2MUPA

Structure of the cis-(tyr39-pro40) form of the human secreted ly-6/upar related protein-1 (slurp-1)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
82
structure length
82
Chain Sequence
MLKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Neuropeptide
molecule keywords Secreted Ly-6/uPAR-related protein 1
publication title Structural and Functional Properties of Human Secreted Ly-6/uPAR Related Protein-1 (SLURP-1) Imply a Non-Canonical Mode of Interaction with 7 nAChR
rcsb
source organism Homo sapiens
total genus 7
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2mupA00
1S4YA 1CDQA 1LXHA 1TXAA 2H64B 5IMTD 2CRSA 2BTXA 2H8UA 3NDSA 4FAOE 4AEAA 2MHYA 1F8UB 1HAJA 1KS6A 2ABXA 1NEAA 6EBXA 1RL5A 1ES7B 1ABTA 2NBTA 1ONJA 4RUDA 2HLQA 2MJYA 4UY2C 1LX5B 1IDLA 1FSSB 4IYEA 2CRTA 1NYSA 5DU1A 5DO6A 4OM5A 1TFSA 2L5SA 2J8BA 1CODA 1KBAA 2GOOC 1LSIA 2UX2A 2FD6U 3KFDI 2HLRA 2K3GA 3NEQA 1VB0A 1NTNA 5DZ5A 2BHIA 1IDIA 5IMYC 1QKDA 1NXBA 1L4WA 4LFTA 3U74U 1M9ZA 2ERAA 1KTZB 1COEA 1HOYA 2MJ4A 2H7ZA 2I9BE 4P7UA 1BXPA 2LA1A 1TXBA 4XJJA 2L03A 4BDTB 3EVSC 2PJYB 2H64C 2QJBC 4FAOC 1KXIA 1CHVS 1PLOA 1KL8A 1CDTA 4HQPF 3VTSA 5EBXA 1MAHF 1RGJA 1IDHA 1I02A 3QB4B 4BIKB 3FEVA 1V6PA 2VLWA 1IQ9A 1CXNA 1KBSA 3EBXA 1CDSA 1HC9A 1LXGA 1XT3A 1JBDA 1CDRA 1CB9A 2QC1A 1KFHA 1LJZA 3LAQU 1DRSA 3NH7A 2H62C 2X8BB 2LCRA 1MR6A 3ERAA 1JE9A 1NTXA 4ZQYA 2JQPA 3KFDE 2JVEA 1ERGA 4DO8A 2H5FA 2MFAA 1ERAA 1BTEA 4OM4A 1HAAA 1ZADA 2CTXA 2CDXA 2QJ9C 1JGKA 2PJYC 1FSCA 2CCXA 3HH7A 2H7ZB 1NORA 2UWRA 1FASA 2H62D 4EY8B 3BT2U 1CREA 1KC4A 1F94A 2GOOB 3U73U 1IDGA 1QKEA 1IJCA 1UG4A 1CRFA 1FRAA 1H0JA 1IKCA 1KU6B 1CVOA 1YWHA 1KBTA 2MUOA 1G6MA 4QTIU 3PLCA 1FFJA 1REWC 1B41B 1HC9B 2MUPA 1CXOA 1IK8A 3BT1U 1W6BA 2N99A 1QM7A 1TGXA 2MJ0A 2OFSA 1CCQA 1CTXA 1NYUA 2QJAC 1FF4A
chains in the Genus database with same CATH superfamily
1S4YA 1CDQA 1LXHA 1TXAA 2H64B 5IMTD 2CRSA 2BTXA 2H8UA 3NDSA 4FAOE 4AEAA 2MHYA 1F8UB 1HAJA 1KS6A 2ABXA 1NEAA 6EBXA 1RL5A 1ES7B 1ABTA 2NBTA 1ONJA 4RUDA 2HLQA 2MJYA 4KSNA 1LX5B 4UY2C 1IDLA 1FSSB 4IYEA 2CRTA 1NYSA 5DU1A 5DO6A 4OM5A 1TFSA 2L5SA 2J8BA 1CODA 1KBAA 2GOOC 1LSIA 2UX2A 2FD6U 3KFDI 2HLRA 2K3GA 3NEQA 1VB0A 1NTNA 5DZ5A 2BHIA 1IDIA 5IMYC 1QKDA 1NXBA 1L4WA 4LFTA 3U74U 1M9ZA 2ERAA 1KTZB 1COEA 1HOYA 2MJ4A 2H7ZA 2I9BE 4P7UA 1BXPA 2LA1A 1TXBA 4XJJA 2L03A 4BDTB 3EVSC 2PJYB 2H64C 2QJBC 4FAOC 1KXIA 1CHVS 1PLOA 1KL8A 1CDTA 4HQPF 3VTSA 5EBXA 1MAHF 1RGJA 1IDHA 1I02A 3QB4B 4BIKB 3FEVA 1V6PA 2VLWA 1IQ9A 1CXNA 1KBSA 3EBXA 1CDSA 1HC9A 1LXGA 1XT3A 1JBDA 1CDRA 1CB9A 2QC1A 1KFHA 1LJZA 3LAQU 1DRSA 3NH7A 2H62C 2X8BB 2LCRA 1MR6A 3ERAA 1JE9A 1NTXA 4ZQYA 2JQPA 3KFDE 2JVEA 1ERGA 4DO8A 2H5FA 2MFAA 1ERAA 1BTEA 4OM4A 1HAAA 1ZADA 2CTXA 2CDXA 2QJ9C 1JGKA 2PJYC 1FSCA 2CCXA 3HH7A 2H7ZB 1NORA 2UWRA 1FASA 2H62D 4EY8B 3BT2U 1CREA 1KC4A 1F94A 2GOOB 3U73U 1IDGA 1QKEA 1IJCA 1UG4A 1CRFA 1FRAA 1H0JA 1IKCA 1KU6B 1CVOA 1YWHA 1KBTA 2MUOA 1G6MA 4QTIU 3PLCA 1FFJA 1REWC 1B41B 1HC9B 2MUPA 1CXOA 1IK8A 3BT1U 1W6BA 2N99A 1QM7A 1TGXA 2MJ0A 2OFSA 1CCQA 1CTXA 1NYUA 2QJAC 1FF4A
chains in the Genus database with same CATH topology
1S4YA 1CDQA 1LXHA 1TXAA 2H64B 5IMTD 2CRSA 2BTXA 2H8UA 3NDSA 4FAOE 4AEAA 2MHYA 1F8UB 1HAJA 1KS6A 2ABXA 1NEAA 6EBXA 1RL5A 1ES7B 1ABTA 2NBTA 1ONJA 4RUDA 2HLQA 2MJYA 4KSNA 1LX5B 4UY2C 1IDLA 1FSSB 4IYEA 2CRTA 1NYSA 5DU1A 5DO6A 4OM5A 1TFSA 2L5SA 2J8BA 1CODA 1KBAA 2GOOC 1LSIA 2UX2A 2FD6U 3KFDI 2HLRA 2K3GA 3NEQA 1VB0A 1NTNA 5DZ5A 2BHIA 1IDIA 5IMYC 1QKDA 1NXBA 1L4WA 4LFTA 3U74U 1M9ZA 2ERAA 1KTZB 1COEA 1HOYA 2MJ4A 2H7ZA 2I9BE 4P7UA 1BXPA 2LA1A 1TXBA 4XJJA 2L03A 4BDTB 3EVSC 2PJYB 2H64C 2QJBC 4FAOC 1KXIA 1CHVS 1PLOA 1KL8A 1CDTA 4HQPF 3VTSA 5EBXA 1MAHF 1RGJA 1IDHA 1I02A 3QB4B 4BIKB 3FEVA 1V6PA 2VLWA 1IQ9A 1CXNA 1KBSA 3EBXA 1CDSA 1HC9A 1LXGA 1XT3A 1JBDA 1CDRA 1CB9A 2QC1A 1KFHA 1LJZA 3LAQU 1DRSA 3NH7A 2H62C 2X8BB 2LCRA 1MR6A 3ERAA 1JE9A 1NTXA 4ZQYA 2JQPA 3KFDE 2JVEA 1ERGA 4DO8A 2H5FA 2MFAA 1ERAA 1BTEA 4OM4A 1HAAA 1ZADA 2CTXA 2CDXA 2QJ9C 1JGKA 2PJYC 1FSCA 2CCXA 3HH7A 2H7ZB 1NORA 2UWRA 1FASA 2H62D 4EY8B 3BT2U 1CREA 1KC4A 1F94A 2GOOB 3U73U 1IDGA 1QKEA 1IJCA 1UG4A 1CRFA 1FRAA 1H0JA 1IKCA 1KU6B 1CVOA 1YWHA 1KBTA 2MUOA 1G6MA 4QTIU 3PLCA 1FFJA 1REWC 1B41B 1HC9B 2MUPA 1CXOA 1IK8A 3BT1U 1W6BA 2N99A 1QM7A 1TGXA 2MJ0A 2OFSA 1CCQA 1CTXA 1NYUA 2QJAC 1FF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4Y A;  1CDQ A;  1LXH A;  1TXA A;  2H64 B;  5IMT D;  2CRS A;  2BTX A;  2H8U A;  3NDS A;  4FAO E;  4AEA A;  2MHY A;  1F8U B;  1HAJ A;  1KS6 A;  2ABX A;  1NEA A;  6EBX A;  1RL5 A;  1ES7 B;  1ABT A;  2NBT A;  1ONJ A;  4RUD A;  2HLQ A;  2MJY A;  4UY2 C;  1LX5 B;  1IDL A;  1FSS B;  4IYE A;  2CRT A;  1NYS A;  5DU1 A;  5DO6 A;  4OM5 A;  1TFS A;  2L5S A;  2J8B A;  1COD A;  1KBA A;  2GOO C;  1LSI A;  2UX2 A;  2FD6 U;  3KFD I;  2HLR A;  2K3G A;  3NEQ A;  1VB0 A;  1NTN A;  5DZ5 A;  2BHI A;  1IDI A;  5IMY C;  1QKD A;  1NXB A;  1L4W A;  4LFT A;  3U74 U;  1M9Z A;  2ERA A;  1KTZ B;  1COE A;  1HOY A;  2MJ4 A;  2H7Z A;  2I9B E;  4P7U A;  1BXP A;  2LA1 A;  1TXB A;  4XJJ A;  2L03 A;  4BDT B;  3EVS C;  2PJY B;  2H64 C;  2QJB C;  4FAO C;  1KXI A;  1CHV S;  1PLO A;  1KL8 A;  1CDT A;  4HQP F;  3VTS A;  5EBX A;  1MAH F;  1RGJ A;  1IDH A;  1I02 A;  3QB4 B;  4BIK B;  3FEV A;  1V6P A;  2VLW A;  1IQ9 A;  1CXN A;  1KBS A;  3EBX A;  1CDS A;  1HC9 A;  1LXG A;  1XT3 A;  1JBD A;  1CDR A;  1CB9 A;  2QC1 A;  1KFH A;  1LJZ A;  3LAQ U;  1DRS A;  3NH7 A;  2H62 C;  2X8B B;  2LCR A;  1MR6 A;  3ERA A;  1JE9 A;  1NTX A;  4ZQY A;  2JQP A;  3KFD E;  2JVE A;  1ERG A;  4DO8 A;  2H5F A;  2MFA A;  1ERA A;  1BTE A;  4OM4 A;  1HAA A;  1ZAD A;  2CTX A;  2CDX A;  2QJ9 C;  1JGK A;  2PJY C;  1FSC A;  2CCX A;  3HH7 A;  2H7Z B;  1NOR A;  2UWR A;  1FAS A;  2H62 D;  4EY8 B;  3BT2 U;  1CRE A;  1KC4 A;  1F94 A;  2GOO B;  3U73 U;  1IDG A;  1QKE A;  1IJC A;  1UG4 A;  1CRF A;  1FRA A;  1H0J A;  1IKC A;  1KU6 B;  1CVO A;  1YWH A;  1KBT A;  2MUO A;  1G6M A;  4QTI U;  3PLC A;  1FFJ A;  1REW C;  1B41 B;  1HC9 B;  2MUP A;  1CXO A;  1IK8 A;  3BT1 U;  1W6B A;  2N99 A;  1QM7 A;  1TGX A;  2MJ0 A;  2OFS A;  1CCQ A;  1CTX A;  1NYU A;  2QJA C;  1FF4 A; 
#chains in the Genus database with same CATH topology
 1S4Y A;  1CDQ A;  1LXH A;  1TXA A;  2H64 B;  5IMT D;  2CRS A;  2BTX A;  2H8U A;  3NDS A;  4FAO E;  4AEA A;  2MHY A;  1F8U B;  1HAJ A;  1KS6 A;  2ABX A;  1NEA A;  6EBX A;  1RL5 A;  1ES7 B;  1ABT A;  2NBT A;  1ONJ A;  4RUD A;  2HLQ A;  2MJY A;  4KSN A;  1LX5 B;  4UY2 C;  1IDL A;  1FSS B;  4IYE A;  2CRT A;  1NYS A;  5DU1 A;  5DO6 A;  4OM5 A;  1TFS A;  2L5S A;  2J8B A;  1COD A;  1KBA A;  2GOO C;  1LSI A;  2UX2 A;  2FD6 U;  3KFD I;  2HLR A;  2K3G A;  3NEQ A;  1VB0 A;  1NTN A;  5DZ5 A;  2BHI A;  1IDI A;  5IMY C;  1QKD A;  1NXB A;  1L4W A;  4LFT A;  3U74 U;  1M9Z A;  2ERA A;  1KTZ B;  1COE A;  1HOY A;  2MJ4 A;  2H7Z A;  2I9B E;  4P7U A;  1BXP A;  2LA1 A;  1TXB A;  4XJJ A;  2L03 A;  4BDT B;  3EVS C;  2PJY B;  2H64 C;  2QJB C;  4FAO C;  1KXI A;  1CHV S;  1PLO A;  1KL8 A;  1CDT A;  4HQP F;  3VTS A;  5EBX A;  1MAH F;  1RGJ A;  1IDH A;  1I02 A;  3QB4 B;  4BIK B;  3FEV A;  1V6P A;  2VLW A;  1IQ9 A;  1CXN A;  1KBS A;  3EBX A;  1CDS A;  1HC9 A;  1LXG A;  1XT3 A;  1JBD A;  1CDR A;  1CB9 A;  2QC1 A;  1KFH A;  1LJZ A;  3LAQ U;  1DRS A;  3NH7 A;  2H62 C;  2X8B B;  2LCR A;  1MR6 A;  3ERA A;  1JE9 A;  1NTX A;  4ZQY A;  2JQP A;  3KFD E;  2JVE A;  1ERG A;  4DO8 A;  2H5F A;  2MFA A;  1ERA A;  1BTE A;  4OM4 A;  1HAA A;  1ZAD A;  2CTX A;  2CDX A;  2QJ9 C;  1JGK A;  2PJY C;  1FSC A;  2CCX A;  3HH7 A;  2H7Z B;  1NOR A;  2UWR A;  1FAS A;  2H62 D;  4EY8 B;  3BT2 U;  1CRE A;  1KC4 A;  1F94 A;  2GOO B;  3U73 U;  1IDG A;  1QKE A;  1IJC A;  1UG4 A;  1CRF A;  1FRA A;  1H0J A;  1IKC A;  1KU6 B;  1CVO A;  1YWH A;  1KBT A;  2MUO A;  1G6M A;  4QTI U;  3PLC A;  1FFJ A;  1REW C;  1B41 B;  1HC9 B;  2MUP A;  1CXO A;  1IK8 A;  3BT1 U;  1W6B A;  2N99 A;  1QM7 A;  1TGX A;  2MJ0 A;  2OFS A;  1CCQ A;  1CTX A;  1NYU A;  2QJA C;  1FF4 A; 
#chains in the Genus database with same CATH homology
 1S4Y A;  1CDQ A;  1LXH A;  1TXA A;  2H64 B;  5IMT D;  2CRS A;  2BTX A;  2H8U A;  3NDS A;  4FAO E;  4AEA A;  2MHY A;  1F8U B;  1HAJ A;  1KS6 A;  2ABX A;  1NEA A;  6EBX A;  1RL5 A;  1ES7 B;  1ABT A;  2NBT A;  1ONJ A;  4RUD A;  2HLQ A;  2MJY A;  4KSN A;  1LX5 B;  4UY2 C;  1IDL A;  1FSS B;  4IYE A;  2CRT A;  1NYS A;  5DU1 A;  5DO6 A;  4OM5 A;  1TFS A;  2L5S A;  2J8B A;  1COD A;  1KBA A;  2GOO C;  1LSI A;  2UX2 A;  2FD6 U;  3KFD I;  2HLR A;  2K3G A;  3NEQ A;  1VB0 A;  1NTN A;  5DZ5 A;  2BHI A;  1IDI A;  5IMY C;  1QKD A;  1NXB A;  1L4W A;  4LFT A;  3U74 U;  1M9Z A;  2ERA A;  1KTZ B;  1COE A;  1HOY A;  2MJ4 A;  2H7Z A;  2I9B E;  4P7U A;  1BXP A;  2LA1 A;  1TXB A;  4XJJ A;  2L03 A;  4BDT B;  3EVS C;  2PJY B;  2H64 C;  2QJB C;  4FAO C;  1KXI A;  1CHV S;  1PLO A;  1KL8 A;  1CDT A;  4HQP F;  3VTS A;  5EBX A;  1MAH F;  1RGJ A;  1IDH A;  1I02 A;  3QB4 B;  4BIK B;  3FEV A;  1V6P A;  2VLW A;  1IQ9 A;  1CXN A;  1KBS A;  3EBX A;  1CDS A;  1HC9 A;  1LXG A;  1XT3 A;  1JBD A;  1CDR A;  1CB9 A;  2QC1 A;  1KFH A;  1LJZ A;  3LAQ U;  1DRS A;  3NH7 A;  2H62 C;  2X8B B;  2LCR A;  1MR6 A;  3ERA A;  1JE9 A;  1NTX A;  4ZQY A;  2JQP A;  3KFD E;  2JVE A;  1ERG A;  4DO8 A;  2H5F A;  2MFA A;  1ERA A;  1BTE A;  4OM4 A;  1HAA A;  1ZAD A;  2CTX A;  2CDX A;  2QJ9 C;  1JGK A;  2PJY C;  1FSC A;  2CCX A;  3HH7 A;  2H7Z B;  1NOR A;  2UWR A;  1FAS A;  2H62 D;  4EY8 B;  3BT2 U;  1CRE A;  1KC4 A;  1F94 A;  2GOO B;  3U73 U;  1IDG A;  1QKE A;  1IJC A;  1UG4 A;  1CRF A;  1FRA A;  1H0J A;  1IKC A;  1KU6 B;  1CVO A;  1YWH A;  1KBT A;  2MUO A;  1G6M A;  4QTI U;  3PLC A;  1FFJ A;  1REW C;  1B41 B;  1HC9 B;  2MUP A;  1CXO A;  1IK8 A;  3BT1 U;  1W6B A;  2N99 A;  1QM7 A;  1TGX A;  2MJ0 A;  2OFS A;  1CCQ A;  1CTX A;  1NYU A;  2QJA C;  1FF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...