1KBAA

Crystal structure of kappa-bungarotoxin at 2.3-angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords KAPPA-BUNGAROTOXIN
publication title Crystal structure of kappa-bungarotoxin at 2.3-A resolution.
pubmed doi rcsb
source organism Bungarus multicinctus
total genus 13
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1kbaA00
2H5FA 1CREA 1F94A 1KL8A 2J8BA 1IDHA 1B41B 1ERGA 1XT3A 2PJYC 2L5SA 1CDSA 3NH7A 1NORA 1KBAA 1LJZA 2MHYA 1IDLA 1F8UB 2VLWA 1CXNA 1KU6B 2HLRA 4HQPF 1CB9A 2ABXA 2GOOC 4XJJA 4BDTB 1CDRA 1PLOA 5DZ5A 1NTNA 3VTSA 1IJCA 3ERAA 3QB4B 2CRSA 1QKDA 2BHIA 2X8BB 1FASA 2H64B 2H62C 2CRTA 1KS6A 3KFDI 1JGKA 2N99A 2H62D 1MR6A 2UX2A 1FSSB 1TGXA 1QM7A 1RL5A 2QC1A 1S4YA 1LXGA 1HOYA 2MJYA 3KFDE 4OM4A 6EBXA 2K3GA 1KC4A 1HC9A 1NTXA 3HH7A 1QKEA 3BT1U 2BTXA 3EVSC 1CODA 4FAOC 1YWHA 4AEAA 1CTXA 4ZQYA 1FRAA 1COEA 1KTZB 4OM5A 4P7UA 4RUDA 5DU1A 5IMTD 2H7ZA 1KBTA 1NYSA 3EBXA 1L4WA 2CDXA 3BT2U 1HAAA 2QJBC 4EY8B 5EBXA 1JBDA 5IMYC 1KBSA 1LSIA 3LAQU 2FD6U 2OFSA 1DRSA 2H64C 1KXIA 2LCRA 3PLCA 1UG4A 2JVEA 3NEQA 4IYEA 2QJ9C 1BTEA 1ES7B 1M9ZA 2MUPA 1LXHA 1CRFA 2NBTA 1FFJA 1TFSA 5DO6A 4BIKB 1CCQA 2QJAC 1CHVS 1JE9A 2PJYB 1MAHF 4QTIU 2UWRA 4UY2C 1FSCA 1IKCA 2JQPA 2ERAA 1VB0A 1HC9B 3U73U 2I9BE 1IK8A 2GOOB 1I02A 3FEVA 1V6PA 3U74U 1KFHA 1W6BA 2MFAA 1CXOA 2CTXA 1CDTA 1IDGA 2MJ0A 1IDIA 1TXBA 4DO8A 1H0JA 4FAOE 1CDQA 1ONJA 2H7ZB 2LA1A 4LFTA 2MJ4A 1REWC 1G6MA 1TXAA 1CVOA 1BXPA 2L03A 2HLQA 1LX5B 2MUOA 1IQ9A 1NXBA 1ZADA 1HAJA 2CCXA 1ERAA 1RGJA 3NDSA 1ABTA 1FF4A 2H8UA 1NEAA 1NYUA
chains in the Genus database with same CATH superfamily
2H5FA 1CREA 1F94A 1KL8A 2J8BA 1IDHA 1B41B 1ERGA 1XT3A 2PJYC 2L5SA 1CDSA 3NH7A 1NORA 1KBAA 1LJZA 2MHYA 1IDLA 1F8UB 2VLWA 1CXNA 1KU6B 2HLRA 4HQPF 1CB9A 2ABXA 2GOOC 4XJJA 4BDTB 1CDRA 1PLOA 5DZ5A 1NTNA 3VTSA 1IJCA 3ERAA 3QB4B 2CRSA 1QKDA 2BHIA 2X8BB 1FASA 2H64B 2H62C 2CRTA 1KS6A 3KFDI 1JGKA 2N99A 2H62D 1MR6A 2UX2A 1FSSB 1TGXA 1QM7A 1RL5A 2QC1A 1S4YA 1LXGA 1HOYA 2MJYA 3KFDE 4OM4A 6EBXA 2K3GA 1KC4A 1HC9A 1NTXA 3HH7A 1QKEA 3BT1U 2BTXA 3EVSC 1CODA 4FAOC 1YWHA 4AEAA 1CTXA 4ZQYA 1FRAA 1COEA 1KTZB 4OM5A 4P7UA 4RUDA 5DU1A 5IMTD 2H7ZA 1KBTA 1NYSA 3EBXA 1L4WA 2CDXA 3BT2U 1HAAA 2QJBC 4EY8B 5EBXA 1JBDA 5IMYC 1KBSA 1LSIA 3LAQU 2FD6U 2OFSA 1DRSA 2H64C 1KXIA 2LCRA 3PLCA 1UG4A 2JVEA 3NEQA 4IYEA 2QJ9C 1BTEA 1ES7B 1M9ZA 2MUPA 1LXHA 1CRFA 2NBTA 1FFJA 4KSNA 1TFSA 5DO6A 4BIKB 1CCQA 2QJAC 1CHVS 1JE9A 2PJYB 1MAHF 4QTIU 2UWRA 4UY2C 1FSCA 1IKCA 2JQPA 2ERAA 1VB0A 1HC9B 3U73U 2I9BE 1IK8A 2GOOB 1I02A 3FEVA 1V6PA 3U74U 1KFHA 1W6BA 2MFAA 1CXOA 2CTXA 1CDTA 1IDGA 2MJ0A 1IDIA 1TXBA 4DO8A 1H0JA 4FAOE 1CDQA 1ONJA 2H7ZB 2LA1A 4LFTA 2MJ4A 1REWC 1G6MA 1TXAA 1CVOA 1BXPA 2L03A 2HLQA 1LX5B 2MUOA 1IQ9A 1NXBA 1ZADA 1HAJA 2CCXA 1ERAA 1RGJA 3NDSA 1ABTA 1FF4A 2H8UA 1NEAA 1NYUA
chains in the Genus database with same CATH topology
2H5FA 1CREA 1F94A 1KL8A 2J8BA 1IDHA 1B41B 1ERGA 1XT3A 2PJYC 2L5SA 1CDSA 3NH7A 1NORA 1KBAA 1LJZA 2MHYA 1IDLA 1F8UB 2VLWA 1CXNA 1KU6B 2HLRA 4HQPF 1CB9A 2ABXA 2GOOC 4XJJA 4BDTB 1CDRA 1PLOA 5DZ5A 1NTNA 3VTSA 1IJCA 3ERAA 3QB4B 2CRSA 1QKDA 2BHIA 2X8BB 1FASA 2H64B 2H62C 2CRTA 1KS6A 3KFDI 1JGKA 2N99A 2H62D 1MR6A 2UX2A 1FSSB 1TGXA 1QM7A 1RL5A 2QC1A 1S4YA 1LXGA 1HOYA 2MJYA 3KFDE 4OM4A 6EBXA 2K3GA 1KC4A 1HC9A 1NTXA 3HH7A 1QKEA 3BT1U 2BTXA 3EVSC 1CODA 4FAOC 1YWHA 4AEAA 1CTXA 4ZQYA 1FRAA 1COEA 1KTZB 4OM5A 4P7UA 4RUDA 5DU1A 5IMTD 2H7ZA 1KBTA 1NYSA 3EBXA 1L4WA 2CDXA 3BT2U 1HAAA 2QJBC 4EY8B 5EBXA 1JBDA 5IMYC 1KBSA 1LSIA 3LAQU 2FD6U 2OFSA 1DRSA 2H64C 1KXIA 2LCRA 3PLCA 1UG4A 2JVEA 3NEQA 4IYEA 2QJ9C 1BTEA 1ES7B 1M9ZA 2MUPA 1LXHA 1CRFA 2NBTA 1FFJA 4KSNA 1TFSA 5DO6A 4BIKB 1CCQA 2QJAC 1CHVS 1JE9A 2PJYB 1MAHF 4QTIU 2UWRA 4UY2C 1FSCA 1IKCA 2JQPA 2ERAA 1VB0A 1HC9B 3U73U 2I9BE 1IK8A 2GOOB 1I02A 3FEVA 1V6PA 3U74U 1KFHA 1W6BA 2MFAA 1CXOA 2CTXA 1CDTA 1IDGA 2MJ0A 1IDIA 1TXBA 4DO8A 1H0JA 4FAOE 1CDQA 1ONJA 2H7ZB 2LA1A 4LFTA 2MJ4A 1REWC 1G6MA 1TXAA 1CVOA 1BXPA 2L03A 2HLQA 1LX5B 2MUOA 1IQ9A 1NXBA 1ZADA 1HAJA 2CCXA 1ERAA 1RGJA 3NDSA 1ABTA 1FF4A 2H8UA 1NEAA 1NYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H5F A;  1CRE A;  1F94 A;  1KL8 A;  2J8B A;  1IDH A;  1B41 B;  1ERG A;  1XT3 A;  2PJY C;  2L5S A;  1CDS A;  3NH7 A;  1NOR A;  1KBA A;  1LJZ A;  2MHY A;  1IDL A;  1F8U B;  2VLW A;  1CXN A;  1KU6 B;  2HLR A;  4HQP F;  1CB9 A;  2ABX A;  2GOO C;  4XJJ A;  4BDT B;  1CDR A;  1PLO A;  5DZ5 A;  1NTN A;  3VTS A;  1IJC A;  3ERA A;  3QB4 B;  2CRS A;  1QKD A;  2BHI A;  2X8B B;  1FAS A;  2H64 B;  2H62 C;  2CRT A;  1KS6 A;  3KFD I;  1JGK A;  2N99 A;  2H62 D;  1MR6 A;  2UX2 A;  1FSS B;  1TGX A;  1QM7 A;  1RL5 A;  2QC1 A;  1S4Y A;  1LXG A;  1HOY A;  2MJY A;  3KFD E;  4OM4 A;  6EBX A;  2K3G A;  1KC4 A;  1HC9 A;  1NTX A;  3HH7 A;  1QKE A;  3BT1 U;  2BTX A;  3EVS C;  1COD A;  4FAO C;  1YWH A;  4AEA A;  1CTX A;  4ZQY A;  1FRA A;  1COE A;  1KTZ B;  4OM5 A;  4P7U A;  4RUD A;  5DU1 A;  5IMT D;  2H7Z A;  1KBT A;  1NYS A;  3EBX A;  1L4W A;  2CDX A;  3BT2 U;  1HAA A;  2QJB C;  4EY8 B;  5EBX A;  1JBD A;  5IMY C;  1KBS A;  1LSI A;  3LAQ U;  2FD6 U;  2OFS A;  1DRS A;  2H64 C;  1KXI A;  2LCR A;  3PLC A;  1UG4 A;  2JVE A;  3NEQ A;  4IYE A;  2QJ9 C;  1BTE A;  1ES7 B;  1M9Z A;  2MUP A;  1LXH A;  1CRF A;  2NBT A;  1FFJ A;  1TFS A;  5DO6 A;  4BIK B;  1CCQ A;  2QJA C;  1CHV S;  1JE9 A;  2PJY B;  1MAH F;  4QTI U;  2UWR A;  4UY2 C;  1FSC A;  1IKC A;  2JQP A;  2ERA A;  1VB0 A;  1HC9 B;  3U73 U;  2I9B E;  1IK8 A;  2GOO B;  1I02 A;  3FEV A;  1V6P A;  3U74 U;  1KFH A;  1W6B A;  2MFA A;  1CXO A;  2CTX A;  1CDT A;  1IDG A;  2MJ0 A;  1IDI A;  1TXB A;  4DO8 A;  1H0J A;  4FAO E;  1CDQ A;  1ONJ A;  2H7Z B;  2LA1 A;  4LFT A;  2MJ4 A;  1REW C;  1G6M A;  1TXA A;  1CVO A;  1BXP A;  2L03 A;  2HLQ A;  1LX5 B;  2MUO A;  1IQ9 A;  1NXB A;  1ZAD A;  1HAJ A;  2CCX A;  1ERA A;  1RGJ A;  3NDS A;  1ABT A;  1FF4 A;  2H8U A;  1NEA A;  1NYU A; 
#chains in the Genus database with same CATH topology
 2H5F A;  1CRE A;  1F94 A;  1KL8 A;  2J8B A;  1IDH A;  1B41 B;  1ERG A;  1XT3 A;  2PJY C;  2L5S A;  1CDS A;  3NH7 A;  1NOR A;  1KBA A;  1LJZ A;  2MHY A;  1IDL A;  1F8U B;  2VLW A;  1CXN A;  1KU6 B;  2HLR A;  4HQP F;  1CB9 A;  2ABX A;  2GOO C;  4XJJ A;  4BDT B;  1CDR A;  1PLO A;  5DZ5 A;  1NTN A;  3VTS A;  1IJC A;  3ERA A;  3QB4 B;  2CRS A;  1QKD A;  2BHI A;  2X8B B;  1FAS A;  2H64 B;  2H62 C;  2CRT A;  1KS6 A;  3KFD I;  1JGK A;  2N99 A;  2H62 D;  1MR6 A;  2UX2 A;  1FSS B;  1TGX A;  1QM7 A;  1RL5 A;  2QC1 A;  1S4Y A;  1LXG A;  1HOY A;  2MJY A;  3KFD E;  4OM4 A;  6EBX A;  2K3G A;  1KC4 A;  1HC9 A;  1NTX A;  3HH7 A;  1QKE A;  3BT1 U;  2BTX A;  3EVS C;  1COD A;  4FAO C;  1YWH A;  4AEA A;  1CTX A;  4ZQY A;  1FRA A;  1COE A;  1KTZ B;  4OM5 A;  4P7U A;  4RUD A;  5DU1 A;  5IMT D;  2H7Z A;  1KBT A;  1NYS A;  3EBX A;  1L4W A;  2CDX A;  3BT2 U;  1HAA A;  2QJB C;  4EY8 B;  5EBX A;  1JBD A;  5IMY C;  1KBS A;  1LSI A;  3LAQ U;  2FD6 U;  2OFS A;  1DRS A;  2H64 C;  1KXI A;  2LCR A;  3PLC A;  1UG4 A;  2JVE A;  3NEQ A;  4IYE A;  2QJ9 C;  1BTE A;  1ES7 B;  1M9Z A;  2MUP A;  1LXH A;  1CRF A;  2NBT A;  1FFJ A;  4KSN A;  1TFS A;  5DO6 A;  4BIK B;  1CCQ A;  2QJA C;  1CHV S;  1JE9 A;  2PJY B;  1MAH F;  4QTI U;  2UWR A;  4UY2 C;  1FSC A;  1IKC A;  2JQP A;  2ERA A;  1VB0 A;  1HC9 B;  3U73 U;  2I9B E;  1IK8 A;  2GOO B;  1I02 A;  3FEV A;  1V6P A;  3U74 U;  1KFH A;  1W6B A;  2MFA A;  1CXO A;  2CTX A;  1CDT A;  1IDG A;  2MJ0 A;  1IDI A;  1TXB A;  4DO8 A;  1H0J A;  4FAO E;  1CDQ A;  1ONJ A;  2H7Z B;  2LA1 A;  4LFT A;  2MJ4 A;  1REW C;  1G6M A;  1TXA A;  1CVO A;  1BXP A;  2L03 A;  2HLQ A;  1LX5 B;  2MUO A;  1IQ9 A;  1NXB A;  1ZAD A;  1HAJ A;  2CCX A;  1ERA A;  1RGJ A;  3NDS A;  1ABT A;  1FF4 A;  2H8U A;  1NEA A;  1NYU A; 
#chains in the Genus database with same CATH homology
 2H5F A;  1CRE A;  1F94 A;  1KL8 A;  2J8B A;  1IDH A;  1B41 B;  1ERG A;  1XT3 A;  2PJY C;  2L5S A;  1CDS A;  3NH7 A;  1NOR A;  1KBA A;  1LJZ A;  2MHY A;  1IDL A;  1F8U B;  2VLW A;  1CXN A;  1KU6 B;  2HLR A;  4HQP F;  1CB9 A;  2ABX A;  2GOO C;  4XJJ A;  4BDT B;  1CDR A;  1PLO A;  5DZ5 A;  1NTN A;  3VTS A;  1IJC A;  3ERA A;  3QB4 B;  2CRS A;  1QKD A;  2BHI A;  2X8B B;  1FAS A;  2H64 B;  2H62 C;  2CRT A;  1KS6 A;  3KFD I;  1JGK A;  2N99 A;  2H62 D;  1MR6 A;  2UX2 A;  1FSS B;  1TGX A;  1QM7 A;  1RL5 A;  2QC1 A;  1S4Y A;  1LXG A;  1HOY A;  2MJY A;  3KFD E;  4OM4 A;  6EBX A;  2K3G A;  1KC4 A;  1HC9 A;  1NTX A;  3HH7 A;  1QKE A;  3BT1 U;  2BTX A;  3EVS C;  1COD A;  4FAO C;  1YWH A;  4AEA A;  1CTX A;  4ZQY A;  1FRA A;  1COE A;  1KTZ B;  4OM5 A;  4P7U A;  4RUD A;  5DU1 A;  5IMT D;  2H7Z A;  1KBT A;  1NYS A;  3EBX A;  1L4W A;  2CDX A;  3BT2 U;  1HAA A;  2QJB C;  4EY8 B;  5EBX A;  1JBD A;  5IMY C;  1KBS A;  1LSI A;  3LAQ U;  2FD6 U;  2OFS A;  1DRS A;  2H64 C;  1KXI A;  2LCR A;  3PLC A;  1UG4 A;  2JVE A;  3NEQ A;  4IYE A;  2QJ9 C;  1BTE A;  1ES7 B;  1M9Z A;  2MUP A;  1LXH A;  1CRF A;  2NBT A;  1FFJ A;  4KSN A;  1TFS A;  5DO6 A;  4BIK B;  1CCQ A;  2QJA C;  1CHV S;  1JE9 A;  2PJY B;  1MAH F;  4QTI U;  2UWR A;  4UY2 C;  1FSC A;  1IKC A;  2JQP A;  2ERA A;  1VB0 A;  1HC9 B;  3U73 U;  2I9B E;  1IK8 A;  2GOO B;  1I02 A;  3FEV A;  1V6P A;  3U74 U;  1KFH A;  1W6B A;  2MFA A;  1CXO A;  2CTX A;  1CDT A;  1IDG A;  2MJ0 A;  1IDI A;  1TXB A;  4DO8 A;  1H0J A;  4FAO E;  1CDQ A;  1ONJ A;  2H7Z B;  2LA1 A;  4LFT A;  2MJ4 A;  1REW C;  1G6M A;  1TXA A;  1CVO A;  1BXP A;  2L03 A;  2HLQ A;  1LX5 B;  2MUO A;  1IQ9 A;  1NXB A;  1ZAD A;  1HAJ A;  2CCX A;  1ERA A;  1RGJ A;  3NDS A;  1ABT A;  1FF4 A;  2H8U A;  1NEA A;  1NYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...