2HLQA

Crystal structure of the extracellular domain of the type ii bmp receptor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
100
structure length
100
Chain Sequence
ALCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein receptor type-2
publication title High resolution structures of the bone morphogenetic protein type II receptor in two crystal forms: Implications for ligand binding
pubmed doi rcsb
source organism Ovis aries
molecule tags Transferase
total genus 23
structure length 100
sequence length 100
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2006-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2hlqA00
1CDSA 1B41B 3U74U 1IDIA 4DO8A 2CRTA 2QC1A 2X8BB 1CCQA 1FASA 1RGJA 2N99A 2LA1A 1JGKA 2UX2A 6EBXA 1YWHA 1KU6B 1COEA 2CDXA 2HLRA 2PJYC 1ERGA 1FRAA 1NEAA 1FSSB 4ZQYA 1HOYA 2H8UA 1S4YA 5DZ5A 1ES7B 4BDTB 1F8UB 2H5FA 1CDRA 2MJYA 1CTXA 2MUOA 2GOOC 3QB4B 1TFSA 2QJAC 1LXHA 4RUDA 1FF4A 1QKEA 2BTXA 1KC4A 1LX5B 1HAJA 2CTXA 5IMTD 1ABTA 1CDQA 1QM7A 1LSIA 2PJYB 1RL5A 4QTIU 1BXPA 3KFDI 1VB0A 1ZADA 5DO6A 4FAOC 1LXGA 2QJBC 1MAHF 2H7ZB 2OFSA 1FSCA 2GOOB 2H64C 1TXBA 1BTEA 1KXIA 1NORA 1IDLA 2ABXA 2JQPA 1NYSA 1DRSA 1IDGA 4XJJA 1NXBA 2CCXA 1HC9A 4IYEA 1REWC 1JBDA 3FEVA 2L5SA 1QKDA 1ERAA 2ERAA 3BT1U 1KBTA 2MFAA 1H0JA 1HAAA 2MJ0A 2UWRA 5DU1A 5IMYC 4LFTA 2NBTA 4P7UA 1G6MA 1CDTA 1TGXA 2H64B 1V6PA 1ONJA 2FD6U 1LJZA 2H62C 3EBXA 4BIKB 1FFJA 1CREA 2MJ4A 5EBXA 1NTNA 2L03A 1F94A 1KFHA 1M9ZA 1MR6A 2HLQA 4EY8B 2H62D 4AEAA 1CODA 2H7ZA 1IJCA 2VLWA 3BT2U 3HH7A 1IKCA 1KS6A 3KFDE 3VTSA 1L4WA 1IDHA 2MHYA 3ERAA 3NDSA 2QJ9C 3NEQA 1XT3A 2LCRA 1CVOA 4UY2C 1HC9B 2BHIA 1IQ9A 3U73U 2JVEA 1KBSA 3LAQU 1CXNA 3PLCA 1CXOA 2J8BA 1NYUA 1NTXA 3EVSC 1JE9A 3NH7A 1KBAA 1CB9A 1PLOA 1CRFA 4OM5A 1I02A 1CHVS 2CRSA 2K3GA 2MUPA 4OM4A 1IK8A 2I9BE 1KL8A 4FAOE 4HQPF 1UG4A 1W6BA 1TXAA 1KTZB
chains in the Genus database with same CATH superfamily
1CDSA 1B41B 3U74U 1IDIA 4DO8A 2CRTA 2QC1A 2X8BB 1CCQA 1FASA 1RGJA 2N99A 2LA1A 1JGKA 2UX2A 6EBXA 1YWHA 1KU6B 1COEA 2CDXA 2HLRA 2PJYC 1ERGA 1FRAA 1NEAA 1FSSB 4ZQYA 1HOYA 2H8UA 1S4YA 5DZ5A 1ES7B 4BDTB 1F8UB 2H5FA 1CDRA 2MJYA 1CTXA 2MUOA 2GOOC 3QB4B 1TFSA 2QJAC 1LXHA 4RUDA 1FF4A 1QKEA 4KSNA 2BTXA 1KC4A 1LX5B 1HAJA 2CTXA 5IMTD 1ABTA 1CDQA 1QM7A 1LSIA 2PJYB 1RL5A 4QTIU 1BXPA 3KFDI 1VB0A 1ZADA 5DO6A 4FAOC 1LXGA 2QJBC 1MAHF 2H7ZB 2OFSA 1FSCA 2GOOB 2H64C 1TXBA 1BTEA 1KXIA 1NORA 1IDLA 2ABXA 2JQPA 1NYSA 1DRSA 1IDGA 4XJJA 1NXBA 2CCXA 1HC9A 4IYEA 1REWC 1JBDA 3FEVA 2L5SA 1QKDA 1ERAA 2ERAA 3BT1U 1KBTA 2MFAA 1H0JA 1HAAA 2MJ0A 2UWRA 5DU1A 5IMYC 4LFTA 2NBTA 4P7UA 1G6MA 1CDTA 1TGXA 2H64B 1V6PA 1ONJA 2FD6U 1LJZA 2H62C 3EBXA 4BIKB 1FFJA 1CREA 2MJ4A 5EBXA 1NTNA 2L03A 1F94A 1KFHA 1M9ZA 1MR6A 2HLQA 4EY8B 2H62D 4AEAA 1CODA 2H7ZA 1IJCA 2VLWA 3BT2U 3HH7A 1IKCA 1KS6A 3KFDE 3VTSA 1L4WA 1IDHA 2MHYA 3ERAA 3NDSA 2QJ9C 3NEQA 1XT3A 2LCRA 1CVOA 4UY2C 1HC9B 2BHIA 1IQ9A 3U73U 2JVEA 1KBSA 3LAQU 1CXNA 3PLCA 1CXOA 2J8BA 1NYUA 1NTXA 3EVSC 1JE9A 3NH7A 1KBAA 1CB9A 1PLOA 1CRFA 4OM5A 1I02A 1CHVS 2CRSA 2K3GA 2MUPA 4OM4A 1IK8A 2I9BE 1KL8A 4FAOE 4HQPF 1UG4A 1W6BA 1TXAA 1KTZB
chains in the Genus database with same CATH topology
1CDSA 1B41B 3U74U 1IDIA 4DO8A 2CRTA 2QC1A 2X8BB 1CCQA 1FASA 1RGJA 2N99A 2LA1A 1JGKA 2UX2A 6EBXA 1YWHA 1KU6B 1COEA 2CDXA 2HLRA 2PJYC 1ERGA 1FRAA 1NEAA 1FSSB 4ZQYA 1HOYA 2H8UA 1S4YA 5DZ5A 1ES7B 4BDTB 1F8UB 2H5FA 1CDRA 2MJYA 1CTXA 2MUOA 2GOOC 3QB4B 1TFSA 2QJAC 1LXHA 4RUDA 1FF4A 1QKEA 4KSNA 2BTXA 1KC4A 1LX5B 1HAJA 2CTXA 5IMTD 1ABTA 1CDQA 1QM7A 1LSIA 2PJYB 1RL5A 4QTIU 1BXPA 3KFDI 1VB0A 1ZADA 5DO6A 4FAOC 1LXGA 2QJBC 1MAHF 2H7ZB 2OFSA 1FSCA 2GOOB 2H64C 1TXBA 1BTEA 1KXIA 1NORA 1IDLA 2ABXA 2JQPA 1NYSA 1DRSA 1IDGA 4XJJA 1NXBA 2CCXA 1HC9A 4IYEA 1REWC 1JBDA 3FEVA 2L5SA 1QKDA 1ERAA 2ERAA 3BT1U 1KBTA 2MFAA 1H0JA 1HAAA 2MJ0A 2UWRA 5DU1A 5IMYC 4LFTA 2NBTA 4P7UA 1G6MA 1CDTA 1TGXA 2H64B 1V6PA 1ONJA 2FD6U 1LJZA 2H62C 3EBXA 4BIKB 1FFJA 1CREA 2MJ4A 5EBXA 1NTNA 2L03A 1F94A 1KFHA 1M9ZA 1MR6A 2HLQA 4EY8B 2H62D 4AEAA 1CODA 2H7ZA 1IJCA 2VLWA 3BT2U 3HH7A 1IKCA 1KS6A 3KFDE 3VTSA 1L4WA 1IDHA 2MHYA 3ERAA 3NDSA 2QJ9C 3NEQA 1XT3A 2LCRA 1CVOA 4UY2C 1HC9B 2BHIA 1IQ9A 3U73U 2JVEA 1KBSA 3LAQU 1CXNA 3PLCA 1CXOA 2J8BA 1NYUA 1NTXA 3EVSC 1JE9A 3NH7A 1KBAA 1CB9A 1PLOA 1CRFA 4OM5A 1I02A 1CHVS 2CRSA 2K3GA 2MUPA 4OM4A 1IK8A 2I9BE 1KL8A 4FAOE 4HQPF 1UG4A 1W6BA 1TXAA 1KTZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CDS A;  1B41 B;  3U74 U;  1IDI A;  4DO8 A;  2CRT A;  2QC1 A;  2X8B B;  1CCQ A;  1FAS A;  1RGJ A;  2N99 A;  2LA1 A;  1JGK A;  2UX2 A;  6EBX A;  1YWH A;  1KU6 B;  1COE A;  2CDX A;  2HLR A;  2PJY C;  1ERG A;  1FRA A;  1NEA A;  1FSS B;  4ZQY A;  1HOY A;  2H8U A;  1S4Y A;  5DZ5 A;  1ES7 B;  4BDT B;  1F8U B;  2H5F A;  1CDR A;  2MJY A;  1CTX A;  2MUO A;  2GOO C;  3QB4 B;  1TFS A;  2QJA C;  1LXH A;  4RUD A;  1FF4 A;  1QKE A;  2BTX A;  1KC4 A;  1LX5 B;  1HAJ A;  2CTX A;  5IMT D;  1ABT A;  1CDQ A;  1QM7 A;  1LSI A;  2PJY B;  1RL5 A;  4QTI U;  1BXP A;  3KFD I;  1VB0 A;  1ZAD A;  5DO6 A;  4FAO C;  1LXG A;  2QJB C;  1MAH F;  2H7Z B;  2OFS A;  1FSC A;  2GOO B;  2H64 C;  1TXB A;  1BTE A;  1KXI A;  1NOR A;  1IDL A;  2ABX A;  2JQP A;  1NYS A;  1DRS A;  1IDG A;  4XJJ A;  1NXB A;  2CCX A;  1HC9 A;  4IYE A;  1REW C;  1JBD A;  3FEV A;  2L5S A;  1QKD A;  1ERA A;  2ERA A;  3BT1 U;  1KBT A;  2MFA A;  1H0J A;  1HAA A;  2MJ0 A;  2UWR A;  5DU1 A;  5IMY C;  4LFT A;  2NBT A;  4P7U A;  1G6M A;  1CDT A;  1TGX A;  2H64 B;  1V6P A;  1ONJ A;  2FD6 U;  1LJZ A;  2H62 C;  3EBX A;  4BIK B;  1FFJ A;  1CRE A;  2MJ4 A;  5EBX A;  1NTN A;  2L03 A;  1F94 A;  1KFH A;  1M9Z A;  1MR6 A;  2HLQ A;  4EY8 B;  2H62 D;  4AEA A;  1COD A;  2H7Z A;  1IJC A;  2VLW A;  3BT2 U;  3HH7 A;  1IKC A;  1KS6 A;  3KFD E;  3VTS A;  1L4W A;  1IDH A;  2MHY A;  3ERA A;  3NDS A;  2QJ9 C;  3NEQ A;  1XT3 A;  2LCR A;  1CVO A;  4UY2 C;  1HC9 B;  2BHI A;  1IQ9 A;  3U73 U;  2JVE A;  1KBS A;  3LAQ U;  1CXN A;  3PLC A;  1CXO A;  2J8B A;  1NYU A;  1NTX A;  3EVS C;  1JE9 A;  3NH7 A;  1KBA A;  1CB9 A;  1PLO A;  1CRF A;  4OM5 A;  1I02 A;  1CHV S;  2CRS A;  2K3G A;  2MUP A;  4OM4 A;  1IK8 A;  2I9B E;  1KL8 A;  4FAO E;  4HQP F;  1UG4 A;  1W6B A;  1TXA A;  1KTZ B; 
#chains in the Genus database with same CATH topology
 1CDS A;  1B41 B;  3U74 U;  1IDI A;  4DO8 A;  2CRT A;  2QC1 A;  2X8B B;  1CCQ A;  1FAS A;  1RGJ A;  2N99 A;  2LA1 A;  1JGK A;  2UX2 A;  6EBX A;  1YWH A;  1KU6 B;  1COE A;  2CDX A;  2HLR A;  2PJY C;  1ERG A;  1FRA A;  1NEA A;  1FSS B;  4ZQY A;  1HOY A;  2H8U A;  1S4Y A;  5DZ5 A;  1ES7 B;  4BDT B;  1F8U B;  2H5F A;  1CDR A;  2MJY A;  1CTX A;  2MUO A;  2GOO C;  3QB4 B;  1TFS A;  2QJA C;  1LXH A;  4RUD A;  1FF4 A;  1QKE A;  4KSN A;  2BTX A;  1KC4 A;  1LX5 B;  1HAJ A;  2CTX A;  5IMT D;  1ABT A;  1CDQ A;  1QM7 A;  1LSI A;  2PJY B;  1RL5 A;  4QTI U;  1BXP A;  3KFD I;  1VB0 A;  1ZAD A;  5DO6 A;  4FAO C;  1LXG A;  2QJB C;  1MAH F;  2H7Z B;  2OFS A;  1FSC A;  2GOO B;  2H64 C;  1TXB A;  1BTE A;  1KXI A;  1NOR A;  1IDL A;  2ABX A;  2JQP A;  1NYS A;  1DRS A;  1IDG A;  4XJJ A;  1NXB A;  2CCX A;  1HC9 A;  4IYE A;  1REW C;  1JBD A;  3FEV A;  2L5S A;  1QKD A;  1ERA A;  2ERA A;  3BT1 U;  1KBT A;  2MFA A;  1H0J A;  1HAA A;  2MJ0 A;  2UWR A;  5DU1 A;  5IMY C;  4LFT A;  2NBT A;  4P7U A;  1G6M A;  1CDT A;  1TGX A;  2H64 B;  1V6P A;  1ONJ A;  2FD6 U;  1LJZ A;  2H62 C;  3EBX A;  4BIK B;  1FFJ A;  1CRE A;  2MJ4 A;  5EBX A;  1NTN A;  2L03 A;  1F94 A;  1KFH A;  1M9Z A;  1MR6 A;  2HLQ A;  4EY8 B;  2H62 D;  4AEA A;  1COD A;  2H7Z A;  1IJC A;  2VLW A;  3BT2 U;  3HH7 A;  1IKC A;  1KS6 A;  3KFD E;  3VTS A;  1L4W A;  1IDH A;  2MHY A;  3ERA A;  3NDS A;  2QJ9 C;  3NEQ A;  1XT3 A;  2LCR A;  1CVO A;  4UY2 C;  1HC9 B;  2BHI A;  1IQ9 A;  3U73 U;  2JVE A;  1KBS A;  3LAQ U;  1CXN A;  3PLC A;  1CXO A;  2J8B A;  1NYU A;  1NTX A;  3EVS C;  1JE9 A;  3NH7 A;  1KBA A;  1CB9 A;  1PLO A;  1CRF A;  4OM5 A;  1I02 A;  1CHV S;  2CRS A;  2K3G A;  2MUP A;  4OM4 A;  1IK8 A;  2I9B E;  1KL8 A;  4FAO E;  4HQP F;  1UG4 A;  1W6B A;  1TXA A;  1KTZ B; 
#chains in the Genus database with same CATH homology
 1CDS A;  1B41 B;  3U74 U;  1IDI A;  4DO8 A;  2CRT A;  2QC1 A;  2X8B B;  1CCQ A;  1FAS A;  1RGJ A;  2N99 A;  2LA1 A;  1JGK A;  2UX2 A;  6EBX A;  1YWH A;  1KU6 B;  1COE A;  2CDX A;  2HLR A;  2PJY C;  1ERG A;  1FRA A;  1NEA A;  1FSS B;  4ZQY A;  1HOY A;  2H8U A;  1S4Y A;  5DZ5 A;  1ES7 B;  4BDT B;  1F8U B;  2H5F A;  1CDR A;  2MJY A;  1CTX A;  2MUO A;  2GOO C;  3QB4 B;  1TFS A;  2QJA C;  1LXH A;  4RUD A;  1FF4 A;  1QKE A;  4KSN A;  2BTX A;  1KC4 A;  1LX5 B;  1HAJ A;  2CTX A;  5IMT D;  1ABT A;  1CDQ A;  1QM7 A;  1LSI A;  2PJY B;  1RL5 A;  4QTI U;  1BXP A;  3KFD I;  1VB0 A;  1ZAD A;  5DO6 A;  4FAO C;  1LXG A;  2QJB C;  1MAH F;  2H7Z B;  2OFS A;  1FSC A;  2GOO B;  2H64 C;  1TXB A;  1BTE A;  1KXI A;  1NOR A;  1IDL A;  2ABX A;  2JQP A;  1NYS A;  1DRS A;  1IDG A;  4XJJ A;  1NXB A;  2CCX A;  1HC9 A;  4IYE A;  1REW C;  1JBD A;  3FEV A;  2L5S A;  1QKD A;  1ERA A;  2ERA A;  3BT1 U;  1KBT A;  2MFA A;  1H0J A;  1HAA A;  2MJ0 A;  2UWR A;  5DU1 A;  5IMY C;  4LFT A;  2NBT A;  4P7U A;  1G6M A;  1CDT A;  1TGX A;  2H64 B;  1V6P A;  1ONJ A;  2FD6 U;  1LJZ A;  2H62 C;  3EBX A;  4BIK B;  1FFJ A;  1CRE A;  2MJ4 A;  5EBX A;  1NTN A;  2L03 A;  1F94 A;  1KFH A;  1M9Z A;  1MR6 A;  2HLQ A;  4EY8 B;  2H62 D;  4AEA A;  1COD A;  2H7Z A;  1IJC A;  2VLW A;  3BT2 U;  3HH7 A;  1IKC A;  1KS6 A;  3KFD E;  3VTS A;  1L4W A;  1IDH A;  2MHY A;  3ERA A;  3NDS A;  2QJ9 C;  3NEQ A;  1XT3 A;  2LCR A;  1CVO A;  4UY2 C;  1HC9 B;  2BHI A;  1IQ9 A;  3U73 U;  2JVE A;  1KBS A;  3LAQ U;  1CXN A;  3PLC A;  1CXO A;  2J8B A;  1NYU A;  1NTX A;  3EVS C;  1JE9 A;  3NH7 A;  1KBA A;  1CB9 A;  1PLO A;  1CRF A;  4OM5 A;  1I02 A;  1CHV S;  2CRS A;  2K3G A;  2MUP A;  4OM4 A;  1IK8 A;  2I9B E;  1KL8 A;  4FAO E;  4HQP F;  1UG4 A;  1W6B A;  1TXA A;  1KTZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...