1IDGA 1CODA 1FSCA 1IK8A 4UY2C 6EBXA 1TXBA 2MJYA 4LFTA 2FD6U 2BTXA 1TXAA 2X8BB 1KL8A 1UG4A 2H7ZA 2QJ9C 5DU1A 1HAJA 2CDXA 1LXGA 1KC4A 2QJBC 2K3GA 3FEVA 2JQPA 2ABXA 1KBSA 1S4YA 4FAOE 1CHVS 4KSNA 1ONJA 1L4WA 2L03A 1FFJA 2GOOB 3EBXA 1BXPA 2PJYC 1LX5B 4HQPF 3QB4B 2MFAA 4P7UA 2CRSA 1I02A 2H62C 2L5SA 1KFHA 1ERAA 3KFDE 2CRTA 4FAOC 1JBDA 1KS6A 3NH7A 1HC9A 2H64C 1FF4A 1DRSA 1COEA 2MUPA 5IMYC 2JVEA 1IDLA 1FSSB 3HH7A 1LJZA 1FASA 1CCQA 1NTNA 2LCRA 2HLRA 1NTXA 2H8UA 4QTIU 4OM4A 5DO6A 2MHYA 4IYEA 3EVSC 1CDTA 3PLCA 1IDIA 1B41B 1KBTA 1NYSA 3BT1U 4OM5A 1CXNA 1NYUA 1G6MA
chains in the Genus database with same CATH topology
1ERGA 2MJ4A 2H7ZB 1W6BA 2PJYB 1CTXA 1NORA 2H62D 4EY8B 1M9ZA 1NXBA 3KFDI 3BT2U 1HOYA 4BDTB 3ERAA 2OFSA 1CRFA 2H64B 1QKEA 5DZ5A 1MR6A 1ES7B 1CDQA 1FRAA 1ZADA 1QM7A 1IDHA 1LXHA 1MAHF 1CVOA 1CREA 2UWRA 1JGKA 2NBTA 2UX2A 1XT3A 1NEAA 3U74U 1KTZB 1H0JA 1V6PA 2ERAA 2I9BE 2N99A 2CCXA 3NDSA 4RUDA 4ZQYA 1HC9B 1PLOA 4DO8A 1YWHA 1TGXA 2H5FA 2QC1A 1CXOA 1LSIA 1REWC 1QKDA 1RGJA 1JE9A 5EBXA 2QJAC 1KXIA 2VLWA 1CDSA 5IMTD 4AEAA 2CTXA 1HAAA 1IQ9A 2BHIA 1KU6B 1BTEA 2GOOC 2HLQA 4XJJA 3U73U 1F8UB 2LA1A 1F94A 1TFSA 3LAQU 1VB0A 3VTSA 1KBAA 2MUOA 1CB9A 2J8BA 4BIKB 1RL5A 1IJCA 1CDRA 1ABTA 2MJ0A 3NEQA 1IKCA 1IDGA 1CODA 1FSCA 1IK8A 4UY2C 6EBXA 1TXBA 2MJYA 4LFTA 2FD6U 2BTXA 1TXAA 2X8BB 1KL8A 1UG4A 2H7ZA 2QJ9C 5DU1A 1HAJA 2CDXA 1LXGA 1KC4A 2QJBC 2K3GA 3FEVA 2JQPA 2ABXA 1KBSA 1S4YA 4FAOE 1CHVS 4KSNA 1ONJA 1L4WA 2L03A 1FFJA 2GOOB 3EBXA 1BXPA 2PJYC 1LX5B 4HQPF 3QB4B 2MFAA 4P7UA 2CRSA 1I02A 2H62C 2L5SA 1KFHA 1ERAA 3KFDE 2CRTA 4FAOC 1JBDA 1KS6A 3NH7A 1HC9A 2H64C 1FF4A 1DRSA 1COEA 2MUPA 5IMYC 2JVEA 1IDLA 1FSSB 3HH7A 1LJZA 1FASA 1CCQA 1NTNA 2LCRA 2HLRA 1NTXA 2H8UA 4QTIU 4OM4A 5DO6A 2MHYA 4IYEA 3EVSC 1CDTA 3PLCA 1IDIA 1B41B 1KBTA 1NYSA 3BT1U 4OM5A 1CXNA 1NYUA 1G6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERG A;  2MJ4 A;  2H7Z B;  1W6B A;  2PJY B;  1CTX A;  1NOR A;  2H62 D;  4EY8 B;  1M9Z A;  1NXB A;  3KFD I;  3BT2 U;  1HOY A;  4BDT B;  3ERA A;  2OFS A;  1CRF A;  2H64 B;  1QKE A;  5DZ5 A;  1MR6 A;  1ES7 B;  1CDQ A;  1FRA A;  1ZAD A;  1QM7 A;  1IDH A;  1LXH A;  1MAH F;  1CVO A;  1CRE A;  2UWR A;  1JGK A;  2NBT A;  2UX2 A;  1XT3 A;  1NEA A;  3U74 U;  1KTZ B;  1H0J A;  1V6P A;  2ERA A;  2I9B E;  2N99 A;  2CCX A;  3NDS A;  4RUD A;  4ZQY A;  1HC9 B;  1PLO A;  4DO8 A;  1YWH A;  1TGX A;  2H5F A;  2QC1 A;  1CXO A;  1LSI A;  1REW C;  1QKD A;  1RGJ A;  1JE9 A;  5EBX A;  2QJA C;  1KXI A;  2VLW A;  1CDS A;  5IMT D;  4AEA A;  2CTX A;  1HAA A;  1IQ9 A;  2BHI A;  1KU6 B;  1BTE A;  2GOO C;  2HLQ A;  4XJJ A;  3U73 U;  1F8U B;  2LA1 A;  1F94 A;  1TFS A;  3LAQ U;  1VB0 A;  3VTS A;  1KBA A;  2MUO A;  1CB9 A;  2J8B A;  4BIK B;  1RL5 A;  1IJC A;  1CDR A;  1ABT A;  2MJ0 A;  3NEQ A;  1IKC A;  1IDG A;  1COD A;  1FSC A;  1IK8 A;  4UY2 C;  6EBX A;  1TXB A;  2MJY A;  4LFT A;  2FD6 U;  2BTX A;  1TXA A;  2X8B B;  1KL8 A;  1UG4 A;  2H7Z A;  2QJ9 C;  5DU1 A;  1HAJ A;  2CDX A;  1LXG A;  1KC4 A;  2QJB C;  2K3G A;  3FEV A;  2JQP A;  2ABX A;  1KBS A;  1S4Y A;  4FAO E;  1CHV S;  1ONJ A;  1L4W A;  2L03 A;  1FFJ A;  2GOO B;  3EBX A;  1BXP A;  2PJY C;  1LX5 B;  4HQP F;  3QB4 B;  2MFA A;  4P7U A;  2CRS A;  1I02 A;  2H62 C;  2L5S A;  1KFH A;  1ERA A;  3KFD E;  2CRT A;  4FAO C;  1JBD A;  1KS6 A;  3NH7 A;  1HC9 A;  2H64 C;  1FF4 A;  1DRS A;  1COE A;  2MUP A;  5IMY C;  2JVE A;  1IDL A;  1FSS B;  3HH7 A;  1LJZ A;  1FAS A;  1CCQ A;  1NTN A;  2LCR A;  2HLR A;  1NTX A;  2H8U A;  4QTI U;  4OM4 A;  5DO6 A;  2MHY A;  4IYE A;  3EVS C;  1CDT A;  3PLC A;  1IDI A;  1B41 B;  1KBT A;  1NYS A;  3BT1 U;  4OM5 A;  1CXN A;  1NYU A;  1G6M A; 
#chains in the Genus database with same CATH topology
 1ERG A;  2MJ4 A;  2H7Z B;  1W6B A;  2PJY B;  1CTX A;  1NOR A;  2H62 D;  4EY8 B;  1M9Z A;  1NXB A;  3KFD I;  3BT2 U;  1HOY A;  4BDT B;  3ERA A;  2OFS A;  1CRF A;  2H64 B;  1QKE A;  5DZ5 A;  1MR6 A;  1ES7 B;  1CDQ A;  1FRA A;  1ZAD A;  1QM7 A;  1IDH A;  1LXH A;  1MAH F;  1CVO A;  1CRE A;  2UWR A;  1JGK A;  2NBT A;  2UX2 A;  1XT3 A;  1NEA A;  3U74 U;  1KTZ B;  1H0J A;  1V6P A;  2ERA A;  2I9B E;  2N99 A;  2CCX A;  3NDS A;  4RUD A;  4ZQY A;  1HC9 B;  1PLO A;  4DO8 A;  1YWH A;  1TGX A;  2H5F A;  2QC1 A;  1CXO A;  1LSI A;  1REW C;  1QKD A;  1RGJ A;  1JE9 A;  5EBX A;  2QJA C;  1KXI A;  2VLW A;  1CDS A;  5IMT D;  4AEA A;  2CTX A;  1HAA A;  1IQ9 A;  2BHI A;  1KU6 B;  1BTE A;  2GOO C;  2HLQ A;  4XJJ A;  3U73 U;  1F8U B;  2LA1 A;  1F94 A;  1TFS A;  3LAQ U;  1VB0 A;  3VTS A;  1KBA A;  2MUO A;  1CB9 A;  2J8B A;  4BIK B;  1RL5 A;  1IJC A;  1CDR A;  1ABT A;  2MJ0 A;  3NEQ A;  1IKC A;  1IDG A;  1COD A;  1FSC A;  1IK8 A;  4UY2 C;  6EBX A;  1TXB A;  2MJY A;  4LFT A;  2FD6 U;  2BTX A;  1TXA A;  2X8B B;  1KL8 A;  1UG4 A;  2H7Z A;  2QJ9 C;  5DU1 A;  1HAJ A;  2CDX A;  1LXG A;  1KC4 A;  2QJB C;  2K3G A;  3FEV A;  2JQP A;  2ABX A;  1KBS A;  1S4Y A;  4FAO E;  1CHV S;  4KSN A;  1ONJ A;  1L4W A;  2L03 A;  1FFJ A;  2GOO B;  3EBX A;  1BXP A;  2PJY C;  1LX5 B;  4HQP F;  3QB4 B;  2MFA A;  4P7U A;  2CRS A;  1I02 A;  2H62 C;  2L5S A;  1KFH A;  1ERA A;  3KFD E;  2CRT A;  4FAO C;  1JBD A;  1KS6 A;  3NH7 A;  1HC9 A;  2H64 C;  1FF4 A;  1DRS A;  1COE A;  2MUP A;  5IMY C;  2JVE A;  1IDL A;  1FSS B;  3HH7 A;  1LJZ A;  1FAS A;  1CCQ A;  1NTN A;  2LCR A;  2HLR A;  1NTX A;  2H8U A;  4QTI U;  4OM4 A;  5DO6 A;  2MHY A;  4IYE A;  3EVS C;  1CDT A;  3PLC A;  1IDI A;  1B41 B;  1KBT A;  1NYS A;  3BT1 U;  4OM5 A;  1CXN A;  1NYU A;  1G6M A; 
#chains in the Genus database with same CATH homology
 1ERG A;  2MJ4 A;  2H7Z B;  1W6B A;  2PJY B;  1CTX A;  1NOR A;  2H62 D;  4EY8 B;  1M9Z A;  1NXB A;  3KFD I;  3BT2 U;  1HOY A;  4BDT B;  3ERA A;  2OFS A;  1CRF A;  2H64 B;  1QKE A;  5DZ5 A;  1MR6 A;  1ES7 B;  1CDQ A;  1FRA A;  1ZAD A;  1QM7 A;  1IDH A;  1LXH A;  1MAH F;  1CVO A;  1CRE A;  2UWR A;  1JGK A;  2NBT A;  2UX2 A;  1XT3 A;  1NEA A;  3U74 U;  1KTZ B;  1H0J A;  1V6P A;  2ERA A;  2I9B E;  2N99 A;  2CCX A;  3NDS A;  4RUD A;  4ZQY A;  1HC9 B;  1PLO A;  4DO8 A;  1YWH A;  1TGX A;  2H5F A;  2QC1 A;  1CXO A;  1LSI A;  1REW C;  1QKD A;  1RGJ A;  1JE9 A;  5EBX A;  2QJA C;  1KXI A;  2VLW A;  1CDS A;  5IMT D;  4AEA A;  2CTX A;  1HAA A;  1IQ9 A;  2BHI A;  1KU6 B;  1BTE A;  2GOO C;  2HLQ A;  4XJJ A;  3U73 U;  1F8U B;  2LA1 A;  1F94 A;  1TFS A;  3LAQ U;  1VB0 A;  3VTS A;  1KBA A;  2MUO A;  1CB9 A;  2J8B A;  4BIK B;  1RL5 A;  1IJC A;  1CDR A;  1ABT A;  2MJ0 A;  3NEQ A;  1IKC A;  1IDG A;  1COD A;  1FSC A;  1IK8 A;  4UY2 C;  6EBX A;  1TXB A;  2MJY A;  4LFT A;  2FD6 U;  2BTX A;  1TXA A;  2X8B B;  1KL8 A;  1UG4 A;  2H7Z A;  2QJ9 C;  5DU1 A;  1HAJ A;  2CDX A;  1LXG A;  1KC4 A;  2QJB C;  2K3G A;  3FEV A;  2JQP A;  2ABX A;  1KBS A;  1S4Y A;  4FAO E;  1CHV S;  4KSN A;  1ONJ A;  1L4W A;  2L03 A;  1FFJ A;  2GOO B;  3EBX A;  1BXP A;  2PJY C;  1LX5 B;  4HQP F;  3QB4 B;  2MFA A;  4P7U A;  2CRS A;  1I02 A;  2H62 C;  2L5S A;  1KFH A;  1ERA A;  3KFD E;  2CRT A;  4FAO C;  1JBD A;  1KS6 A;  3NH7 A;  1HC9 A;  2H64 C;  1FF4 A;  1DRS A;  1COE A;  2MUP A;  5IMY C;  2JVE A;  1IDL A;  1FSS B;  3HH7 A;  1LJZ A;  1FAS A;  1CCQ A;  1NTN A;  2LCR A;  2HLR A;  1NTX A;  2H8U A;  4QTI U;  4OM4 A;  5DO6 A;  2MHY A;  4IYE A;  3EVS C;  1CDT A;  3PLC A;  1IDI A;  1B41 B;  1KBT A;  1NYS A;  3BT1 U;  4OM5 A;  1CXN A;  1NYU A;  1G6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...