1KBAA

Crystal structure of kappa-bungarotoxin at 2.3-angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of kappa-bungarotoxin at 2.3-A resolution.
pubmed doi rcsb
source organism Bungarus multicinctus
molecule tags Toxin
molecule keywords KAPPA-BUNGAROTOXIN
total genus 13
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1kbaA00
1ONJA 2K3GA 1KFHA 5DO6A 3BT1U 2HLQA 2QC1A 1FSSB 2FD6U 2ABXA 2H64C 2QJBC 1BXPA 1LXGA 1CVOA 2H7ZB 2NBTA 1CXOA 3NDSA 2CCXA 1UG4A 3QB4B 2MFAA 1H0JA 1PLOA 1TXAA 1CTXA 1HC9A 1COEA 2PJYC 1LSIA 2H62D 1NTXA 2H8UA 1V6PA 3ERAA 2N99A 1TXBA 1KTZB 2H62C 4LFTA 2CRTA 1FSCA 1IJCA 1CREA 2GOOB 5DU1A 6EBXA 2CTXA 1NTNA 2QJAC 4UY2C 4AEAA 2L5SA 3PLCA 2MJ0A 2PJYB 1KBTA 5IMTD 1HOYA 1W6BA 1HAAA 4FAOC 4BDTB 1DRSA 1G6MA 4QTIU 1NEAA 4HQPF 1CODA 5EBXA 1KC4A 2CRSA 1HAJA 1ES7B 1KS6A 3VTSA 1RGJA 2OFSA 1IK8A 1FRAA 1CDTA 1L4WA 2LCRA 1FFJA 2ERAA 1B41B 1YWHA 1IDGA 1ZADA 1CDQA 1ABTA 3EVSC 2VLWA 2JVEA 5DZ5A 3KFDI 1I02A 2UX2A 1NYSA 2H7ZA 1TFSA 3U73U 2UWRA 1CXNA 3KFDE 2HLRA 1F94A 2I9BE 2X8BB 1CB9A 1IDLA 1MAHF 1IDIA 2MUOA 4DO8A 4IYEA 3FEVA 2CDXA 4OM5A 1ERGA 1QM7A 4XJJA 5IMYC 4P7UA 1QKEA 1CRFA 3NH7A 1LXHA 1IDHA 1FASA 1CDSA 2QJ9C 2MJYA 4BIKB 1QKDA 3LAQU 1HC9B 3U74U 1VB0A 1KXIA 1BTEA 2J8BA 1MR6A 1KBSA 1LX5B 2LA1A 1NORA 3NEQA 2MHYA 1JE9A 2BHIA 2MJ4A 3BT2U 1LJZA 1S4YA 1REWC 4ZQYA 1JGKA 1CHVS 1CDRA 4FAOE 1FF4A 1NXBA 1TGXA 4RUDA 1IKCA 2H64B 1IQ9A 1KU6B 3EBXA 1F8UB 1JBDA 2L03A 1CCQA 2JQPA 1KBAA 1XT3A 2MUPA 1ERAA 1RL5A 1M9ZA 1KL8A 2BTXA 2H5FA 4OM4A 4EY8B 2GOOC 3HH7A 1NYUA
chains in the Genus database with same CATH superfamily
1ONJA 2K3GA 1KFHA 5DO6A 3BT1U 2HLQA 2QC1A 1FSSB 2FD6U 2ABXA 2H64C 2QJBC 1BXPA 1LXGA 1CVOA 2H7ZB 2NBTA 1CXOA 3NDSA 2CCXA 1UG4A 3QB4B 2MFAA 1H0JA 1PLOA 1TXAA 1CTXA 1HC9A 1COEA 2PJYC 1LSIA 2H62D 1NTXA 2H8UA 1V6PA 3ERAA 2N99A 1TXBA 1KTZB 2H62C 4LFTA 2CRTA 1FSCA 1IJCA 1CREA 2GOOB 5DU1A 6EBXA 2CTXA 1NTNA 2QJAC 4UY2C 4AEAA 2L5SA 3PLCA 2MJ0A 2PJYB 1KBTA 5IMTD 1HOYA 1W6BA 1HAAA 4FAOC 4BDTB 1DRSA 1G6MA 4QTIU 1NEAA 4HQPF 1CODA 5EBXA 1KC4A 2CRSA 1HAJA 1ES7B 1KS6A 3VTSA 1RGJA 2OFSA 1IK8A 1FRAA 1CDTA 1L4WA 2LCRA 1FFJA 2ERAA 1B41B 1YWHA 1IDGA 1ZADA 1CDQA 1ABTA 3EVSC 2VLWA 2JVEA 5DZ5A 3KFDI 1I02A 2UX2A 1NYSA 2H7ZA 1TFSA 3U73U 2UWRA 1CXNA 3KFDE 2HLRA 1F94A 2I9BE 2X8BB 1CB9A 1IDLA 1MAHF 1IDIA 2MUOA 4DO8A 4IYEA 3FEVA 2CDXA 4OM5A 1ERGA 1QM7A 4XJJA 5IMYC 4KSNA 4P7UA 1QKEA 1CRFA 3NH7A 1LXHA 1IDHA 1FASA 1CDSA 2QJ9C 2MJYA 4BIKB 1QKDA 3LAQU 1HC9B 3U74U 1VB0A 1KXIA 1BTEA 2J8BA 1MR6A 1KBSA 1LX5B 2LA1A 1NORA 3NEQA 2MHYA 1JE9A 2BHIA 2MJ4A 3BT2U 1LJZA 1S4YA 1REWC 4ZQYA 1JGKA 1CHVS 1CDRA 4FAOE 1FF4A 1NXBA 1TGXA 4RUDA 1IKCA 2H64B 1IQ9A 1KU6B 3EBXA 1F8UB 1JBDA 2L03A 1CCQA 2JQPA 1KBAA 1XT3A 2MUPA 1ERAA 1RL5A 1M9ZA 1KL8A 2BTXA 2H5FA 4OM4A 4EY8B 2GOOC 3HH7A 1NYUA
chains in the Genus database with same CATH topology
1ONJA 2K3GA 1KFHA 5DO6A 3BT1U 2HLQA 2QC1A 1FSSB 2FD6U 2ABXA 2H64C 2QJBC 1BXPA 1LXGA 1CVOA 2H7ZB 2NBTA 1CXOA 3NDSA 2CCXA 1UG4A 3QB4B 2MFAA 1H0JA 1PLOA 1TXAA 1CTXA 1HC9A 1COEA 2PJYC 1LSIA 2H62D 1NTXA 2H8UA 1V6PA 3ERAA 2N99A 1TXBA 1KTZB 2H62C 4LFTA 2CRTA 1FSCA 1IJCA 1CREA 2GOOB 5DU1A 6EBXA 2CTXA 1NTNA 2QJAC 4UY2C 4AEAA 2L5SA 3PLCA 2MJ0A 2PJYB 1KBTA 5IMTD 1HOYA 1W6BA 1HAAA 4FAOC 4BDTB 1DRSA 1G6MA 4QTIU 1NEAA 4HQPF 1CODA 5EBXA 1KC4A 2CRSA 1HAJA 1ES7B 1KS6A 3VTSA 1RGJA 2OFSA 1IK8A 1FRAA 1CDTA 1L4WA 2LCRA 1FFJA 2ERAA 1B41B 1YWHA 1IDGA 1ZADA 1CDQA 1ABTA 3EVSC 2VLWA 2JVEA 5DZ5A 3KFDI 1I02A 2UX2A 1NYSA 2H7ZA 1TFSA 3U73U 2UWRA 1CXNA 3KFDE 2HLRA 1F94A 2I9BE 2X8BB 1CB9A 1IDLA 1MAHF 1IDIA 2MUOA 4DO8A 4IYEA 3FEVA 2CDXA 4OM5A 1ERGA 1QM7A 4XJJA 5IMYC 4KSNA 4P7UA 1QKEA 1CRFA 3NH7A 1LXHA 1IDHA 1FASA 1CDSA 2QJ9C 2MJYA 4BIKB 1QKDA 3LAQU 1HC9B 3U74U 1VB0A 1KXIA 1BTEA 2J8BA 1MR6A 1KBSA 1LX5B 2LA1A 1NORA 3NEQA 2MHYA 1JE9A 2BHIA 2MJ4A 3BT2U 1LJZA 1S4YA 1REWC 4ZQYA 1JGKA 1CHVS 1CDRA 4FAOE 1FF4A 1NXBA 1TGXA 4RUDA 1IKCA 2H64B 1IQ9A 1KU6B 3EBXA 1F8UB 1JBDA 2L03A 1CCQA 2JQPA 1KBAA 1XT3A 2MUPA 1ERAA 1RL5A 1M9ZA 1KL8A 2BTXA 2H5FA 4OM4A 4EY8B 2GOOC 3HH7A 1NYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ONJ A;  2K3G A;  1KFH A;  5DO6 A;  3BT1 U;  2HLQ A;  2QC1 A;  1FSS B;  2FD6 U;  2ABX A;  2H64 C;  2QJB C;  1BXP A;  1LXG A;  1CVO A;  2H7Z B;  2NBT A;  1CXO A;  3NDS A;  2CCX A;  1UG4 A;  3QB4 B;  2MFA A;  1H0J A;  1PLO A;  1TXA A;  1CTX A;  1HC9 A;  1COE A;  2PJY C;  1LSI A;  2H62 D;  1NTX A;  2H8U A;  1V6P A;  3ERA A;  2N99 A;  1TXB A;  1KTZ B;  2H62 C;  4LFT A;  2CRT A;  1FSC A;  1IJC A;  1CRE A;  2GOO B;  5DU1 A;  6EBX A;  2CTX A;  1NTN A;  2QJA C;  4UY2 C;  4AEA A;  2L5S A;  3PLC A;  2MJ0 A;  2PJY B;  1KBT A;  5IMT D;  1HOY A;  1W6B A;  1HAA A;  4FAO C;  4BDT B;  1DRS A;  1G6M A;  4QTI U;  1NEA A;  4HQP F;  1COD A;  5EBX A;  1KC4 A;  2CRS A;  1HAJ A;  1ES7 B;  1KS6 A;  3VTS A;  1RGJ A;  2OFS A;  1IK8 A;  1FRA A;  1CDT A;  1L4W A;  2LCR A;  1FFJ A;  2ERA A;  1B41 B;  1YWH A;  1IDG A;  1ZAD A;  1CDQ A;  1ABT A;  3EVS C;  2VLW A;  2JVE A;  5DZ5 A;  3KFD I;  1I02 A;  2UX2 A;  1NYS A;  2H7Z A;  1TFS A;  3U73 U;  2UWR A;  1CXN A;  3KFD E;  2HLR A;  1F94 A;  2I9B E;  2X8B B;  1CB9 A;  1IDL A;  1MAH F;  1IDI A;  2MUO A;  4DO8 A;  4IYE A;  3FEV A;  2CDX A;  4OM5 A;  1ERG A;  1QM7 A;  4XJJ A;  5IMY C;  4P7U A;  1QKE A;  1CRF A;  3NH7 A;  1LXH A;  1IDH A;  1FAS A;  1CDS A;  2QJ9 C;  2MJY A;  4BIK B;  1QKD A;  3LAQ U;  1HC9 B;  3U74 U;  1VB0 A;  1KXI A;  1BTE A;  2J8B A;  1MR6 A;  1KBS A;  1LX5 B;  2LA1 A;  1NOR A;  3NEQ A;  2MHY A;  1JE9 A;  2BHI A;  2MJ4 A;  3BT2 U;  1LJZ A;  1S4Y A;  1REW C;  4ZQY A;  1JGK A;  1CHV S;  1CDR A;  4FAO E;  1FF4 A;  1NXB A;  1TGX A;  4RUD A;  1IKC A;  2H64 B;  1IQ9 A;  1KU6 B;  3EBX A;  1F8U B;  1JBD A;  2L03 A;  1CCQ A;  2JQP A;  1KBA A;  1XT3 A;  2MUP A;  1ERA A;  1RL5 A;  1M9Z A;  1KL8 A;  2BTX A;  2H5F A;  4OM4 A;  4EY8 B;  2GOO C;  3HH7 A;  1NYU A; 
#chains in the Genus database with same CATH topology
 1ONJ A;  2K3G A;  1KFH A;  5DO6 A;  3BT1 U;  2HLQ A;  2QC1 A;  1FSS B;  2FD6 U;  2ABX A;  2H64 C;  2QJB C;  1BXP A;  1LXG A;  1CVO A;  2H7Z B;  2NBT A;  1CXO A;  3NDS A;  2CCX A;  1UG4 A;  3QB4 B;  2MFA A;  1H0J A;  1PLO A;  1TXA A;  1CTX A;  1HC9 A;  1COE A;  2PJY C;  1LSI A;  2H62 D;  1NTX A;  2H8U A;  1V6P A;  3ERA A;  2N99 A;  1TXB A;  1KTZ B;  2H62 C;  4LFT A;  2CRT A;  1FSC A;  1IJC A;  1CRE A;  2GOO B;  5DU1 A;  6EBX A;  2CTX A;  1NTN A;  2QJA C;  4UY2 C;  4AEA A;  2L5S A;  3PLC A;  2MJ0 A;  2PJY B;  1KBT A;  5IMT D;  1HOY A;  1W6B A;  1HAA A;  4FAO C;  4BDT B;  1DRS A;  1G6M A;  4QTI U;  1NEA A;  4HQP F;  1COD A;  5EBX A;  1KC4 A;  2CRS A;  1HAJ A;  1ES7 B;  1KS6 A;  3VTS A;  1RGJ A;  2OFS A;  1IK8 A;  1FRA A;  1CDT A;  1L4W A;  2LCR A;  1FFJ A;  2ERA A;  1B41 B;  1YWH A;  1IDG A;  1ZAD A;  1CDQ A;  1ABT A;  3EVS C;  2VLW A;  2JVE A;  5DZ5 A;  3KFD I;  1I02 A;  2UX2 A;  1NYS A;  2H7Z A;  1TFS A;  3U73 U;  2UWR A;  1CXN A;  3KFD E;  2HLR A;  1F94 A;  2I9B E;  2X8B B;  1CB9 A;  1IDL A;  1MAH F;  1IDI A;  2MUO A;  4DO8 A;  4IYE A;  3FEV A;  2CDX A;  4OM5 A;  1ERG A;  1QM7 A;  4XJJ A;  5IMY C;  4KSN A;  4P7U A;  1QKE A;  1CRF A;  3NH7 A;  1LXH A;  1IDH A;  1FAS A;  1CDS A;  2QJ9 C;  2MJY A;  4BIK B;  1QKD A;  3LAQ U;  1HC9 B;  3U74 U;  1VB0 A;  1KXI A;  1BTE A;  2J8B A;  1MR6 A;  1KBS A;  1LX5 B;  2LA1 A;  1NOR A;  3NEQ A;  2MHY A;  1JE9 A;  2BHI A;  2MJ4 A;  3BT2 U;  1LJZ A;  1S4Y A;  1REW C;  4ZQY A;  1JGK A;  1CHV S;  1CDR A;  4FAO E;  1FF4 A;  1NXB A;  1TGX A;  4RUD A;  1IKC A;  2H64 B;  1IQ9 A;  1KU6 B;  3EBX A;  1F8U B;  1JBD A;  2L03 A;  1CCQ A;  2JQP A;  1KBA A;  1XT3 A;  2MUP A;  1ERA A;  1RL5 A;  1M9Z A;  1KL8 A;  2BTX A;  2H5F A;  4OM4 A;  4EY8 B;  2GOO C;  3HH7 A;  1NYU A; 
#chains in the Genus database with same CATH homology
 1ONJ A;  2K3G A;  1KFH A;  5DO6 A;  3BT1 U;  2HLQ A;  2QC1 A;  1FSS B;  2FD6 U;  2ABX A;  2H64 C;  2QJB C;  1BXP A;  1LXG A;  1CVO A;  2H7Z B;  2NBT A;  1CXO A;  3NDS A;  2CCX A;  1UG4 A;  3QB4 B;  2MFA A;  1H0J A;  1PLO A;  1TXA A;  1CTX A;  1HC9 A;  1COE A;  2PJY C;  1LSI A;  2H62 D;  1NTX A;  2H8U A;  1V6P A;  3ERA A;  2N99 A;  1TXB A;  1KTZ B;  2H62 C;  4LFT A;  2CRT A;  1FSC A;  1IJC A;  1CRE A;  2GOO B;  5DU1 A;  6EBX A;  2CTX A;  1NTN A;  2QJA C;  4UY2 C;  4AEA A;  2L5S A;  3PLC A;  2MJ0 A;  2PJY B;  1KBT A;  5IMT D;  1HOY A;  1W6B A;  1HAA A;  4FAO C;  4BDT B;  1DRS A;  1G6M A;  4QTI U;  1NEA A;  4HQP F;  1COD A;  5EBX A;  1KC4 A;  2CRS A;  1HAJ A;  1ES7 B;  1KS6 A;  3VTS A;  1RGJ A;  2OFS A;  1IK8 A;  1FRA A;  1CDT A;  1L4W A;  2LCR A;  1FFJ A;  2ERA A;  1B41 B;  1YWH A;  1IDG A;  1ZAD A;  1CDQ A;  1ABT A;  3EVS C;  2VLW A;  2JVE A;  5DZ5 A;  3KFD I;  1I02 A;  2UX2 A;  1NYS A;  2H7Z A;  1TFS A;  3U73 U;  2UWR A;  1CXN A;  3KFD E;  2HLR A;  1F94 A;  2I9B E;  2X8B B;  1CB9 A;  1IDL A;  1MAH F;  1IDI A;  2MUO A;  4DO8 A;  4IYE A;  3FEV A;  2CDX A;  4OM5 A;  1ERG A;  1QM7 A;  4XJJ A;  5IMY C;  4KSN A;  4P7U A;  1QKE A;  1CRF A;  3NH7 A;  1LXH A;  1IDH A;  1FAS A;  1CDS A;  2QJ9 C;  2MJY A;  4BIK B;  1QKD A;  3LAQ U;  1HC9 B;  3U74 U;  1VB0 A;  1KXI A;  1BTE A;  2J8B A;  1MR6 A;  1KBS A;  1LX5 B;  2LA1 A;  1NOR A;  3NEQ A;  2MHY A;  1JE9 A;  2BHI A;  2MJ4 A;  3BT2 U;  1LJZ A;  1S4Y A;  1REW C;  4ZQY A;  1JGK A;  1CHV S;  1CDR A;  4FAO E;  1FF4 A;  1NXB A;  1TGX A;  4RUD A;  1IKC A;  2H64 B;  1IQ9 A;  1KU6 B;  3EBX A;  1F8U B;  1JBD A;  2L03 A;  1CCQ A;  2JQP A;  1KBA A;  1XT3 A;  2MUP A;  1ERA A;  1RL5 A;  1M9Z A;  1KL8 A;  2BTX A;  2H5F A;  4OM4 A;  4EY8 B;  2GOO C;  3HH7 A;  1NYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...