4LFTA

Structure of alpha-elapitoxin-dpp2d isolated from black mamba (dendroaspis polylepis) venom
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
RTCNKTFSDQSKICPPGENICYTKTWCDAFCSQRGKRVELGCAATCPKVKAGVEIKCCSTDNCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Isolation and Structural and Pharmacological Characterization of alpha-Elapitoxin-Dpp2d, an Amidated Three Finger Toxin from Black Mamba Venom.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Alpha-elapitoxin-Dpp2a
total genus 11
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4lftA00
3EBXA 3PLCA 1BXPA 1IDHA 2N99A 1PLOA 1CXOA 1VB0A 1CODA 3NEQA 1KC4A 1JGKA 1ONJA 1IJCA 4OM4A 2L5SA 2X8BB 2HLRA 1KBTA 2PJYC 5EBXA 1HC9B 1W6BA 4IYEA 2FD6U 2H5FA 4ZQYA 4HQPF 1TXAA 3ERAA 1COEA 1LSIA 4BIKB 2ERAA 1KBAA 2BHIA 1G6MA 1CXNA 2MUPA 4OM5A 5IMYC 5IMTD 3KFDE 4DO8A 3NH7A 4BDTB 1IDLA 4RUDA 2K3GA 1NYSA 2QJAC 1TFSA 2MHYA 1TGXA 1ERGA 5DU1A 1IDGA 3EVSC 4P7UA 3VTSA 1MAHF 2MFAA 4XJJA 1IKCA 4QTIU 2CRSA 1NEAA 1YWHA 1CDQA 1NTNA 2H8UA 2ABXA 2LCRA 4LFTA 1LX5B 2QJBC 1FSCA 1KBSA 1HAJA 1BTEA 3NDSA 1HOYA 1H0JA 1LXGA 1HC9A 1IDIA 1FASA 2QC1A 1S4YA 2HLQA 2MJYA 3QB4B 5DZ5A 2I9BE 1ZADA 1RL5A 2QJ9C 4EY8B 1KXIA 1MR6A 1JE9A 1CDTA 1ABTA 1LJZA 2NBTA 1KS6A 1KFHA 1CHVS 1QM7A 2VLWA 1RGJA 2MJ4A 3BT2U 1IQ9A 1NYUA 1V6PA 2JQPA 2OFSA 3U74U 1FFJA 1I02A 6EBXA 2JVEA 2UX2A 2GOOB 4UY2C 1FF4A 2H62D 1TXBA 1F8UB 1IK8A 2J8BA 1JBDA 1ES7B 3HH7A 1CVOA 2H62C 2CRTA 1CREA 4FAOC 1CCQA 1FRAA 1UG4A 1CDSA 4AEAA 2MJ0A 1REWC 1F94A 2H64B 5DO6A 2CTXA 1CB9A 2CCXA 2CDXA 1FSSB 1CRFA 1NORA 1XT3A 2H7ZA 2UWRA 1M9ZA 2BTXA 2H64C 1CTXA 1NXBA 1KTZB 3KFDI 1KU6B 3LAQU 2LA1A 1L4WA 2L03A 3BT1U 1B41B 3FEVA 2GOOC 1KL8A 1QKEA 1NTXA 1LXHA 1ERAA 2MUOA 3U73U 2PJYB 1DRSA 1CDRA 1HAAA 2H7ZB 4FAOE 1QKDA
chains in the Genus database with same CATH superfamily
3EBXA 3PLCA 1BXPA 1IDHA 2N99A 1PLOA 1CXOA 1VB0A 1CODA 3NEQA 1KC4A 1JGKA 1ONJA 1IJCA 4OM4A 2L5SA 2X8BB 2HLRA 1KBTA 2PJYC 5EBXA 1HC9B 1W6BA 4IYEA 2FD6U 2H5FA 4ZQYA 4HQPF 4KSNA 1TXAA 3ERAA 1COEA 1LSIA 4BIKB 2ERAA 1KBAA 2BHIA 1G6MA 1CXNA 2MUPA 4OM5A 5IMYC 5IMTD 3KFDE 4DO8A 3NH7A 4BDTB 1IDLA 4RUDA 2K3GA 1NYSA 2QJAC 1TFSA 2MHYA 1TGXA 1ERGA 5DU1A 1IDGA 3EVSC 4P7UA 3VTSA 1MAHF 2MFAA 4XJJA 1IKCA 4QTIU 2CRSA 1NEAA 1YWHA 1CDQA 1NTNA 2H8UA 2ABXA 2LCRA 4LFTA 1LX5B 2QJBC 1FSCA 1KBSA 1HAJA 1BTEA 3NDSA 1HOYA 1H0JA 1LXGA 1HC9A 1IDIA 1FASA 2QC1A 1S4YA 2HLQA 2MJYA 3QB4B 5DZ5A 2I9BE 1ZADA 1RL5A 2QJ9C 4EY8B 1KXIA 1MR6A 1JE9A 1CDTA 1ABTA 1LJZA 2NBTA 1KS6A 1KFHA 1CHVS 1QM7A 2VLWA 1RGJA 2MJ4A 3BT2U 1IQ9A 1NYUA 1V6PA 2JQPA 2OFSA 3U74U 1FFJA 1I02A 6EBXA 2JVEA 2UX2A 2GOOB 4UY2C 1FF4A 2H62D 1TXBA 1F8UB 1IK8A 2J8BA 1JBDA 1ES7B 3HH7A 1CVOA 2H62C 2CRTA 1CREA 4FAOC 1CCQA 1FRAA 1UG4A 1CDSA 4AEAA 2MJ0A 1REWC 1F94A 2H64B 5DO6A 2CTXA 1CB9A 2CCXA 2CDXA 1FSSB 1CRFA 1NORA 1XT3A 2H7ZA 2UWRA 1M9ZA 2BTXA 2H64C 1CTXA 1NXBA 1KTZB 3KFDI 1KU6B 3LAQU 2LA1A 1L4WA 2L03A 3BT1U 1B41B 3FEVA 2GOOC 1KL8A 1QKEA 1NTXA 1LXHA 1ERAA 2MUOA 3U73U 2PJYB 1DRSA 1CDRA 1HAAA 2H7ZB 4FAOE 1QKDA
chains in the Genus database with same CATH topology
3EBXA 3PLCA 1BXPA 1IDHA 2N99A 1PLOA 1CXOA 1VB0A 1CODA 3NEQA 1KC4A 1JGKA 1ONJA 1IJCA 4OM4A 2L5SA 2X8BB 2HLRA 1KBTA 2PJYC 5EBXA 1HC9B 1W6BA 4IYEA 2FD6U 2H5FA 4ZQYA 4HQPF 4KSNA 1TXAA 3ERAA 1COEA 1LSIA 4BIKB 2ERAA 1KBAA 2BHIA 1G6MA 1CXNA 2MUPA 4OM5A 5IMYC 5IMTD 3KFDE 4DO8A 3NH7A 4BDTB 1IDLA 4RUDA 2K3GA 1NYSA 2QJAC 1TFSA 2MHYA 1TGXA 1ERGA 5DU1A 1IDGA 3EVSC 4P7UA 3VTSA 1MAHF 2MFAA 4XJJA 1IKCA 4QTIU 2CRSA 1NEAA 1YWHA 1CDQA 1NTNA 2H8UA 2ABXA 2LCRA 4LFTA 1LX5B 2QJBC 1FSCA 1KBSA 1HAJA 1BTEA 3NDSA 1HOYA 1H0JA 1LXGA 1HC9A 1IDIA 1FASA 2QC1A 1S4YA 2HLQA 2MJYA 3QB4B 5DZ5A 2I9BE 1ZADA 1RL5A 2QJ9C 4EY8B 1KXIA 1MR6A 1JE9A 1CDTA 1ABTA 1LJZA 2NBTA 1KS6A 1KFHA 1CHVS 1QM7A 2VLWA 1RGJA 2MJ4A 3BT2U 1IQ9A 1NYUA 1V6PA 2JQPA 2OFSA 3U74U 1FFJA 1I02A 6EBXA 2JVEA 2UX2A 2GOOB 4UY2C 1FF4A 2H62D 1TXBA 1F8UB 1IK8A 2J8BA 1JBDA 1ES7B 3HH7A 1CVOA 2H62C 2CRTA 1CREA 4FAOC 1CCQA 1FRAA 1UG4A 1CDSA 4AEAA 2MJ0A 1REWC 1F94A 2H64B 5DO6A 2CTXA 1CB9A 2CCXA 2CDXA 1FSSB 1CRFA 1NORA 1XT3A 2H7ZA 2UWRA 1M9ZA 2BTXA 2H64C 1CTXA 1NXBA 1KTZB 3KFDI 1KU6B 3LAQU 2LA1A 1L4WA 2L03A 3BT1U 1B41B 3FEVA 2GOOC 1KL8A 1QKEA 1NTXA 1LXHA 1ERAA 2MUOA 3U73U 2PJYB 1DRSA 1CDRA 1HAAA 2H7ZB 4FAOE 1QKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBX A;  3PLC A;  1BXP A;  1IDH A;  2N99 A;  1PLO A;  1CXO A;  1VB0 A;  1COD A;  3NEQ A;  1KC4 A;  1JGK A;  1ONJ A;  1IJC A;  4OM4 A;  2L5S A;  2X8B B;  2HLR A;  1KBT A;  2PJY C;  5EBX A;  1HC9 B;  1W6B A;  4IYE A;  2FD6 U;  2H5F A;  4ZQY A;  4HQP F;  1TXA A;  3ERA A;  1COE A;  1LSI A;  4BIK B;  2ERA A;  1KBA A;  2BHI A;  1G6M A;  1CXN A;  2MUP A;  4OM5 A;  5IMY C;  5IMT D;  3KFD E;  4DO8 A;  3NH7 A;  4BDT B;  1IDL A;  4RUD A;  2K3G A;  1NYS A;  2QJA C;  1TFS A;  2MHY A;  1TGX A;  1ERG A;  5DU1 A;  1IDG A;  3EVS C;  4P7U A;  3VTS A;  1MAH F;  2MFA A;  4XJJ A;  1IKC A;  4QTI U;  2CRS A;  1NEA A;  1YWH A;  1CDQ A;  1NTN A;  2H8U A;  2ABX A;  2LCR A;  4LFT A;  1LX5 B;  2QJB C;  1FSC A;  1KBS A;  1HAJ A;  1BTE A;  3NDS A;  1HOY A;  1H0J A;  1LXG A;  1HC9 A;  1IDI A;  1FAS A;  2QC1 A;  1S4Y A;  2HLQ A;  2MJY A;  3QB4 B;  5DZ5 A;  2I9B E;  1ZAD A;  1RL5 A;  2QJ9 C;  4EY8 B;  1KXI A;  1MR6 A;  1JE9 A;  1CDT A;  1ABT A;  1LJZ A;  2NBT A;  1KS6 A;  1KFH A;  1CHV S;  1QM7 A;  2VLW A;  1RGJ A;  2MJ4 A;  3BT2 U;  1IQ9 A;  1NYU A;  1V6P A;  2JQP A;  2OFS A;  3U74 U;  1FFJ A;  1I02 A;  6EBX A;  2JVE A;  2UX2 A;  2GOO B;  4UY2 C;  1FF4 A;  2H62 D;  1TXB A;  1F8U B;  1IK8 A;  2J8B A;  1JBD A;  1ES7 B;  3HH7 A;  1CVO A;  2H62 C;  2CRT A;  1CRE A;  4FAO C;  1CCQ A;  1FRA A;  1UG4 A;  1CDS A;  4AEA A;  2MJ0 A;  1REW C;  1F94 A;  2H64 B;  5DO6 A;  2CTX A;  1CB9 A;  2CCX A;  2CDX A;  1FSS B;  1CRF A;  1NOR A;  1XT3 A;  2H7Z A;  2UWR A;  1M9Z A;  2BTX A;  2H64 C;  1CTX A;  1NXB A;  1KTZ B;  3KFD I;  1KU6 B;  3LAQ U;  2LA1 A;  1L4W A;  2L03 A;  3BT1 U;  1B41 B;  3FEV A;  2GOO C;  1KL8 A;  1QKE A;  1NTX A;  1LXH A;  1ERA A;  2MUO A;  3U73 U;  2PJY B;  1DRS A;  1CDR A;  1HAA A;  2H7Z B;  4FAO E;  1QKD A; 
#chains in the Genus database with same CATH topology
 3EBX A;  3PLC A;  1BXP A;  1IDH A;  2N99 A;  1PLO A;  1CXO A;  1VB0 A;  1COD A;  3NEQ A;  1KC4 A;  1JGK A;  1ONJ A;  1IJC A;  4OM4 A;  2L5S A;  2X8B B;  2HLR A;  1KBT A;  2PJY C;  5EBX A;  1HC9 B;  1W6B A;  4IYE A;  2FD6 U;  2H5F A;  4ZQY A;  4HQP F;  4KSN A;  1TXA A;  3ERA A;  1COE A;  1LSI A;  4BIK B;  2ERA A;  1KBA A;  2BHI A;  1G6M A;  1CXN A;  2MUP A;  4OM5 A;  5IMY C;  5IMT D;  3KFD E;  4DO8 A;  3NH7 A;  4BDT B;  1IDL A;  4RUD A;  2K3G A;  1NYS A;  2QJA C;  1TFS A;  2MHY A;  1TGX A;  1ERG A;  5DU1 A;  1IDG A;  3EVS C;  4P7U A;  3VTS A;  1MAH F;  2MFA A;  4XJJ A;  1IKC A;  4QTI U;  2CRS A;  1NEA A;  1YWH A;  1CDQ A;  1NTN A;  2H8U A;  2ABX A;  2LCR A;  4LFT A;  1LX5 B;  2QJB C;  1FSC A;  1KBS A;  1HAJ A;  1BTE A;  3NDS A;  1HOY A;  1H0J A;  1LXG A;  1HC9 A;  1IDI A;  1FAS A;  2QC1 A;  1S4Y A;  2HLQ A;  2MJY A;  3QB4 B;  5DZ5 A;  2I9B E;  1ZAD A;  1RL5 A;  2QJ9 C;  4EY8 B;  1KXI A;  1MR6 A;  1JE9 A;  1CDT A;  1ABT A;  1LJZ A;  2NBT A;  1KS6 A;  1KFH A;  1CHV S;  1QM7 A;  2VLW A;  1RGJ A;  2MJ4 A;  3BT2 U;  1IQ9 A;  1NYU A;  1V6P A;  2JQP A;  2OFS A;  3U74 U;  1FFJ A;  1I02 A;  6EBX A;  2JVE A;  2UX2 A;  2GOO B;  4UY2 C;  1FF4 A;  2H62 D;  1TXB A;  1F8U B;  1IK8 A;  2J8B A;  1JBD A;  1ES7 B;  3HH7 A;  1CVO A;  2H62 C;  2CRT A;  1CRE A;  4FAO C;  1CCQ A;  1FRA A;  1UG4 A;  1CDS A;  4AEA A;  2MJ0 A;  1REW C;  1F94 A;  2H64 B;  5DO6 A;  2CTX A;  1CB9 A;  2CCX A;  2CDX A;  1FSS B;  1CRF A;  1NOR A;  1XT3 A;  2H7Z A;  2UWR A;  1M9Z A;  2BTX A;  2H64 C;  1CTX A;  1NXB A;  1KTZ B;  3KFD I;  1KU6 B;  3LAQ U;  2LA1 A;  1L4W A;  2L03 A;  3BT1 U;  1B41 B;  3FEV A;  2GOO C;  1KL8 A;  1QKE A;  1NTX A;  1LXH A;  1ERA A;  2MUO A;  3U73 U;  2PJY B;  1DRS A;  1CDR A;  1HAA A;  2H7Z B;  4FAO E;  1QKD A; 
#chains in the Genus database with same CATH homology
 3EBX A;  3PLC A;  1BXP A;  1IDH A;  2N99 A;  1PLO A;  1CXO A;  1VB0 A;  1COD A;  3NEQ A;  1KC4 A;  1JGK A;  1ONJ A;  1IJC A;  4OM4 A;  2L5S A;  2X8B B;  2HLR A;  1KBT A;  2PJY C;  5EBX A;  1HC9 B;  1W6B A;  4IYE A;  2FD6 U;  2H5F A;  4ZQY A;  4HQP F;  4KSN A;  1TXA A;  3ERA A;  1COE A;  1LSI A;  4BIK B;  2ERA A;  1KBA A;  2BHI A;  1G6M A;  1CXN A;  2MUP A;  4OM5 A;  5IMY C;  5IMT D;  3KFD E;  4DO8 A;  3NH7 A;  4BDT B;  1IDL A;  4RUD A;  2K3G A;  1NYS A;  2QJA C;  1TFS A;  2MHY A;  1TGX A;  1ERG A;  5DU1 A;  1IDG A;  3EVS C;  4P7U A;  3VTS A;  1MAH F;  2MFA A;  4XJJ A;  1IKC A;  4QTI U;  2CRS A;  1NEA A;  1YWH A;  1CDQ A;  1NTN A;  2H8U A;  2ABX A;  2LCR A;  4LFT A;  1LX5 B;  2QJB C;  1FSC A;  1KBS A;  1HAJ A;  1BTE A;  3NDS A;  1HOY A;  1H0J A;  1LXG A;  1HC9 A;  1IDI A;  1FAS A;  2QC1 A;  1S4Y A;  2HLQ A;  2MJY A;  3QB4 B;  5DZ5 A;  2I9B E;  1ZAD A;  1RL5 A;  2QJ9 C;  4EY8 B;  1KXI A;  1MR6 A;  1JE9 A;  1CDT A;  1ABT A;  1LJZ A;  2NBT A;  1KS6 A;  1KFH A;  1CHV S;  1QM7 A;  2VLW A;  1RGJ A;  2MJ4 A;  3BT2 U;  1IQ9 A;  1NYU A;  1V6P A;  2JQP A;  2OFS A;  3U74 U;  1FFJ A;  1I02 A;  6EBX A;  2JVE A;  2UX2 A;  2GOO B;  4UY2 C;  1FF4 A;  2H62 D;  1TXB A;  1F8U B;  1IK8 A;  2J8B A;  1JBD A;  1ES7 B;  3HH7 A;  1CVO A;  2H62 C;  2CRT A;  1CRE A;  4FAO C;  1CCQ A;  1FRA A;  1UG4 A;  1CDS A;  4AEA A;  2MJ0 A;  1REW C;  1F94 A;  2H64 B;  5DO6 A;  2CTX A;  1CB9 A;  2CCX A;  2CDX A;  1FSS B;  1CRF A;  1NOR A;  1XT3 A;  2H7Z A;  2UWR A;  1M9Z A;  2BTX A;  2H64 C;  1CTX A;  1NXB A;  1KTZ B;  3KFD I;  1KU6 B;  3LAQ U;  2LA1 A;  1L4W A;  2L03 A;  3BT1 U;  1B41 B;  3FEV A;  2GOO C;  1KL8 A;  1QKE A;  1NTX A;  1LXH A;  1ERA A;  2MUO A;  3U73 U;  2PJY B;  1DRS A;  1CDR A;  1HAA A;  2H7Z B;  4FAO E;  1QKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...