2MUPA

Structure of the cis-(tyr39-pro40) form of the human secreted ly-6/upar related protein-1 (slurp-1)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
82
structure length
82
Chain Sequence
MLKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Properties of Human Secreted Ly-6/uPAR Related Protein-1 (SLURP-1) Imply a Non-Canonical Mode of Interaction with 7 nAChR
rcsb
source organism Homo sapiens
molecule tags Neuropeptide
molecule keywords Secreted Ly-6/uPAR-related protein 1
total genus 7
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2mupA00
4OM4A 1IDHA 3FEVA 1IJCA 1IQ9A 2J8BA 2FD6U 2MJ0A 1IDGA 1CTXA 2CRTA 1KC4A 1CDSA 1FSCA 1KL8A 2GOOC 2I9BE 1TGXA 1VB0A 4IYEA 1L4WA 3NH7A 1W6BA 1HC9A 4FAOC 1BXPA 2H8UA 5EBXA 1HAJA 1FSSB 2BHIA 1YWHA 4BIKB 1KBTA 2GOOB 1IDIA 2BTXA 1RL5A 2X8BB 1NTNA 3U73U 1KU6B 3ERAA 4HQPF 3VTSA 2MUOA 4ZQYA 1JGKA 2H7ZB 1CCQA 1LJZA 2MFAA 3EBXA 1JE9A 5IMYC 1COEA 1MAHF 4UY2C 2LCRA 1S4YA 2QJBC 1CRFA 3QB4B 4LFTA 2MUPA 4RUDA 3NEQA 4OM5A 1CXNA 1F8UB 2MJ4A 2QC1A 2QJ9C 1LX5B 2UWRA 3PLCA 1CB9A 1FRAA 3NDSA 3LAQU 2K3GA 1CVOA 4BDTB 1NXBA 1KXIA 3HH7A 1NTXA 2H62C 2N99A 4FAOE 1CODA 2CCXA 2ABXA 1NEAA 1QM7A 2MHYA 2L5SA 5DU1A 2JVEA 1TFSA 1FF4A 1HAAA 1QKDA 6EBXA 3EVSC 1XT3A 2CDXA 2LA1A 4QTIU 2PJYB 1CDRA 2UX2A 5DO6A 3BT1U 4AEAA 1H0JA 2HLQA 1CDQA 1LXHA 1REWC 1IKCA 1KBAA 1LXGA 2H7ZA 4XJJA 4EY8B 1TXBA 3U74U 1ES7B 1NYUA 1MR6A 3KFDE 2L03A 1HOYA 1FASA 1M9ZA 1IK8A 1CHVS 1CDTA 1ERGA 1QKEA 1RGJA 1KFHA 1FFJA 1I02A 1NORA 2H64C 2H64B 3KFDI 4P7UA 1HC9B 1KBSA 1IDLA 2CRSA 1ABTA 1CXOA 1NYSA 1B41B 1CREA 2PJYC 1JBDA 1V6PA 4DO8A 1DRSA 2NBTA 1KS6A 1TXAA 2OFSA 5IMTD 2HLRA 2VLWA 1BTEA 1KTZB 5DZ5A 1LSIA 2H62D 2H5FA 1ZADA 1ONJA 1G6MA 1PLOA 2MJYA 2QJAC 1ERAA 2JQPA 2CTXA 3BT2U 1F94A 1UG4A 2ERAA
chains in the Genus database with same CATH superfamily
4OM4A 1IDHA 3FEVA 1IJCA 1IQ9A 2J8BA 2FD6U 2MJ0A 1IDGA 1CTXA 2CRTA 1KC4A 1CDSA 1FSCA 1KL8A 2GOOC 2I9BE 1TGXA 1VB0A 4IYEA 1L4WA 3NH7A 1W6BA 1HC9A 4FAOC 1BXPA 2H8UA 5EBXA 1HAJA 1FSSB 2BHIA 1YWHA 4BIKB 1KBTA 2GOOB 1IDIA 2BTXA 1RL5A 2X8BB 1NTNA 3U73U 1KU6B 3ERAA 4HQPF 3VTSA 2MUOA 4ZQYA 1JGKA 2H7ZB 1CCQA 1LJZA 2MFAA 3EBXA 1JE9A 5IMYC 1COEA 1MAHF 4UY2C 2LCRA 1S4YA 2QJBC 1CRFA 3QB4B 4LFTA 2MUPA 4RUDA 3NEQA 4OM5A 1CXNA 1F8UB 2MJ4A 2QC1A 2QJ9C 1LX5B 2UWRA 3PLCA 1CB9A 1FRAA 3NDSA 3LAQU 2K3GA 1CVOA 4BDTB 1NXBA 1KXIA 3HH7A 1NTXA 2H62C 2N99A 4FAOE 1CODA 2CCXA 2ABXA 1NEAA 1QM7A 2MHYA 2L5SA 5DU1A 2JVEA 1TFSA 1FF4A 1HAAA 1QKDA 6EBXA 3EVSC 1XT3A 2CDXA 2LA1A 4QTIU 2PJYB 1CDRA 2UX2A 5DO6A 3BT1U 4AEAA 1H0JA 2HLQA 1CDQA 1LXHA 1REWC 1IKCA 1KBAA 1LXGA 2H7ZA 4XJJA 4EY8B 1TXBA 3U74U 1ES7B 1NYUA 1MR6A 3KFDE 2L03A 1HOYA 1FASA 1M9ZA 1IK8A 1CHVS 1CDTA 1ERGA 1QKEA 1RGJA 1KFHA 4KSNA 1FFJA 1I02A 1NORA 2H64C 2H64B 3KFDI 4P7UA 1HC9B 1KBSA 1IDLA 2CRSA 1ABTA 1CXOA 1NYSA 1B41B 1CREA 2PJYC 1JBDA 1V6PA 4DO8A 1DRSA 2NBTA 1KS6A 1TXAA 2OFSA 5IMTD 2HLRA 2VLWA 1BTEA 1KTZB 5DZ5A 1LSIA 2H62D 2H5FA 1ZADA 1ONJA 1G6MA 1PLOA 2MJYA 2QJAC 1ERAA 2JQPA 2CTXA 3BT2U 1F94A 1UG4A 2ERAA
chains in the Genus database with same CATH topology
4OM4A 1IDHA 3FEVA 1IJCA 1IQ9A 2J8BA 2FD6U 2MJ0A 1IDGA 1CTXA 2CRTA 1KC4A 1CDSA 1FSCA 1KL8A 2GOOC 2I9BE 1TGXA 1VB0A 4IYEA 1L4WA 3NH7A 1W6BA 1HC9A 4FAOC 1BXPA 2H8UA 5EBXA 1HAJA 1FSSB 2BHIA 1YWHA 4BIKB 1KBTA 2GOOB 1IDIA 2BTXA 1RL5A 2X8BB 1NTNA 3U73U 1KU6B 3ERAA 4HQPF 3VTSA 2MUOA 4ZQYA 1JGKA 2H7ZB 1CCQA 1LJZA 2MFAA 3EBXA 1JE9A 5IMYC 1COEA 1MAHF 4UY2C 2LCRA 1S4YA 2QJBC 1CRFA 3QB4B 4LFTA 2MUPA 4RUDA 3NEQA 4OM5A 1CXNA 1F8UB 2MJ4A 2QC1A 2QJ9C 1LX5B 2UWRA 3PLCA 1CB9A 1FRAA 3NDSA 3LAQU 2K3GA 1CVOA 4BDTB 1NXBA 1KXIA 3HH7A 1NTXA 2H62C 2N99A 4FAOE 1CODA 2CCXA 2ABXA 1NEAA 1QM7A 2MHYA 2L5SA 5DU1A 2JVEA 1TFSA 1FF4A 1HAAA 1QKDA 6EBXA 3EVSC 1XT3A 2CDXA 2LA1A 4QTIU 2PJYB 1CDRA 2UX2A 5DO6A 3BT1U 4AEAA 1H0JA 2HLQA 1CDQA 1LXHA 1REWC 1IKCA 1KBAA 1LXGA 2H7ZA 4XJJA 4EY8B 1TXBA 3U74U 1ES7B 1NYUA 1MR6A 3KFDE 2L03A 1HOYA 1FASA 1M9ZA 1IK8A 1CHVS 1CDTA 1ERGA 1QKEA 1RGJA 1KFHA 4KSNA 1FFJA 1I02A 1NORA 2H64C 2H64B 3KFDI 4P7UA 1HC9B 1KBSA 1IDLA 2CRSA 1ABTA 1CXOA 1NYSA 1B41B 1CREA 2PJYC 1JBDA 1V6PA 4DO8A 1DRSA 2NBTA 1KS6A 1TXAA 2OFSA 5IMTD 2HLRA 2VLWA 1BTEA 1KTZB 5DZ5A 1LSIA 2H62D 2H5FA 1ZADA 1ONJA 1G6MA 1PLOA 2MJYA 2QJAC 1ERAA 2JQPA 2CTXA 3BT2U 1F94A 1UG4A 2ERAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OM4 A;  1IDH A;  3FEV A;  1IJC A;  1IQ9 A;  2J8B A;  2FD6 U;  2MJ0 A;  1IDG A;  1CTX A;  2CRT A;  1KC4 A;  1CDS A;  1FSC A;  1KL8 A;  2GOO C;  2I9B E;  1TGX A;  1VB0 A;  4IYE A;  1L4W A;  3NH7 A;  1W6B A;  1HC9 A;  4FAO C;  1BXP A;  2H8U A;  5EBX A;  1HAJ A;  1FSS B;  2BHI A;  1YWH A;  4BIK B;  1KBT A;  2GOO B;  1IDI A;  2BTX A;  1RL5 A;  2X8B B;  1NTN A;  3U73 U;  1KU6 B;  3ERA A;  4HQP F;  3VTS A;  2MUO A;  4ZQY A;  1JGK A;  2H7Z B;  1CCQ A;  1LJZ A;  2MFA A;  3EBX A;  1JE9 A;  5IMY C;  1COE A;  1MAH F;  4UY2 C;  2LCR A;  1S4Y A;  2QJB C;  1CRF A;  3QB4 B;  4LFT A;  2MUP A;  4RUD A;  3NEQ A;  4OM5 A;  1CXN A;  1F8U B;  2MJ4 A;  2QC1 A;  2QJ9 C;  1LX5 B;  2UWR A;  3PLC A;  1CB9 A;  1FRA A;  3NDS A;  3LAQ U;  2K3G A;  1CVO A;  4BDT B;  1NXB A;  1KXI A;  3HH7 A;  1NTX A;  2H62 C;  2N99 A;  4FAO E;  1COD A;  2CCX A;  2ABX A;  1NEA A;  1QM7 A;  2MHY A;  2L5S A;  5DU1 A;  2JVE A;  1TFS A;  1FF4 A;  1HAA A;  1QKD A;  6EBX A;  3EVS C;  1XT3 A;  2CDX A;  2LA1 A;  4QTI U;  2PJY B;  1CDR A;  2UX2 A;  5DO6 A;  3BT1 U;  4AEA A;  1H0J A;  2HLQ A;  1CDQ A;  1LXH A;  1REW C;  1IKC A;  1KBA A;  1LXG A;  2H7Z A;  4XJJ A;  4EY8 B;  1TXB A;  3U74 U;  1ES7 B;  1NYU A;  1MR6 A;  3KFD E;  2L03 A;  1HOY A;  1FAS A;  1M9Z A;  1IK8 A;  1CHV S;  1CDT A;  1ERG A;  1QKE A;  1RGJ A;  1KFH A;  1FFJ A;  1I02 A;  1NOR A;  2H64 C;  2H64 B;  3KFD I;  4P7U A;  1HC9 B;  1KBS A;  1IDL A;  2CRS A;  1ABT A;  1CXO A;  1NYS A;  1B41 B;  1CRE A;  2PJY C;  1JBD A;  1V6P A;  4DO8 A;  1DRS A;  2NBT A;  1KS6 A;  1TXA A;  2OFS A;  5IMT D;  2HLR A;  2VLW A;  1BTE A;  1KTZ B;  5DZ5 A;  1LSI A;  2H62 D;  2H5F A;  1ZAD A;  1ONJ A;  1G6M A;  1PLO A;  2MJY A;  2QJA C;  1ERA A;  2JQP A;  2CTX A;  3BT2 U;  1F94 A;  1UG4 A;  2ERA A; 
#chains in the Genus database with same CATH topology
 4OM4 A;  1IDH A;  3FEV A;  1IJC A;  1IQ9 A;  2J8B A;  2FD6 U;  2MJ0 A;  1IDG A;  1CTX A;  2CRT A;  1KC4 A;  1CDS A;  1FSC A;  1KL8 A;  2GOO C;  2I9B E;  1TGX A;  1VB0 A;  4IYE A;  1L4W A;  3NH7 A;  1W6B A;  1HC9 A;  4FAO C;  1BXP A;  2H8U A;  5EBX A;  1HAJ A;  1FSS B;  2BHI A;  1YWH A;  4BIK B;  1KBT A;  2GOO B;  1IDI A;  2BTX A;  1RL5 A;  2X8B B;  1NTN A;  3U73 U;  1KU6 B;  3ERA A;  4HQP F;  3VTS A;  2MUO A;  4ZQY A;  1JGK A;  2H7Z B;  1CCQ A;  1LJZ A;  2MFA A;  3EBX A;  1JE9 A;  5IMY C;  1COE A;  1MAH F;  4UY2 C;  2LCR A;  1S4Y A;  2QJB C;  1CRF A;  3QB4 B;  4LFT A;  2MUP A;  4RUD A;  3NEQ A;  4OM5 A;  1CXN A;  1F8U B;  2MJ4 A;  2QC1 A;  2QJ9 C;  1LX5 B;  2UWR A;  3PLC A;  1CB9 A;  1FRA A;  3NDS A;  3LAQ U;  2K3G A;  1CVO A;  4BDT B;  1NXB A;  1KXI A;  3HH7 A;  1NTX A;  2H62 C;  2N99 A;  4FAO E;  1COD A;  2CCX A;  2ABX A;  1NEA A;  1QM7 A;  2MHY A;  2L5S A;  5DU1 A;  2JVE A;  1TFS A;  1FF4 A;  1HAA A;  1QKD A;  6EBX A;  3EVS C;  1XT3 A;  2CDX A;  2LA1 A;  4QTI U;  2PJY B;  1CDR A;  2UX2 A;  5DO6 A;  3BT1 U;  4AEA A;  1H0J A;  2HLQ A;  1CDQ A;  1LXH A;  1REW C;  1IKC A;  1KBA A;  1LXG A;  2H7Z A;  4XJJ A;  4EY8 B;  1TXB A;  3U74 U;  1ES7 B;  1NYU A;  1MR6 A;  3KFD E;  2L03 A;  1HOY A;  1FAS A;  1M9Z A;  1IK8 A;  1CHV S;  1CDT A;  1ERG A;  1QKE A;  1RGJ A;  1KFH A;  4KSN A;  1FFJ A;  1I02 A;  1NOR A;  2H64 C;  2H64 B;  3KFD I;  4P7U A;  1HC9 B;  1KBS A;  1IDL A;  2CRS A;  1ABT A;  1CXO A;  1NYS A;  1B41 B;  1CRE A;  2PJY C;  1JBD A;  1V6P A;  4DO8 A;  1DRS A;  2NBT A;  1KS6 A;  1TXA A;  2OFS A;  5IMT D;  2HLR A;  2VLW A;  1BTE A;  1KTZ B;  5DZ5 A;  1LSI A;  2H62 D;  2H5F A;  1ZAD A;  1ONJ A;  1G6M A;  1PLO A;  2MJY A;  2QJA C;  1ERA A;  2JQP A;  2CTX A;  3BT2 U;  1F94 A;  1UG4 A;  2ERA A; 
#chains in the Genus database with same CATH homology
 4OM4 A;  1IDH A;  3FEV A;  1IJC A;  1IQ9 A;  2J8B A;  2FD6 U;  2MJ0 A;  1IDG A;  1CTX A;  2CRT A;  1KC4 A;  1CDS A;  1FSC A;  1KL8 A;  2GOO C;  2I9B E;  1TGX A;  1VB0 A;  4IYE A;  1L4W A;  3NH7 A;  1W6B A;  1HC9 A;  4FAO C;  1BXP A;  2H8U A;  5EBX A;  1HAJ A;  1FSS B;  2BHI A;  1YWH A;  4BIK B;  1KBT A;  2GOO B;  1IDI A;  2BTX A;  1RL5 A;  2X8B B;  1NTN A;  3U73 U;  1KU6 B;  3ERA A;  4HQP F;  3VTS A;  2MUO A;  4ZQY A;  1JGK A;  2H7Z B;  1CCQ A;  1LJZ A;  2MFA A;  3EBX A;  1JE9 A;  5IMY C;  1COE A;  1MAH F;  4UY2 C;  2LCR A;  1S4Y A;  2QJB C;  1CRF A;  3QB4 B;  4LFT A;  2MUP A;  4RUD A;  3NEQ A;  4OM5 A;  1CXN A;  1F8U B;  2MJ4 A;  2QC1 A;  2QJ9 C;  1LX5 B;  2UWR A;  3PLC A;  1CB9 A;  1FRA A;  3NDS A;  3LAQ U;  2K3G A;  1CVO A;  4BDT B;  1NXB A;  1KXI A;  3HH7 A;  1NTX A;  2H62 C;  2N99 A;  4FAO E;  1COD A;  2CCX A;  2ABX A;  1NEA A;  1QM7 A;  2MHY A;  2L5S A;  5DU1 A;  2JVE A;  1TFS A;  1FF4 A;  1HAA A;  1QKD A;  6EBX A;  3EVS C;  1XT3 A;  2CDX A;  2LA1 A;  4QTI U;  2PJY B;  1CDR A;  2UX2 A;  5DO6 A;  3BT1 U;  4AEA A;  1H0J A;  2HLQ A;  1CDQ A;  1LXH A;  1REW C;  1IKC A;  1KBA A;  1LXG A;  2H7Z A;  4XJJ A;  4EY8 B;  1TXB A;  3U74 U;  1ES7 B;  1NYU A;  1MR6 A;  3KFD E;  2L03 A;  1HOY A;  1FAS A;  1M9Z A;  1IK8 A;  1CHV S;  1CDT A;  1ERG A;  1QKE A;  1RGJ A;  1KFH A;  4KSN A;  1FFJ A;  1I02 A;  1NOR A;  2H64 C;  2H64 B;  3KFD I;  4P7U A;  1HC9 B;  1KBS A;  1IDL A;  2CRS A;  1ABT A;  1CXO A;  1NYS A;  1B41 B;  1CRE A;  2PJY C;  1JBD A;  1V6P A;  4DO8 A;  1DRS A;  2NBT A;  1KS6 A;  1TXA A;  2OFS A;  5IMT D;  2HLR A;  2VLW A;  1BTE A;  1KTZ B;  5DZ5 A;  1LSI A;  2H62 D;  2H5F A;  1ZAD A;  1ONJ A;  1G6M A;  1PLO A;  2MJY A;  2QJA C;  1ERA A;  2JQP A;  2CTX A;  3BT2 U;  1F94 A;  1UG4 A;  2ERA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...