4LFTA

Structure of alpha-elapitoxin-dpp2d isolated from black mamba (dendroaspis polylepis) venom
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
RTCNKTFSDQSKICPPGENICYTKTWCDAFCSQRGKRVELGCAATCPKVKAGVEIKCCSTDNCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Alpha-elapitoxin-Dpp2a
publication title Isolation and Structural and Pharmacological Characterization of alpha-Elapitoxin-Dpp2d, an Amidated Three Finger Toxin from Black Mamba Venom.
pubmed doi rcsb
total genus 11
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4lftA00
2CRTA 2H62D 3HH7A 1V6PA 5EBXA 1W6BA 2MJ4A 1JE9A 4AEAA 1ES7B 1CDTA 2H8UA 2OFSA 2H64B 4DO8A 1F8UB 1BXPA 1HC9B 1NXBA 1KXIA 2H64C 2UWRA 3VTSA 1KBAA 2CDXA 2QJAC 2LA1A 2BTXA 1ERAA 1CDQA 2ERAA 1CTXA 2JQPA 4FAOE 2HLRA 1HAAA 2MUPA 1IDHA 3KFDE 1CDRA 1CCQA 4BDTB 2BHIA 1CXOA 1NTXA 1IDIA 1FASA 2QC1A 2CTXA 1ABTA 1KC4A 2HLQA 1LXGA 1CXNA 2FD6U 2LCRA 3NEQA 1NYUA 1XT3A 2UX2A 6EBXA 1LSIA 4RUDA 1PLOA 2GOOB 2ABXA 1B41B 1RGJA 3FEVA 1RL5A 1MAHF 2GOOC 1QM7A 1IK8A 1FSSB 3NDSA 1NYSA 1F94A 5DU1A 2X8BB 1ZADA 1JGKA 1NTNA 3KFDI 4HQPF 1LX5B 2MJYA 1H0JA 2JVEA 4FAOC 2CCXA 3LAQU 3BT1U 3U74U 1KBTA 3U73U 1L4WA 2MFAA 3EVSC 1UG4A 1ONJA 3PLCA 2QJ9C 2MJ0A 1S4YA 2L03A 2MUOA 1G6MA 1IJCA 1HAJA 3QB4B 3EBXA 1NEAA 1COEA 1LXHA 1TGXA 2PJYB 3BT2U 4XJJA 1KU6B 4EY8B 1JBDA 4ZQYA 1HOYA 1MR6A 2PJYC 1IKCA 1IDGA 3ERAA 1IQ9A 5DZ5A 5IMYC 1KL8A 1M9ZA 1CHVS 2H7ZA 1HC9A 4P7UA 5IMTD 4LFTA 1KBSA 1VB0A 2K3GA 2J8BA 1TXAA 1REWC 5DO6A 1FF4A 1ERGA 1TFSA 1KFHA 2MHYA 4UY2C 1NORA 1KTZB 1CDSA 1FRAA 1BTEA 1QKDA 2I9BE 1I02A 1FFJA 1CODA 1CVOA 4BIKB 1DRSA 4OM4A 2VLWA 2H7ZB 4OM5A 1CB9A 1CRFA 1LJZA 2NBTA 1FSCA 3NH7A 1CREA 1YWHA 2QJBC 2CRSA 1QKEA 1TXBA 1KS6A 4QTIU 1IDLA 2L5SA 4IYEA 2H5FA 2H62C 2N99A
chains in the Genus database with same CATH superfamily
2CRTA 2H62D 3HH7A 1V6PA 5EBXA 1W6BA 2MJ4A 1JE9A 4AEAA 1ES7B 1CDTA 2H8UA 2OFSA 2H64B 4DO8A 1F8UB 1BXPA 1HC9B 1NXBA 1KXIA 2H64C 2UWRA 3VTSA 1KBAA 2CDXA 2QJAC 2LA1A 2BTXA 1ERAA 1CDQA 2ERAA 1CTXA 2JQPA 4FAOE 2HLRA 1HAAA 2MUPA 1IDHA 3KFDE 1CDRA 1CCQA 4BDTB 2BHIA 1CXOA 1NTXA 1IDIA 1FASA 2QC1A 2CTXA 1ABTA 1KC4A 2HLQA 1LXGA 1CXNA 2FD6U 2LCRA 3NEQA 1NYUA 1XT3A 4KSNA 2UX2A 6EBXA 1LSIA 4RUDA 1PLOA 2GOOB 2ABXA 1B41B 1RGJA 3FEVA 1RL5A 1MAHF 2GOOC 1QM7A 1IK8A 1FSSB 3NDSA 1NYSA 1F94A 5DU1A 2X8BB 1ZADA 1JGKA 1NTNA 3KFDI 4HQPF 1LX5B 2MJYA 1H0JA 2JVEA 4FAOC 2CCXA 3LAQU 3BT1U 3U74U 1KBTA 3U73U 1L4WA 2MFAA 3EVSC 1UG4A 1ONJA 3PLCA 2QJ9C 2MJ0A 1S4YA 2L03A 2MUOA 1G6MA 1IJCA 1HAJA 3QB4B 3EBXA 1NEAA 1COEA 1LXHA 1TGXA 2PJYB 3BT2U 4XJJA 1KU6B 4EY8B 1JBDA 4ZQYA 1HOYA 1MR6A 2PJYC 1IKCA 1IDGA 3ERAA 1IQ9A 5DZ5A 5IMYC 1KL8A 1M9ZA 1CHVS 2H7ZA 1HC9A 4P7UA 5IMTD 4LFTA 1KBSA 1VB0A 2K3GA 2J8BA 1TXAA 1REWC 5DO6A 1FF4A 1ERGA 1TFSA 1KFHA 2MHYA 4UY2C 1NORA 1KTZB 1CDSA 1FRAA 1BTEA 1QKDA 2I9BE 1I02A 1FFJA 1CODA 1CVOA 4BIKB 1DRSA 4OM4A 2VLWA 2H7ZB 4OM5A 1CB9A 1CRFA 1LJZA 2NBTA 1FSCA 3NH7A 1CREA 1YWHA 2QJBC 2CRSA 1QKEA 1TXBA 1KS6A 4QTIU 1IDLA 2L5SA 4IYEA 2H5FA 2H62C 2N99A
chains in the Genus database with same CATH topology
2CRTA 2H62D 3HH7A 1V6PA 5EBXA 1W6BA 2MJ4A 1JE9A 4AEAA 1ES7B 1CDTA 2H8UA 2OFSA 2H64B 4DO8A 1F8UB 1BXPA 1HC9B 1NXBA 1KXIA 2H64C 2UWRA 3VTSA 1KBAA 2CDXA 2QJAC 2LA1A 2BTXA 1ERAA 1CDQA 2ERAA 1CTXA 2JQPA 4FAOE 2HLRA 1HAAA 2MUPA 1IDHA 3KFDE 1CDRA 1CCQA 4BDTB 2BHIA 1CXOA 1NTXA 1IDIA 1FASA 2QC1A 2CTXA 1ABTA 1KC4A 2HLQA 1LXGA 1CXNA 2FD6U 2LCRA 3NEQA 1NYUA 1XT3A 4KSNA 2UX2A 6EBXA 1LSIA 4RUDA 1PLOA 2GOOB 2ABXA 1B41B 1RGJA 3FEVA 1RL5A 1MAHF 2GOOC 1QM7A 1IK8A 1FSSB 3NDSA 1NYSA 1F94A 5DU1A 2X8BB 1ZADA 1JGKA 1NTNA 3KFDI 4HQPF 1LX5B 2MJYA 1H0JA 2JVEA 4FAOC 2CCXA 3LAQU 3BT1U 3U74U 1KBTA 3U73U 1L4WA 2MFAA 3EVSC 1UG4A 1ONJA 3PLCA 2QJ9C 2MJ0A 1S4YA 2L03A 2MUOA 1G6MA 1IJCA 1HAJA 3QB4B 3EBXA 1NEAA 1COEA 1LXHA 1TGXA 2PJYB 3BT2U 4XJJA 1KU6B 4EY8B 1JBDA 4ZQYA 1HOYA 1MR6A 2PJYC 1IKCA 1IDGA 3ERAA 1IQ9A 5DZ5A 5IMYC 1KL8A 1M9ZA 1CHVS 2H7ZA 1HC9A 4P7UA 5IMTD 4LFTA 1KBSA 1VB0A 2K3GA 2J8BA 1TXAA 1REWC 5DO6A 1FF4A 1ERGA 1TFSA 1KFHA 2MHYA 4UY2C 1NORA 1KTZB 1CDSA 1FRAA 1BTEA 1QKDA 2I9BE 1I02A 1FFJA 1CODA 1CVOA 4BIKB 1DRSA 4OM4A 2VLWA 2H7ZB 4OM5A 1CB9A 1CRFA 1LJZA 2NBTA 1FSCA 3NH7A 1CREA 1YWHA 2QJBC 2CRSA 1QKEA 1TXBA 1KS6A 4QTIU 1IDLA 2L5SA 4IYEA 2H5FA 2H62C 2N99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRT A;  2H62 D;  3HH7 A;  1V6P A;  5EBX A;  1W6B A;  2MJ4 A;  1JE9 A;  4AEA A;  1ES7 B;  1CDT A;  2H8U A;  2OFS A;  2H64 B;  4DO8 A;  1F8U B;  1BXP A;  1HC9 B;  1NXB A;  1KXI A;  2H64 C;  2UWR A;  3VTS A;  1KBA A;  2CDX A;  2QJA C;  2LA1 A;  2BTX A;  1ERA A;  1CDQ A;  2ERA A;  1CTX A;  2JQP A;  4FAO E;  2HLR A;  1HAA A;  2MUP A;  1IDH A;  3KFD E;  1CDR A;  1CCQ A;  4BDT B;  2BHI A;  1CXO A;  1NTX A;  1IDI A;  1FAS A;  2QC1 A;  2CTX A;  1ABT A;  1KC4 A;  2HLQ A;  1LXG A;  1CXN A;  2FD6 U;  2LCR A;  3NEQ A;  1NYU A;  1XT3 A;  2UX2 A;  6EBX A;  1LSI A;  4RUD A;  1PLO A;  2GOO B;  2ABX A;  1B41 B;  1RGJ A;  3FEV A;  1RL5 A;  1MAH F;  2GOO C;  1QM7 A;  1IK8 A;  1FSS B;  3NDS A;  1NYS A;  1F94 A;  5DU1 A;  2X8B B;  1ZAD A;  1JGK A;  1NTN A;  3KFD I;  4HQP F;  1LX5 B;  2MJY A;  1H0J A;  2JVE A;  4FAO C;  2CCX A;  3LAQ U;  3BT1 U;  3U74 U;  1KBT A;  3U73 U;  1L4W A;  2MFA A;  3EVS C;  1UG4 A;  1ONJ A;  3PLC A;  2QJ9 C;  2MJ0 A;  1S4Y A;  2L03 A;  2MUO A;  1G6M A;  1IJC A;  1HAJ A;  3QB4 B;  3EBX A;  1NEA A;  1COE A;  1LXH A;  1TGX A;  2PJY B;  3BT2 U;  4XJJ A;  1KU6 B;  4EY8 B;  1JBD A;  4ZQY A;  1HOY A;  1MR6 A;  2PJY C;  1IKC A;  1IDG A;  3ERA A;  1IQ9 A;  5DZ5 A;  5IMY C;  1KL8 A;  1M9Z A;  1CHV S;  2H7Z A;  1HC9 A;  4P7U A;  5IMT D;  4LFT A;  1KBS A;  1VB0 A;  2K3G A;  2J8B A;  1TXA A;  1REW C;  5DO6 A;  1FF4 A;  1ERG A;  1TFS A;  1KFH A;  2MHY A;  4UY2 C;  1NOR A;  1KTZ B;  1CDS A;  1FRA A;  1BTE A;  1QKD A;  2I9B E;  1I02 A;  1FFJ A;  1COD A;  1CVO A;  4BIK B;  1DRS A;  4OM4 A;  2VLW A;  2H7Z B;  4OM5 A;  1CB9 A;  1CRF A;  1LJZ A;  2NBT A;  1FSC A;  3NH7 A;  1CRE A;  1YWH A;  2QJB C;  2CRS A;  1QKE A;  1TXB A;  1KS6 A;  4QTI U;  1IDL A;  2L5S A;  4IYE A;  2H5F A;  2H62 C;  2N99 A; 
#chains in the Genus database with same CATH topology
 2CRT A;  2H62 D;  3HH7 A;  1V6P A;  5EBX A;  1W6B A;  2MJ4 A;  1JE9 A;  4AEA A;  1ES7 B;  1CDT A;  2H8U A;  2OFS A;  2H64 B;  4DO8 A;  1F8U B;  1BXP A;  1HC9 B;  1NXB A;  1KXI A;  2H64 C;  2UWR A;  3VTS A;  1KBA A;  2CDX A;  2QJA C;  2LA1 A;  2BTX A;  1ERA A;  1CDQ A;  2ERA A;  1CTX A;  2JQP A;  4FAO E;  2HLR A;  1HAA A;  2MUP A;  1IDH A;  3KFD E;  1CDR A;  1CCQ A;  4BDT B;  2BHI A;  1CXO A;  1NTX A;  1IDI A;  1FAS A;  2QC1 A;  2CTX A;  1ABT A;  1KC4 A;  2HLQ A;  1LXG A;  1CXN A;  2FD6 U;  2LCR A;  3NEQ A;  1NYU A;  1XT3 A;  4KSN A;  2UX2 A;  6EBX A;  1LSI A;  4RUD A;  1PLO A;  2GOO B;  2ABX A;  1B41 B;  1RGJ A;  3FEV A;  1RL5 A;  1MAH F;  2GOO C;  1QM7 A;  1IK8 A;  1FSS B;  3NDS A;  1NYS A;  1F94 A;  5DU1 A;  2X8B B;  1ZAD A;  1JGK A;  1NTN A;  3KFD I;  4HQP F;  1LX5 B;  2MJY A;  1H0J A;  2JVE A;  4FAO C;  2CCX A;  3LAQ U;  3BT1 U;  3U74 U;  1KBT A;  3U73 U;  1L4W A;  2MFA A;  3EVS C;  1UG4 A;  1ONJ A;  3PLC A;  2QJ9 C;  2MJ0 A;  1S4Y A;  2L03 A;  2MUO A;  1G6M A;  1IJC A;  1HAJ A;  3QB4 B;  3EBX A;  1NEA A;  1COE A;  1LXH A;  1TGX A;  2PJY B;  3BT2 U;  4XJJ A;  1KU6 B;  4EY8 B;  1JBD A;  4ZQY A;  1HOY A;  1MR6 A;  2PJY C;  1IKC A;  1IDG A;  3ERA A;  1IQ9 A;  5DZ5 A;  5IMY C;  1KL8 A;  1M9Z A;  1CHV S;  2H7Z A;  1HC9 A;  4P7U A;  5IMT D;  4LFT A;  1KBS A;  1VB0 A;  2K3G A;  2J8B A;  1TXA A;  1REW C;  5DO6 A;  1FF4 A;  1ERG A;  1TFS A;  1KFH A;  2MHY A;  4UY2 C;  1NOR A;  1KTZ B;  1CDS A;  1FRA A;  1BTE A;  1QKD A;  2I9B E;  1I02 A;  1FFJ A;  1COD A;  1CVO A;  4BIK B;  1DRS A;  4OM4 A;  2VLW A;  2H7Z B;  4OM5 A;  1CB9 A;  1CRF A;  1LJZ A;  2NBT A;  1FSC A;  3NH7 A;  1CRE A;  1YWH A;  2QJB C;  2CRS A;  1QKE A;  1TXB A;  1KS6 A;  4QTI U;  1IDL A;  2L5S A;  4IYE A;  2H5F A;  2H62 C;  2N99 A; 
#chains in the Genus database with same CATH homology
 2CRT A;  2H62 D;  3HH7 A;  1V6P A;  5EBX A;  1W6B A;  2MJ4 A;  1JE9 A;  4AEA A;  1ES7 B;  1CDT A;  2H8U A;  2OFS A;  2H64 B;  4DO8 A;  1F8U B;  1BXP A;  1HC9 B;  1NXB A;  1KXI A;  2H64 C;  2UWR A;  3VTS A;  1KBA A;  2CDX A;  2QJA C;  2LA1 A;  2BTX A;  1ERA A;  1CDQ A;  2ERA A;  1CTX A;  2JQP A;  4FAO E;  2HLR A;  1HAA A;  2MUP A;  1IDH A;  3KFD E;  1CDR A;  1CCQ A;  4BDT B;  2BHI A;  1CXO A;  1NTX A;  1IDI A;  1FAS A;  2QC1 A;  2CTX A;  1ABT A;  1KC4 A;  2HLQ A;  1LXG A;  1CXN A;  2FD6 U;  2LCR A;  3NEQ A;  1NYU A;  1XT3 A;  4KSN A;  2UX2 A;  6EBX A;  1LSI A;  4RUD A;  1PLO A;  2GOO B;  2ABX A;  1B41 B;  1RGJ A;  3FEV A;  1RL5 A;  1MAH F;  2GOO C;  1QM7 A;  1IK8 A;  1FSS B;  3NDS A;  1NYS A;  1F94 A;  5DU1 A;  2X8B B;  1ZAD A;  1JGK A;  1NTN A;  3KFD I;  4HQP F;  1LX5 B;  2MJY A;  1H0J A;  2JVE A;  4FAO C;  2CCX A;  3LAQ U;  3BT1 U;  3U74 U;  1KBT A;  3U73 U;  1L4W A;  2MFA A;  3EVS C;  1UG4 A;  1ONJ A;  3PLC A;  2QJ9 C;  2MJ0 A;  1S4Y A;  2L03 A;  2MUO A;  1G6M A;  1IJC A;  1HAJ A;  3QB4 B;  3EBX A;  1NEA A;  1COE A;  1LXH A;  1TGX A;  2PJY B;  3BT2 U;  4XJJ A;  1KU6 B;  4EY8 B;  1JBD A;  4ZQY A;  1HOY A;  1MR6 A;  2PJY C;  1IKC A;  1IDG A;  3ERA A;  1IQ9 A;  5DZ5 A;  5IMY C;  1KL8 A;  1M9Z A;  1CHV S;  2H7Z A;  1HC9 A;  4P7U A;  5IMT D;  4LFT A;  1KBS A;  1VB0 A;  2K3G A;  2J8B A;  1TXA A;  1REW C;  5DO6 A;  1FF4 A;  1ERG A;  1TFS A;  1KFH A;  2MHY A;  4UY2 C;  1NOR A;  1KTZ B;  1CDS A;  1FRA A;  1BTE A;  1QKD A;  2I9B E;  1I02 A;  1FFJ A;  1COD A;  1CVO A;  4BIK B;  1DRS A;  4OM4 A;  2VLW A;  2H7Z B;  4OM5 A;  1CB9 A;  1CRF A;  1LJZ A;  2NBT A;  1FSC A;  3NH7 A;  1CRE A;  1YWH A;  2QJB C;  2CRS A;  1QKE A;  1TXB A;  1KS6 A;  4QTI U;  1IDL A;  2L5S A;  4IYE A;  2H5F A;  2H62 C;  2N99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...