2PJYC

Structural basis for cooperative assembly of the tgf-beta signaling complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
79
structure length
79
Chain Sequence
ALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSSCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/cytokine receptor
molecule keywords Transforming growth factor beta-3
publication title Cooperative assembly of TGF-beta superfamily signaling complexes is mediated by two disparate mechanisms and distinct modes of receptor binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 79
sequence length 79
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2pjyC00
2UWRA 1QKDA 1NORA 3NDSA 4BIKB 1FFJA 1KBTA 1CVOA 1TXBA 2K3GA 1IDHA 1ABTA 1CB9A 2CRTA 2H5FA 2GOOB 1IJCA 1IDIA 2UX2A 4HQPF 1FASA 2OFSA 1ERGA 1IK8A 5IMTD 1UG4A 1NYSA 1I02A 1ERAA 2CRSA 1CXOA 1KU6B 2QJBC 1HAJA 1CRFA 2JQPA 2VLWA 2H8UA 2CDXA 2MFAA 1JBDA 1BXPA 1H0JA 3ERAA 1W6BA 1HC9B 4FAOE 2L03A 1IDGA 2H64B 3NEQA 1FRAA 2BHIA 3QB4B 4UY2C 1KFHA 3U74U 1CDTA 1IQ9A 2PJYC 1ES7B 4IYEA 1KBAA 2ABXA 3BT2U 3EBXA 1CTXA 3EVSC 1KXIA 1KBSA 1LX5B 1LXGA 4P7UA 1CDQA 1TGXA 5DU1A 5DZ5A 1COEA 1NTNA 3VTSA 2HLQA 2MJ0A 1NTXA 1RL5A 2HLRA 2QJAC 5IMYC 2JVEA 4XJJA 3U73U 1CODA 1NEAA 4DO8A 2MHYA 3HH7A 1KC4A 2QJ9C 3NH7A 2N99A 1MR6A 2GOOC 3BT1U 1LXHA 1REWC 4QTIU 1DRSA 2MJ4A 1B41B 2MJYA 2L5SA 4FAOC 1KS6A 1G6MA 1BTEA 1M9ZA 1L4WA 2MUOA 2X8BB 4RUDA 1XT3A 1QKEA 1FSCA 1HOYA 4OM5A 3FEVA 2LCRA 2CCXA 2H62C 1CDRA 1NXBA 1ZADA 1JGKA 2ERAA 1CXNA 2H7ZA 1F8UB 1IKCA 2H7ZB 1V6PA 2CTXA 1FF4A 4ZQYA 1LJZA 6EBXA 1KL8A 2NBTA 2FD6U 3KFDE 1S4YA 1ONJA 1IDLA 1F94A 1QM7A 1TXAA 3PLCA 1RGJA 1CCQA 1VB0A 1CHVS 4AEAA 1NYUA 3LAQU 2J8BA 1CDSA 1HAAA 2MUPA 4EY8B 2I9BE 1KTZB 5DO6A 1JE9A 1FSSB 1LSIA 1PLOA 2PJYB 3KFDI 1TFSA 4OM4A 4BDTB 1YWHA 1MAHF 2BTXA 4LFTA 2QC1A 1CREA 2H62D 2H64C 1HC9A 5EBXA 2LA1A
chains in the Genus database with same CATH superfamily
2UWRA 1QKDA 1NORA 3NDSA 4BIKB 1FFJA 1KBTA 1CVOA 1TXBA 2K3GA 1IDHA 1ABTA 1CB9A 2CRTA 2H5FA 2GOOB 1IJCA 1IDIA 2UX2A 4HQPF 1FASA 2OFSA 1ERGA 1IK8A 5IMTD 1UG4A 1NYSA 1I02A 1ERAA 2CRSA 1CXOA 1KU6B 2QJBC 1HAJA 1CRFA 2JQPA 2VLWA 2H8UA 2CDXA 2MFAA 1JBDA 1BXPA 1H0JA 3ERAA 1W6BA 1HC9B 4FAOE 2L03A 1IDGA 2H64B 3NEQA 1FRAA 2BHIA 3QB4B 4UY2C 1KFHA 3U74U 1CDTA 1IQ9A 2PJYC 1ES7B 4IYEA 1KBAA 2ABXA 3BT2U 3EBXA 1CTXA 3EVSC 1KXIA 1KBSA 1LX5B 1LXGA 4P7UA 1CDQA 1TGXA 5DU1A 5DZ5A 1COEA 1NTNA 3VTSA 2HLQA 2MJ0A 1NTXA 1RL5A 2HLRA 2QJAC 5IMYC 2JVEA 4XJJA 3U73U 1CODA 1NEAA 4DO8A 2MHYA 3HH7A 1KC4A 2QJ9C 3NH7A 2N99A 1MR6A 2GOOC 3BT1U 1LXHA 1REWC 4QTIU 1DRSA 2MJ4A 1B41B 2MJYA 2L5SA 4FAOC 1KS6A 1G6MA 1BTEA 1M9ZA 1L4WA 2MUOA 2X8BB 4RUDA 1XT3A 1QKEA 1FSCA 1HOYA 4OM5A 3FEVA 2LCRA 2CCXA 2H62C 1CDRA 1NXBA 1ZADA 1JGKA 2ERAA 1CXNA 2H7ZA 1F8UB 1IKCA 2H7ZB 1V6PA 2CTXA 1FF4A 4ZQYA 1LJZA 6EBXA 1KL8A 2NBTA 2FD6U 3KFDE 1S4YA 1ONJA 1IDLA 1F94A 1QM7A 1TXAA 3PLCA 1RGJA 1CCQA 1VB0A 1CHVS 4AEAA 1NYUA 3LAQU 2J8BA 1CDSA 1HAAA 2MUPA 4EY8B 2I9BE 1KTZB 5DO6A 1JE9A 1FSSB 1LSIA 1PLOA 2PJYB 3KFDI 1TFSA 4OM4A 4BDTB 1YWHA 1MAHF 2BTXA 4KSNA 4LFTA 2QC1A 1CREA 2H62D 2H64C 1HC9A 5EBXA 2LA1A
chains in the Genus database with same CATH topology
2UWRA 1QKDA 1NORA 3NDSA 4BIKB 1FFJA 1KBTA 1CVOA 1TXBA 2K3GA 1IDHA 1ABTA 1CB9A 2CRTA 2H5FA 2GOOB 1IJCA 1IDIA 2UX2A 4HQPF 1FASA 2OFSA 1ERGA 1IK8A 5IMTD 1UG4A 1NYSA 1I02A 1ERAA 2CRSA 1CXOA 1KU6B 2QJBC 1HAJA 1CRFA 2JQPA 2VLWA 2H8UA 2CDXA 2MFAA 1JBDA 1BXPA 1H0JA 3ERAA 1W6BA 1HC9B 4FAOE 2L03A 1IDGA 2H64B 3NEQA 1FRAA 2BHIA 3QB4B 4UY2C 1KFHA 3U74U 1CDTA 1IQ9A 2PJYC 1ES7B 4IYEA 1KBAA 2ABXA 3BT2U 3EBXA 1CTXA 3EVSC 1KXIA 1KBSA 1LX5B 1LXGA 4P7UA 1CDQA 1TGXA 5DU1A 5DZ5A 1COEA 1NTNA 3VTSA 2HLQA 2MJ0A 1NTXA 1RL5A 2HLRA 2QJAC 5IMYC 2JVEA 4XJJA 3U73U 1CODA 1NEAA 4DO8A 2MHYA 3HH7A 1KC4A 2QJ9C 3NH7A 2N99A 1MR6A 2GOOC 3BT1U 1LXHA 1REWC 4QTIU 1DRSA 2MJ4A 1B41B 2MJYA 2L5SA 4FAOC 1KS6A 1G6MA 1BTEA 1M9ZA 1L4WA 2MUOA 2X8BB 4RUDA 1XT3A 1QKEA 1FSCA 1HOYA 4OM5A 3FEVA 2LCRA 2CCXA 2H62C 1CDRA 1NXBA 1ZADA 1JGKA 2ERAA 1CXNA 2H7ZA 1F8UB 1IKCA 2H7ZB 1V6PA 2CTXA 1FF4A 4ZQYA 1LJZA 6EBXA 1KL8A 2NBTA 2FD6U 3KFDE 1S4YA 1ONJA 1IDLA 1F94A 1QM7A 1TXAA 3PLCA 1RGJA 1CCQA 1VB0A 1CHVS 4AEAA 1NYUA 3LAQU 2J8BA 1CDSA 1HAAA 2MUPA 4EY8B 2I9BE 1KTZB 5DO6A 1JE9A 1FSSB 1LSIA 1PLOA 2PJYB 3KFDI 1TFSA 4OM4A 4BDTB 1YWHA 1MAHF 2BTXA 4KSNA 4LFTA 2QC1A 1CREA 2H62D 2H64C 1HC9A 5EBXA 2LA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWR A;  1QKD A;  1NOR A;  3NDS A;  4BIK B;  1FFJ A;  1KBT A;  1CVO A;  1TXB A;  2K3G A;  1IDH A;  1ABT A;  1CB9 A;  2CRT A;  2H5F A;  2GOO B;  1IJC A;  1IDI A;  2UX2 A;  4HQP F;  1FAS A;  2OFS A;  1ERG A;  1IK8 A;  5IMT D;  1UG4 A;  1NYS A;  1I02 A;  1ERA A;  2CRS A;  1CXO A;  1KU6 B;  2QJB C;  1HAJ A;  1CRF A;  2JQP A;  2VLW A;  2H8U A;  2CDX A;  2MFA A;  1JBD A;  1BXP A;  1H0J A;  3ERA A;  1W6B A;  1HC9 B;  4FAO E;  2L03 A;  1IDG A;  2H64 B;  3NEQ A;  1FRA A;  2BHI A;  3QB4 B;  4UY2 C;  1KFH A;  3U74 U;  1CDT A;  1IQ9 A;  2PJY C;  1ES7 B;  4IYE A;  1KBA A;  2ABX A;  3BT2 U;  3EBX A;  1CTX A;  3EVS C;  1KXI A;  1KBS A;  1LX5 B;  1LXG A;  4P7U A;  1CDQ A;  1TGX A;  5DU1 A;  5DZ5 A;  1COE A;  1NTN A;  3VTS A;  2HLQ A;  2MJ0 A;  1NTX A;  1RL5 A;  2HLR A;  2QJA C;  5IMY C;  2JVE A;  4XJJ A;  3U73 U;  1COD A;  1NEA A;  4DO8 A;  2MHY A;  3HH7 A;  1KC4 A;  2QJ9 C;  3NH7 A;  2N99 A;  1MR6 A;  2GOO C;  3BT1 U;  1LXH A;  1REW C;  4QTI U;  1DRS A;  2MJ4 A;  1B41 B;  2MJY A;  2L5S A;  4FAO C;  1KS6 A;  1G6M A;  1BTE A;  1M9Z A;  1L4W A;  2MUO A;  2X8B B;  4RUD A;  1XT3 A;  1QKE A;  1FSC A;  1HOY A;  4OM5 A;  3FEV A;  2LCR A;  2CCX A;  2H62 C;  1CDR A;  1NXB A;  1ZAD A;  1JGK A;  2ERA A;  1CXN A;  2H7Z A;  1F8U B;  1IKC A;  2H7Z B;  1V6P A;  2CTX A;  1FF4 A;  4ZQY A;  1LJZ A;  6EBX A;  1KL8 A;  2NBT A;  2FD6 U;  3KFD E;  1S4Y A;  1ONJ A;  1IDL A;  1F94 A;  1QM7 A;  1TXA A;  3PLC A;  1RGJ A;  1CCQ A;  1VB0 A;  1CHV S;  4AEA A;  1NYU A;  3LAQ U;  2J8B A;  1CDS A;  1HAA A;  2MUP A;  4EY8 B;  2I9B E;  1KTZ B;  5DO6 A;  1JE9 A;  1FSS B;  1LSI A;  1PLO A;  2PJY B;  3KFD I;  1TFS A;  4OM4 A;  4BDT B;  1YWH A;  1MAH F;  2BTX A;  4LFT A;  2QC1 A;  1CRE A;  2H62 D;  2H64 C;  1HC9 A;  5EBX A;  2LA1 A; 
#chains in the Genus database with same CATH topology
 2UWR A;  1QKD A;  1NOR A;  3NDS A;  4BIK B;  1FFJ A;  1KBT A;  1CVO A;  1TXB A;  2K3G A;  1IDH A;  1ABT A;  1CB9 A;  2CRT A;  2H5F A;  2GOO B;  1IJC A;  1IDI A;  2UX2 A;  4HQP F;  1FAS A;  2OFS A;  1ERG A;  1IK8 A;  5IMT D;  1UG4 A;  1NYS A;  1I02 A;  1ERA A;  2CRS A;  1CXO A;  1KU6 B;  2QJB C;  1HAJ A;  1CRF A;  2JQP A;  2VLW A;  2H8U A;  2CDX A;  2MFA A;  1JBD A;  1BXP A;  1H0J A;  3ERA A;  1W6B A;  1HC9 B;  4FAO E;  2L03 A;  1IDG A;  2H64 B;  3NEQ A;  1FRA A;  2BHI A;  3QB4 B;  4UY2 C;  1KFH A;  3U74 U;  1CDT A;  1IQ9 A;  2PJY C;  1ES7 B;  4IYE A;  1KBA A;  2ABX A;  3BT2 U;  3EBX A;  1CTX A;  3EVS C;  1KXI A;  1KBS A;  1LX5 B;  1LXG A;  4P7U A;  1CDQ A;  1TGX A;  5DU1 A;  5DZ5 A;  1COE A;  1NTN A;  3VTS A;  2HLQ A;  2MJ0 A;  1NTX A;  1RL5 A;  2HLR A;  2QJA C;  5IMY C;  2JVE A;  4XJJ A;  3U73 U;  1COD A;  1NEA A;  4DO8 A;  2MHY A;  3HH7 A;  1KC4 A;  2QJ9 C;  3NH7 A;  2N99 A;  1MR6 A;  2GOO C;  3BT1 U;  1LXH A;  1REW C;  4QTI U;  1DRS A;  2MJ4 A;  1B41 B;  2MJY A;  2L5S A;  4FAO C;  1KS6 A;  1G6M A;  1BTE A;  1M9Z A;  1L4W A;  2MUO A;  2X8B B;  4RUD A;  1XT3 A;  1QKE A;  1FSC A;  1HOY A;  4OM5 A;  3FEV A;  2LCR A;  2CCX A;  2H62 C;  1CDR A;  1NXB A;  1ZAD A;  1JGK A;  2ERA A;  1CXN A;  2H7Z A;  1F8U B;  1IKC A;  2H7Z B;  1V6P A;  2CTX A;  1FF4 A;  4ZQY A;  1LJZ A;  6EBX A;  1KL8 A;  2NBT A;  2FD6 U;  3KFD E;  1S4Y A;  1ONJ A;  1IDL A;  1F94 A;  1QM7 A;  1TXA A;  3PLC A;  1RGJ A;  1CCQ A;  1VB0 A;  1CHV S;  4AEA A;  1NYU A;  3LAQ U;  2J8B A;  1CDS A;  1HAA A;  2MUP A;  4EY8 B;  2I9B E;  1KTZ B;  5DO6 A;  1JE9 A;  1FSS B;  1LSI A;  1PLO A;  2PJY B;  3KFD I;  1TFS A;  4OM4 A;  4BDT B;  1YWH A;  1MAH F;  2BTX A;  4KSN A;  4LFT A;  2QC1 A;  1CRE A;  2H62 D;  2H64 C;  1HC9 A;  5EBX A;  2LA1 A; 
#chains in the Genus database with same CATH homology
 2UWR A;  1QKD A;  1NOR A;  3NDS A;  4BIK B;  1FFJ A;  1KBT A;  1CVO A;  1TXB A;  2K3G A;  1IDH A;  1ABT A;  1CB9 A;  2CRT A;  2H5F A;  2GOO B;  1IJC A;  1IDI A;  2UX2 A;  4HQP F;  1FAS A;  2OFS A;  1ERG A;  1IK8 A;  5IMT D;  1UG4 A;  1NYS A;  1I02 A;  1ERA A;  2CRS A;  1CXO A;  1KU6 B;  2QJB C;  1HAJ A;  1CRF A;  2JQP A;  2VLW A;  2H8U A;  2CDX A;  2MFA A;  1JBD A;  1BXP A;  1H0J A;  3ERA A;  1W6B A;  1HC9 B;  4FAO E;  2L03 A;  1IDG A;  2H64 B;  3NEQ A;  1FRA A;  2BHI A;  3QB4 B;  4UY2 C;  1KFH A;  3U74 U;  1CDT A;  1IQ9 A;  2PJY C;  1ES7 B;  4IYE A;  1KBA A;  2ABX A;  3BT2 U;  3EBX A;  1CTX A;  3EVS C;  1KXI A;  1KBS A;  1LX5 B;  1LXG A;  4P7U A;  1CDQ A;  1TGX A;  5DU1 A;  5DZ5 A;  1COE A;  1NTN A;  3VTS A;  2HLQ A;  2MJ0 A;  1NTX A;  1RL5 A;  2HLR A;  2QJA C;  5IMY C;  2JVE A;  4XJJ A;  3U73 U;  1COD A;  1NEA A;  4DO8 A;  2MHY A;  3HH7 A;  1KC4 A;  2QJ9 C;  3NH7 A;  2N99 A;  1MR6 A;  2GOO C;  3BT1 U;  1LXH A;  1REW C;  4QTI U;  1DRS A;  2MJ4 A;  1B41 B;  2MJY A;  2L5S A;  4FAO C;  1KS6 A;  1G6M A;  1BTE A;  1M9Z A;  1L4W A;  2MUO A;  2X8B B;  4RUD A;  1XT3 A;  1QKE A;  1FSC A;  1HOY A;  4OM5 A;  3FEV A;  2LCR A;  2CCX A;  2H62 C;  1CDR A;  1NXB A;  1ZAD A;  1JGK A;  2ERA A;  1CXN A;  2H7Z A;  1F8U B;  1IKC A;  2H7Z B;  1V6P A;  2CTX A;  1FF4 A;  4ZQY A;  1LJZ A;  6EBX A;  1KL8 A;  2NBT A;  2FD6 U;  3KFD E;  1S4Y A;  1ONJ A;  1IDL A;  1F94 A;  1QM7 A;  1TXA A;  3PLC A;  1RGJ A;  1CCQ A;  1VB0 A;  1CHV S;  4AEA A;  1NYU A;  3LAQ U;  2J8B A;  1CDS A;  1HAA A;  2MUP A;  4EY8 B;  2I9B E;  1KTZ B;  5DO6 A;  1JE9 A;  1FSS B;  1LSI A;  1PLO A;  2PJY B;  3KFD I;  1TFS A;  4OM4 A;  4BDT B;  1YWH A;  1MAH F;  2BTX A;  4KSN A;  4LFT A;  2QC1 A;  1CRE A;  2H62 D;  2H64 C;  1HC9 A;  5EBX A;  2LA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...