1QKDA

Erabutoxin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Neurotoxin
molecule keywords ERABUTOXIN A
publication title Structure of dimeric and monomeric erabutoxin a refined at 1.5 A resolution.
pubmed doi rcsb
total genus 12
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1qkdA00
4OM5A 4QTIU 5IMYC 1CODA 2L03A 5DU1A 2H64B 1ABTA 3LAQU 2UWRA 2MJ0A 1M9ZA 2CDXA 1XT3A 2LCRA 1CCQA 1KBAA 1IDIA 1KU6B 2LA1A 1UG4A 2MUOA 2QJBC 1HAAA 1NYUA 3ERAA 1IK8A 1FRAA 2HLQA 1IDHA 2N99A 3NH7A 2JVEA 1LXGA 1YWHA 1JGKA 1VB0A 1FSSB 1S4YA 4HQPF 6EBXA 2BHIA 1TXAA 1CB9A 1HC9B 3BT2U 2BTXA 3NEQA 1CXNA 2QC1A 1NORA 2H62C 3NDSA 3FEVA 1NTNA 2CRSA 2X8BB 3EVSC 3VTSA 4ZQYA 3KFDE 1CXOA 1IQ9A 1COEA 1IJCA 1JE9A 1TGXA 5DZ5A 1QKEA 4FAOE 1BXPA 4BIKB 1I02A 1KS6A 1HOYA 1QM7A 1MR6A 2CCXA 3U73U 1PLOA 1FASA 1ONJA 4P7UA 4XJJA 1HC9A 1KL8A 1QKDA 1IDLA 2H8UA 4RUDA 1CTXA 2K3GA 1IDGA 4LFTA 2JQPA 1H0JA 5DO6A 1NYSA 1LXHA 4IYEA 2CRTA 1CHVS 1V6PA 4BDTB 5IMTD 1ES7B 1KBSA 2HLRA 1LJZA 2J8BA 1CDTA 1LX5B 2MUPA 2H7ZB 2ABXA 1REWC 2VLWA 2PJYC 3EBXA 1RGJA 2H5FA 1KFHA 2GOOC 3KFDI 1KBTA 1ERGA 1NTXA 1IKCA 2NBTA 4FAOC 1CREA 1FSCA 1LSIA 2QJAC 1JBDA 2MFAA 5EBXA 1CDQA 2MJ4A 1TFSA 1NXBA 1ZADA 1DRSA 2MJYA 3QB4B 1G6MA 2QJ9C 3U74U 1CVOA 1KTZB 1F8UB 1NEAA 2H7ZA 1MAHF 1CRFA 4EY8B 1BTEA 4OM4A 3HH7A 3BT1U 1ERAA 1FF4A 2MHYA 4UY2C 2ERAA 2H64C 1RL5A 2PJYB 1CDSA 1KXIA 2CTXA 2OFSA 2GOOB 4DO8A 1HAJA 1FFJA 2L5SA 1CDRA 2FD6U 1L4WA 2H62D 1KC4A 3PLCA 1TXBA 1F94A 2I9BE 1B41B 2UX2A 4AEAA 1W6BA
chains in the Genus database with same CATH superfamily
4OM5A 4QTIU 5IMYC 1CODA 2L03A 5DU1A 2H64B 1ABTA 3LAQU 2UWRA 2MJ0A 1M9ZA 2CDXA 1XT3A 2LCRA 1CCQA 1KBAA 1IDIA 1KU6B 2LA1A 1UG4A 2MUOA 2QJBC 1HAAA 1NYUA 3ERAA 1IK8A 1FRAA 2HLQA 1IDHA 2N99A 3NH7A 2JVEA 1LXGA 1YWHA 1JGKA 1VB0A 1FSSB 1S4YA 4HQPF 6EBXA 2BHIA 1TXAA 1CB9A 1HC9B 3BT2U 2BTXA 3NEQA 1CXNA 2QC1A 1NORA 2H62C 3NDSA 3FEVA 1NTNA 2CRSA 2X8BB 3EVSC 3VTSA 4ZQYA 3KFDE 1CXOA 1IQ9A 1COEA 1IJCA 1JE9A 1TGXA 5DZ5A 1QKEA 4FAOE 1BXPA 4BIKB 1I02A 1KS6A 1HOYA 1QM7A 1MR6A 2CCXA 3U73U 1PLOA 1FASA 1ONJA 4P7UA 4XJJA 1HC9A 1KL8A 1QKDA 1IDLA 2H8UA 4RUDA 1CTXA 2K3GA 1IDGA 4LFTA 2JQPA 1H0JA 5DO6A 1NYSA 1LXHA 4IYEA 2CRTA 1CHVS 1V6PA 4KSNA 4BDTB 5IMTD 1ES7B 1KBSA 2HLRA 1LJZA 2J8BA 1CDTA 1LX5B 2MUPA 2H7ZB 2ABXA 1REWC 2VLWA 2PJYC 3EBXA 1RGJA 2H5FA 1KFHA 2GOOC 3KFDI 1KBTA 1ERGA 1NTXA 1IKCA 2NBTA 4FAOC 1CREA 1FSCA 1LSIA 2QJAC 1JBDA 2MFAA 5EBXA 1CDQA 2MJ4A 1TFSA 1NXBA 1ZADA 1DRSA 2MJYA 3QB4B 1G6MA 2QJ9C 3U74U 1CVOA 1KTZB 1F8UB 1NEAA 2H7ZA 1MAHF 1CRFA 4EY8B 1BTEA 4OM4A 3HH7A 3BT1U 1ERAA 1FF4A 2MHYA 4UY2C 2ERAA 2H64C 1RL5A 2PJYB 1CDSA 1KXIA 2CTXA 2OFSA 2GOOB 4DO8A 1HAJA 1FFJA 2L5SA 1CDRA 2FD6U 1L4WA 2H62D 1KC4A 3PLCA 1TXBA 1F94A 2I9BE 1B41B 2UX2A 4AEAA 1W6BA
chains in the Genus database with same CATH topology
4OM5A 4QTIU 5IMYC 1CODA 2L03A 5DU1A 2H64B 1ABTA 3LAQU 2UWRA 2MJ0A 1M9ZA 2CDXA 1XT3A 2LCRA 1CCQA 1KBAA 1IDIA 1KU6B 2LA1A 1UG4A 2MUOA 2QJBC 1HAAA 1NYUA 3ERAA 1IK8A 1FRAA 2HLQA 1IDHA 2N99A 3NH7A 2JVEA 1LXGA 1YWHA 1JGKA 1VB0A 1FSSB 1S4YA 4HQPF 6EBXA 2BHIA 1TXAA 1CB9A 1HC9B 3BT2U 2BTXA 3NEQA 1CXNA 2QC1A 1NORA 2H62C 3NDSA 3FEVA 1NTNA 2CRSA 2X8BB 3EVSC 3VTSA 4ZQYA 3KFDE 1CXOA 1IQ9A 1COEA 1IJCA 1JE9A 1TGXA 5DZ5A 1QKEA 4FAOE 1BXPA 4BIKB 1I02A 1KS6A 1HOYA 1QM7A 1MR6A 2CCXA 3U73U 1PLOA 1FASA 1ONJA 4P7UA 4XJJA 1HC9A 1KL8A 1QKDA 1IDLA 2H8UA 4RUDA 1CTXA 2K3GA 1IDGA 4LFTA 2JQPA 1H0JA 5DO6A 1NYSA 1LXHA 4IYEA 2CRTA 1CHVS 1V6PA 4KSNA 4BDTB 5IMTD 1ES7B 1KBSA 2HLRA 1LJZA 2J8BA 1CDTA 1LX5B 2MUPA 2H7ZB 2ABXA 1REWC 2VLWA 2PJYC 3EBXA 1RGJA 2H5FA 1KFHA 2GOOC 3KFDI 1KBTA 1ERGA 1NTXA 1IKCA 2NBTA 4FAOC 1CREA 1FSCA 1LSIA 2QJAC 1JBDA 2MFAA 5EBXA 1CDQA 2MJ4A 1TFSA 1NXBA 1ZADA 1DRSA 2MJYA 3QB4B 1G6MA 2QJ9C 3U74U 1CVOA 1KTZB 1F8UB 1NEAA 2H7ZA 1MAHF 1CRFA 4EY8B 1BTEA 4OM4A 3HH7A 3BT1U 1ERAA 1FF4A 2MHYA 4UY2C 2ERAA 2H64C 1RL5A 2PJYB 1CDSA 1KXIA 2CTXA 2OFSA 2GOOB 4DO8A 1HAJA 1FFJA 2L5SA 1CDRA 2FD6U 1L4WA 2H62D 1KC4A 3PLCA 1TXBA 1F94A 2I9BE 1B41B 2UX2A 4AEAA 1W6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OM5 A;  4QTI U;  5IMY C;  1COD A;  2L03 A;  5DU1 A;  2H64 B;  1ABT A;  3LAQ U;  2UWR A;  2MJ0 A;  1M9Z A;  2CDX A;  1XT3 A;  2LCR A;  1CCQ A;  1KBA A;  1IDI A;  1KU6 B;  2LA1 A;  1UG4 A;  2MUO A;  2QJB C;  1HAA A;  1NYU A;  3ERA A;  1IK8 A;  1FRA A;  2HLQ A;  1IDH A;  2N99 A;  3NH7 A;  2JVE A;  1LXG A;  1YWH A;  1JGK A;  1VB0 A;  1FSS B;  1S4Y A;  4HQP F;  6EBX A;  2BHI A;  1TXA A;  1CB9 A;  1HC9 B;  3BT2 U;  2BTX A;  3NEQ A;  1CXN A;  2QC1 A;  1NOR A;  2H62 C;  3NDS A;  3FEV A;  1NTN A;  2CRS A;  2X8B B;  3EVS C;  3VTS A;  4ZQY A;  3KFD E;  1CXO A;  1IQ9 A;  1COE A;  1IJC A;  1JE9 A;  1TGX A;  5DZ5 A;  1QKE A;  4FAO E;  1BXP A;  4BIK B;  1I02 A;  1KS6 A;  1HOY A;  1QM7 A;  1MR6 A;  2CCX A;  3U73 U;  1PLO A;  1FAS A;  1ONJ A;  4P7U A;  4XJJ A;  1HC9 A;  1KL8 A;  1QKD A;  1IDL A;  2H8U A;  4RUD A;  1CTX A;  2K3G A;  1IDG A;  4LFT A;  2JQP A;  1H0J A;  5DO6 A;  1NYS A;  1LXH A;  4IYE A;  2CRT A;  1CHV S;  1V6P A;  4BDT B;  5IMT D;  1ES7 B;  1KBS A;  2HLR A;  1LJZ A;  2J8B A;  1CDT A;  1LX5 B;  2MUP A;  2H7Z B;  2ABX A;  1REW C;  2VLW A;  2PJY C;  3EBX A;  1RGJ A;  2H5F A;  1KFH A;  2GOO C;  3KFD I;  1KBT A;  1ERG A;  1NTX A;  1IKC A;  2NBT A;  4FAO C;  1CRE A;  1FSC A;  1LSI A;  2QJA C;  1JBD A;  2MFA A;  5EBX A;  1CDQ A;  2MJ4 A;  1TFS A;  1NXB A;  1ZAD A;  1DRS A;  2MJY A;  3QB4 B;  1G6M A;  2QJ9 C;  3U74 U;  1CVO A;  1KTZ B;  1F8U B;  1NEA A;  2H7Z A;  1MAH F;  1CRF A;  4EY8 B;  1BTE A;  4OM4 A;  3HH7 A;  3BT1 U;  1ERA A;  1FF4 A;  2MHY A;  4UY2 C;  2ERA A;  2H64 C;  1RL5 A;  2PJY B;  1CDS A;  1KXI A;  2CTX A;  2OFS A;  2GOO B;  4DO8 A;  1HAJ A;  1FFJ A;  2L5S A;  1CDR A;  2FD6 U;  1L4W A;  2H62 D;  1KC4 A;  3PLC A;  1TXB A;  1F94 A;  2I9B E;  1B41 B;  2UX2 A;  4AEA A;  1W6B A; 
#chains in the Genus database with same CATH topology
 4OM5 A;  4QTI U;  5IMY C;  1COD A;  2L03 A;  5DU1 A;  2H64 B;  1ABT A;  3LAQ U;  2UWR A;  2MJ0 A;  1M9Z A;  2CDX A;  1XT3 A;  2LCR A;  1CCQ A;  1KBA A;  1IDI A;  1KU6 B;  2LA1 A;  1UG4 A;  2MUO A;  2QJB C;  1HAA A;  1NYU A;  3ERA A;  1IK8 A;  1FRA A;  2HLQ A;  1IDH A;  2N99 A;  3NH7 A;  2JVE A;  1LXG A;  1YWH A;  1JGK A;  1VB0 A;  1FSS B;  1S4Y A;  4HQP F;  6EBX A;  2BHI A;  1TXA A;  1CB9 A;  1HC9 B;  3BT2 U;  2BTX A;  3NEQ A;  1CXN A;  2QC1 A;  1NOR A;  2H62 C;  3NDS A;  3FEV A;  1NTN A;  2CRS A;  2X8B B;  3EVS C;  3VTS A;  4ZQY A;  3KFD E;  1CXO A;  1IQ9 A;  1COE A;  1IJC A;  1JE9 A;  1TGX A;  5DZ5 A;  1QKE A;  4FAO E;  1BXP A;  4BIK B;  1I02 A;  1KS6 A;  1HOY A;  1QM7 A;  1MR6 A;  2CCX A;  3U73 U;  1PLO A;  1FAS A;  1ONJ A;  4P7U A;  4XJJ A;  1HC9 A;  1KL8 A;  1QKD A;  1IDL A;  2H8U A;  4RUD A;  1CTX A;  2K3G A;  1IDG A;  4LFT A;  2JQP A;  1H0J A;  5DO6 A;  1NYS A;  1LXH A;  4IYE A;  2CRT A;  1CHV S;  1V6P A;  4KSN A;  4BDT B;  5IMT D;  1ES7 B;  1KBS A;  2HLR A;  1LJZ A;  2J8B A;  1CDT A;  1LX5 B;  2MUP A;  2H7Z B;  2ABX A;  1REW C;  2VLW A;  2PJY C;  3EBX A;  1RGJ A;  2H5F A;  1KFH A;  2GOO C;  3KFD I;  1KBT A;  1ERG A;  1NTX A;  1IKC A;  2NBT A;  4FAO C;  1CRE A;  1FSC A;  1LSI A;  2QJA C;  1JBD A;  2MFA A;  5EBX A;  1CDQ A;  2MJ4 A;  1TFS A;  1NXB A;  1ZAD A;  1DRS A;  2MJY A;  3QB4 B;  1G6M A;  2QJ9 C;  3U74 U;  1CVO A;  1KTZ B;  1F8U B;  1NEA A;  2H7Z A;  1MAH F;  1CRF A;  4EY8 B;  1BTE A;  4OM4 A;  3HH7 A;  3BT1 U;  1ERA A;  1FF4 A;  2MHY A;  4UY2 C;  2ERA A;  2H64 C;  1RL5 A;  2PJY B;  1CDS A;  1KXI A;  2CTX A;  2OFS A;  2GOO B;  4DO8 A;  1HAJ A;  1FFJ A;  2L5S A;  1CDR A;  2FD6 U;  1L4W A;  2H62 D;  1KC4 A;  3PLC A;  1TXB A;  1F94 A;  2I9B E;  1B41 B;  2UX2 A;  4AEA A;  1W6B A; 
#chains in the Genus database with same CATH homology
 4OM5 A;  4QTI U;  5IMY C;  1COD A;  2L03 A;  5DU1 A;  2H64 B;  1ABT A;  3LAQ U;  2UWR A;  2MJ0 A;  1M9Z A;  2CDX A;  1XT3 A;  2LCR A;  1CCQ A;  1KBA A;  1IDI A;  1KU6 B;  2LA1 A;  1UG4 A;  2MUO A;  2QJB C;  1HAA A;  1NYU A;  3ERA A;  1IK8 A;  1FRA A;  2HLQ A;  1IDH A;  2N99 A;  3NH7 A;  2JVE A;  1LXG A;  1YWH A;  1JGK A;  1VB0 A;  1FSS B;  1S4Y A;  4HQP F;  6EBX A;  2BHI A;  1TXA A;  1CB9 A;  1HC9 B;  3BT2 U;  2BTX A;  3NEQ A;  1CXN A;  2QC1 A;  1NOR A;  2H62 C;  3NDS A;  3FEV A;  1NTN A;  2CRS A;  2X8B B;  3EVS C;  3VTS A;  4ZQY A;  3KFD E;  1CXO A;  1IQ9 A;  1COE A;  1IJC A;  1JE9 A;  1TGX A;  5DZ5 A;  1QKE A;  4FAO E;  1BXP A;  4BIK B;  1I02 A;  1KS6 A;  1HOY A;  1QM7 A;  1MR6 A;  2CCX A;  3U73 U;  1PLO A;  1FAS A;  1ONJ A;  4P7U A;  4XJJ A;  1HC9 A;  1KL8 A;  1QKD A;  1IDL A;  2H8U A;  4RUD A;  1CTX A;  2K3G A;  1IDG A;  4LFT A;  2JQP A;  1H0J A;  5DO6 A;  1NYS A;  1LXH A;  4IYE A;  2CRT A;  1CHV S;  1V6P A;  4KSN A;  4BDT B;  5IMT D;  1ES7 B;  1KBS A;  2HLR A;  1LJZ A;  2J8B A;  1CDT A;  1LX5 B;  2MUP A;  2H7Z B;  2ABX A;  1REW C;  2VLW A;  2PJY C;  3EBX A;  1RGJ A;  2H5F A;  1KFH A;  2GOO C;  3KFD I;  1KBT A;  1ERG A;  1NTX A;  1IKC A;  2NBT A;  4FAO C;  1CRE A;  1FSC A;  1LSI A;  2QJA C;  1JBD A;  2MFA A;  5EBX A;  1CDQ A;  2MJ4 A;  1TFS A;  1NXB A;  1ZAD A;  1DRS A;  2MJY A;  3QB4 B;  1G6M A;  2QJ9 C;  3U74 U;  1CVO A;  1KTZ B;  1F8U B;  1NEA A;  2H7Z A;  1MAH F;  1CRF A;  4EY8 B;  1BTE A;  4OM4 A;  3HH7 A;  3BT1 U;  1ERA A;  1FF4 A;  2MHY A;  4UY2 C;  2ERA A;  2H64 C;  1RL5 A;  2PJY B;  1CDS A;  1KXI A;  2CTX A;  2OFS A;  2GOO B;  4DO8 A;  1HAJ A;  1FFJ A;  2L5S A;  1CDR A;  2FD6 U;  1L4W A;  2H62 D;  1KC4 A;  3PLC A;  1TXB A;  1F94 A;  2I9B E;  1B41 B;  2UX2 A;  4AEA A;  1W6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...