2HLQA

Crystal structure of the extracellular domain of the type ii bmp receptor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
100
structure length
100
Chain Sequence
ALCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Bone morphogenetic protein receptor type-2
publication title High resolution structures of the bone morphogenetic protein type II receptor in two crystal forms: Implications for ligand binding
pubmed doi rcsb
source organism Ovis aries
total genus 23
structure length 100
sequence length 100
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2006-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2hlqA00
2LCRA 2K3GA 1CHVS 1MR6A 2UWRA 1IQ9A 1IJCA 1FRAA 2H62C 3NDSA 1HOYA 1LXGA 2VLWA 2MUOA 4BDTB 1CCQA 4FAOE 1VB0A 2H5FA 2UX2A 1NTNA 5IMYC 3QB4B 1V6PA 1KS6A 1JBDA 1QKDA 1TFSA 2H7ZB 1COEA 2H8UA 1IKCA 2H64B 2GOOC 1XT3A 4HQPF 1CXOA 2HLQA 5DZ5A 2L03A 1TXBA 1FFJA 1NORA 1BXPA 6EBXA 1KFHA 2CTXA 1NTXA 1DRSA 1BTEA 1JGKA 1ERAA 4P7UA 1KBTA 1CDSA 1YWHA 1CDQA 2L5SA 2J8BA 1CRFA 2MJ0A 2ERAA 3EVSC 3LAQU 1LJZA 2CRTA 1CDTA 3U73U 1F8UB 3BT2U 1L4WA 2BTXA 1KU6B 2MHYA 2X8BB 1NYSA 1REWC 1W6BA 3VTSA 1ABTA 1KBSA 4OM4A 2MFAA 1ONJA 5IMTD 2GOOB 1HAAA 1PLOA 2N99A 1CVOA 1H0JA 1IDGA 1G6MA 1CODA 1ES7B 1S4YA 4RUDA 2QJ9C 1CXNA 2MJYA 4IYEA 2CRSA 1F94A 2CDXA 1LSIA 3NEQA 1NYUA 1LX5B 1QM7A 1IDLA 2H7ZA 1LXHA 1NEAA 3FEVA 1HC9B 4UY2C 1QKEA 1KBAA 2FD6U 4FAOC 2QC1A 1UG4A 1KC4A 1FF4A 1RGJA 4EY8B 2NBTA 4XJJA 1ZADA 3HH7A 1FASA 1KTZB 2ABXA 5DO6A 1TGXA 1CREA 2BHIA 3PLCA 2QJAC 2HLRA 3BT1U 1B41B 1KXIA 2I9BE 2QJBC 4QTIU 1CTXA 4DO8A 3KFDE 5EBXA 1NXBA 2PJYC 2OFSA 1HC9A 2JQPA 2LA1A 1IDIA 4ZQYA 3KFDI 1TXAA 2MUPA 4LFTA 4BIKB 2MJ4A 1ERGA 1I02A 1FSSB 1IK8A 3ERAA 1M9ZA 4AEAA 1IDHA 2JVEA 3NH7A 1HAJA 5DU1A 2H62D 4OM5A 3EBXA 1JE9A 2CCXA 1FSCA 3U74U 1CB9A 2H64C 1MAHF 1KL8A 1CDRA 2PJYB 1RL5A
chains in the Genus database with same CATH superfamily
2LCRA 2K3GA 1CHVS 1MR6A 2UWRA 1IQ9A 1IJCA 1FRAA 2H62C 3NDSA 1HOYA 1LXGA 2VLWA 2MUOA 4BDTB 1CCQA 4FAOE 1VB0A 2H5FA 2UX2A 1NTNA 5IMYC 3QB4B 1V6PA 1KS6A 1JBDA 1QKDA 1TFSA 2H7ZB 1COEA 2H8UA 1IKCA 2H64B 2GOOC 1XT3A 4HQPF 1CXOA 2HLQA 5DZ5A 2L03A 1TXBA 1FFJA 1NORA 1BXPA 6EBXA 1KFHA 4KSNA 2CTXA 1NTXA 1DRSA 1BTEA 1JGKA 1ERAA 4P7UA 1KBTA 1CDSA 1YWHA 1CDQA 2L5SA 2J8BA 1CRFA 2MJ0A 2ERAA 3EVSC 3LAQU 1LJZA 2CRTA 1CDTA 3U73U 1F8UB 3BT2U 1L4WA 2BTXA 1KU6B 2MHYA 2X8BB 1NYSA 1REWC 1W6BA 3VTSA 1ABTA 1KBSA 4OM4A 2MFAA 1ONJA 5IMTD 2GOOB 1HAAA 1PLOA 2N99A 1CVOA 1H0JA 1IDGA 1G6MA 1CODA 1ES7B 1S4YA 4RUDA 2QJ9C 1CXNA 2MJYA 4IYEA 2CRSA 1F94A 2CDXA 1LSIA 3NEQA 1NYUA 1LX5B 1QM7A 1IDLA 2H7ZA 1LXHA 1NEAA 3FEVA 1HC9B 4UY2C 1QKEA 1KBAA 2FD6U 4FAOC 2QC1A 1UG4A 1KC4A 1FF4A 1RGJA 4EY8B 2NBTA 4XJJA 1ZADA 3HH7A 1FASA 1KTZB 2ABXA 5DO6A 1TGXA 1CREA 2BHIA 3PLCA 2QJAC 2HLRA 3BT1U 1B41B 1KXIA 2I9BE 2QJBC 4QTIU 1CTXA 4DO8A 3KFDE 5EBXA 1NXBA 2PJYC 2OFSA 1HC9A 2JQPA 2LA1A 1IDIA 4ZQYA 3KFDI 1TXAA 2MUPA 4LFTA 4BIKB 2MJ4A 1ERGA 1I02A 1FSSB 1IK8A 3ERAA 1M9ZA 4AEAA 1IDHA 2JVEA 3NH7A 1HAJA 5DU1A 2H62D 4OM5A 3EBXA 1JE9A 2CCXA 1FSCA 3U74U 1CB9A 2H64C 1MAHF 1KL8A 1CDRA 2PJYB 1RL5A
chains in the Genus database with same CATH topology
2LCRA 2K3GA 1CHVS 1MR6A 2UWRA 1IQ9A 1IJCA 1FRAA 2H62C 3NDSA 1HOYA 1LXGA 2VLWA 2MUOA 4BDTB 1CCQA 4FAOE 1VB0A 2H5FA 2UX2A 1NTNA 5IMYC 3QB4B 1V6PA 1KS6A 1JBDA 1QKDA 1TFSA 2H7ZB 1COEA 2H8UA 1IKCA 2H64B 2GOOC 1XT3A 4HQPF 1CXOA 2HLQA 5DZ5A 2L03A 1TXBA 1FFJA 1NORA 1BXPA 6EBXA 1KFHA 4KSNA 2CTXA 1NTXA 1DRSA 1BTEA 1JGKA 1ERAA 4P7UA 1KBTA 1CDSA 1YWHA 1CDQA 2L5SA 2J8BA 1CRFA 2MJ0A 2ERAA 3EVSC 3LAQU 1LJZA 2CRTA 1CDTA 3U73U 1F8UB 3BT2U 1L4WA 2BTXA 1KU6B 2MHYA 2X8BB 1NYSA 1REWC 1W6BA 3VTSA 1ABTA 1KBSA 4OM4A 2MFAA 1ONJA 5IMTD 2GOOB 1HAAA 1PLOA 2N99A 1CVOA 1H0JA 1IDGA 1G6MA 1CODA 1ES7B 1S4YA 4RUDA 2QJ9C 1CXNA 2MJYA 4IYEA 2CRSA 1F94A 2CDXA 1LSIA 3NEQA 1NYUA 1LX5B 1QM7A 1IDLA 2H7ZA 1LXHA 1NEAA 3FEVA 1HC9B 4UY2C 1QKEA 1KBAA 2FD6U 4FAOC 2QC1A 1UG4A 1KC4A 1FF4A 1RGJA 4EY8B 2NBTA 4XJJA 1ZADA 3HH7A 1FASA 1KTZB 2ABXA 5DO6A 1TGXA 1CREA 2BHIA 3PLCA 2QJAC 2HLRA 3BT1U 1B41B 1KXIA 2I9BE 2QJBC 4QTIU 1CTXA 4DO8A 3KFDE 5EBXA 1NXBA 2PJYC 2OFSA 1HC9A 2JQPA 2LA1A 1IDIA 4ZQYA 3KFDI 1TXAA 2MUPA 4LFTA 4BIKB 2MJ4A 1ERGA 1I02A 1FSSB 1IK8A 3ERAA 1M9ZA 4AEAA 1IDHA 2JVEA 3NH7A 1HAJA 5DU1A 2H62D 4OM5A 3EBXA 1JE9A 2CCXA 1FSCA 3U74U 1CB9A 2H64C 1MAHF 1KL8A 1CDRA 2PJYB 1RL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCR A;  2K3G A;  1CHV S;  1MR6 A;  2UWR A;  1IQ9 A;  1IJC A;  1FRA A;  2H62 C;  3NDS A;  1HOY A;  1LXG A;  2VLW A;  2MUO A;  4BDT B;  1CCQ A;  4FAO E;  1VB0 A;  2H5F A;  2UX2 A;  1NTN A;  5IMY C;  3QB4 B;  1V6P A;  1KS6 A;  1JBD A;  1QKD A;  1TFS A;  2H7Z B;  1COE A;  2H8U A;  1IKC A;  2H64 B;  2GOO C;  1XT3 A;  4HQP F;  1CXO A;  2HLQ A;  5DZ5 A;  2L03 A;  1TXB A;  1FFJ A;  1NOR A;  1BXP A;  6EBX A;  1KFH A;  2CTX A;  1NTX A;  1DRS A;  1BTE A;  1JGK A;  1ERA A;  4P7U A;  1KBT A;  1CDS A;  1YWH A;  1CDQ A;  2L5S A;  2J8B A;  1CRF A;  2MJ0 A;  2ERA A;  3EVS C;  3LAQ U;  1LJZ A;  2CRT A;  1CDT A;  3U73 U;  1F8U B;  3BT2 U;  1L4W A;  2BTX A;  1KU6 B;  2MHY A;  2X8B B;  1NYS A;  1REW C;  1W6B A;  3VTS A;  1ABT A;  1KBS A;  4OM4 A;  2MFA A;  1ONJ A;  5IMT D;  2GOO B;  1HAA A;  1PLO A;  2N99 A;  1CVO A;  1H0J A;  1IDG A;  1G6M A;  1COD A;  1ES7 B;  1S4Y A;  4RUD A;  2QJ9 C;  1CXN A;  2MJY A;  4IYE A;  2CRS A;  1F94 A;  2CDX A;  1LSI A;  3NEQ A;  1NYU A;  1LX5 B;  1QM7 A;  1IDL A;  2H7Z A;  1LXH A;  1NEA A;  3FEV A;  1HC9 B;  4UY2 C;  1QKE A;  1KBA A;  2FD6 U;  4FAO C;  2QC1 A;  1UG4 A;  1KC4 A;  1FF4 A;  1RGJ A;  4EY8 B;  2NBT A;  4XJJ A;  1ZAD A;  3HH7 A;  1FAS A;  1KTZ B;  2ABX A;  5DO6 A;  1TGX A;  1CRE A;  2BHI A;  3PLC A;  2QJA C;  2HLR A;  3BT1 U;  1B41 B;  1KXI A;  2I9B E;  2QJB C;  4QTI U;  1CTX A;  4DO8 A;  3KFD E;  5EBX A;  1NXB A;  2PJY C;  2OFS A;  1HC9 A;  2JQP A;  2LA1 A;  1IDI A;  4ZQY A;  3KFD I;  1TXA A;  2MUP A;  4LFT A;  4BIK B;  2MJ4 A;  1ERG A;  1I02 A;  1FSS B;  1IK8 A;  3ERA A;  1M9Z A;  4AEA A;  1IDH A;  2JVE A;  3NH7 A;  1HAJ A;  5DU1 A;  2H62 D;  4OM5 A;  3EBX A;  1JE9 A;  2CCX A;  1FSC A;  3U74 U;  1CB9 A;  2H64 C;  1MAH F;  1KL8 A;  1CDR A;  2PJY B;  1RL5 A; 
#chains in the Genus database with same CATH topology
 2LCR A;  2K3G A;  1CHV S;  1MR6 A;  2UWR A;  1IQ9 A;  1IJC A;  1FRA A;  2H62 C;  3NDS A;  1HOY A;  1LXG A;  2VLW A;  2MUO A;  4BDT B;  1CCQ A;  4FAO E;  1VB0 A;  2H5F A;  2UX2 A;  1NTN A;  5IMY C;  3QB4 B;  1V6P A;  1KS6 A;  1JBD A;  1QKD A;  1TFS A;  2H7Z B;  1COE A;  2H8U A;  1IKC A;  2H64 B;  2GOO C;  1XT3 A;  4HQP F;  1CXO A;  2HLQ A;  5DZ5 A;  2L03 A;  1TXB A;  1FFJ A;  1NOR A;  1BXP A;  6EBX A;  1KFH A;  4KSN A;  2CTX A;  1NTX A;  1DRS A;  1BTE A;  1JGK A;  1ERA A;  4P7U A;  1KBT A;  1CDS A;  1YWH A;  1CDQ A;  2L5S A;  2J8B A;  1CRF A;  2MJ0 A;  2ERA A;  3EVS C;  3LAQ U;  1LJZ A;  2CRT A;  1CDT A;  3U73 U;  1F8U B;  3BT2 U;  1L4W A;  2BTX A;  1KU6 B;  2MHY A;  2X8B B;  1NYS A;  1REW C;  1W6B A;  3VTS A;  1ABT A;  1KBS A;  4OM4 A;  2MFA A;  1ONJ A;  5IMT D;  2GOO B;  1HAA A;  1PLO A;  2N99 A;  1CVO A;  1H0J A;  1IDG A;  1G6M A;  1COD A;  1ES7 B;  1S4Y A;  4RUD A;  2QJ9 C;  1CXN A;  2MJY A;  4IYE A;  2CRS A;  1F94 A;  2CDX A;  1LSI A;  3NEQ A;  1NYU A;  1LX5 B;  1QM7 A;  1IDL A;  2H7Z A;  1LXH A;  1NEA A;  3FEV A;  1HC9 B;  4UY2 C;  1QKE A;  1KBA A;  2FD6 U;  4FAO C;  2QC1 A;  1UG4 A;  1KC4 A;  1FF4 A;  1RGJ A;  4EY8 B;  2NBT A;  4XJJ A;  1ZAD A;  3HH7 A;  1FAS A;  1KTZ B;  2ABX A;  5DO6 A;  1TGX A;  1CRE A;  2BHI A;  3PLC A;  2QJA C;  2HLR A;  3BT1 U;  1B41 B;  1KXI A;  2I9B E;  2QJB C;  4QTI U;  1CTX A;  4DO8 A;  3KFD E;  5EBX A;  1NXB A;  2PJY C;  2OFS A;  1HC9 A;  2JQP A;  2LA1 A;  1IDI A;  4ZQY A;  3KFD I;  1TXA A;  2MUP A;  4LFT A;  4BIK B;  2MJ4 A;  1ERG A;  1I02 A;  1FSS B;  1IK8 A;  3ERA A;  1M9Z A;  4AEA A;  1IDH A;  2JVE A;  3NH7 A;  1HAJ A;  5DU1 A;  2H62 D;  4OM5 A;  3EBX A;  1JE9 A;  2CCX A;  1FSC A;  3U74 U;  1CB9 A;  2H64 C;  1MAH F;  1KL8 A;  1CDR A;  2PJY B;  1RL5 A; 
#chains in the Genus database with same CATH homology
 2LCR A;  2K3G A;  1CHV S;  1MR6 A;  2UWR A;  1IQ9 A;  1IJC A;  1FRA A;  2H62 C;  3NDS A;  1HOY A;  1LXG A;  2VLW A;  2MUO A;  4BDT B;  1CCQ A;  4FAO E;  1VB0 A;  2H5F A;  2UX2 A;  1NTN A;  5IMY C;  3QB4 B;  1V6P A;  1KS6 A;  1JBD A;  1QKD A;  1TFS A;  2H7Z B;  1COE A;  2H8U A;  1IKC A;  2H64 B;  2GOO C;  1XT3 A;  4HQP F;  1CXO A;  2HLQ A;  5DZ5 A;  2L03 A;  1TXB A;  1FFJ A;  1NOR A;  1BXP A;  6EBX A;  1KFH A;  4KSN A;  2CTX A;  1NTX A;  1DRS A;  1BTE A;  1JGK A;  1ERA A;  4P7U A;  1KBT A;  1CDS A;  1YWH A;  1CDQ A;  2L5S A;  2J8B A;  1CRF A;  2MJ0 A;  2ERA A;  3EVS C;  3LAQ U;  1LJZ A;  2CRT A;  1CDT A;  3U73 U;  1F8U B;  3BT2 U;  1L4W A;  2BTX A;  1KU6 B;  2MHY A;  2X8B B;  1NYS A;  1REW C;  1W6B A;  3VTS A;  1ABT A;  1KBS A;  4OM4 A;  2MFA A;  1ONJ A;  5IMT D;  2GOO B;  1HAA A;  1PLO A;  2N99 A;  1CVO A;  1H0J A;  1IDG A;  1G6M A;  1COD A;  1ES7 B;  1S4Y A;  4RUD A;  2QJ9 C;  1CXN A;  2MJY A;  4IYE A;  2CRS A;  1F94 A;  2CDX A;  1LSI A;  3NEQ A;  1NYU A;  1LX5 B;  1QM7 A;  1IDL A;  2H7Z A;  1LXH A;  1NEA A;  3FEV A;  1HC9 B;  4UY2 C;  1QKE A;  1KBA A;  2FD6 U;  4FAO C;  2QC1 A;  1UG4 A;  1KC4 A;  1FF4 A;  1RGJ A;  4EY8 B;  2NBT A;  4XJJ A;  1ZAD A;  3HH7 A;  1FAS A;  1KTZ B;  2ABX A;  5DO6 A;  1TGX A;  1CRE A;  2BHI A;  3PLC A;  2QJA C;  2HLR A;  3BT1 U;  1B41 B;  1KXI A;  2I9B E;  2QJB C;  4QTI U;  1CTX A;  4DO8 A;  3KFD E;  5EBX A;  1NXB A;  2PJY C;  2OFS A;  1HC9 A;  2JQP A;  2LA1 A;  1IDI A;  4ZQY A;  3KFD I;  1TXA A;  2MUP A;  4LFT A;  4BIK B;  2MJ4 A;  1ERG A;  1I02 A;  1FSS B;  1IK8 A;  3ERA A;  1M9Z A;  4AEA A;  1IDH A;  2JVE A;  3NH7 A;  1HAJ A;  5DU1 A;  2H62 D;  4OM5 A;  3EBX A;  1JE9 A;  2CCX A;  1FSC A;  3U74 U;  1CB9 A;  2H64 C;  1MAH F;  1KL8 A;  1CDR A;  2PJY B;  1RL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...