1JE9A

Nmr solution structure of nt2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
61
structure length
61
Chain Sequence
LECHNQQSSQAPTTKTCSGETNCYKKWWSDHRGTIIERGCGCPKVKPGVNLNCCRTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHORT NEUROTOXIN II
publication title Structure-function relationship of three neurotoxins from the venom of Naja kaouthia: a comparison between the NMR-derived structure of NT2 with its homologues, NT1 and NT3
pubmed doi rcsb
molecule tags Toxin
total genus 7
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2001-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1je9A00
2ERAA 1KBTA 4FAOE 1FF4A 1LXGA 1KBAA 1HAJA 2CCXA 3EVSC 1KC4A 1G6MA 2L5SA 2QJAC 3KFDE 2QC1A 5DZ5A 1KBSA 1HOYA 1DRSA 2CRTA 1FSCA 2GOOB 4OM5A 2MJ0A 1CTXA 1JBDA 2H7ZB 1TFSA 2FD6U 2MUOA 2CDXA 2H62C 2J8BA 1L4WA 5DO6A 1YWHA 1IKCA 2K3GA 3NDSA 1CXNA 1NTXA 1NORA 1ERGA 3LAQU 1IDHA 2H8UA 1HAAA 2ABXA 1FFJA 1ONJA 1LX5B 1IQ9A 2LA1A 2I9BE 1HC9B 2QJ9C 4HQPF 2MUPA 1CREA 1CDQA 2H64C 1ZADA 1CVOA 1F94A 1XT3A 2H64B 1MR6A 1PLOA 4DO8A 2JVEA 1F8UB 1RGJA 3ERAA 2HLQA 2H5FA 4UY2C 1M9ZA 1CDRA 2CTXA 6EBXA 2QJBC 2L03A 1LJZA 1TGXA 2H7ZA 1TXBA 1QKEA 2UWRA 1UG4A 1CB9A 1FSSB 1NTNA 4XJJA 1MAHF 2CRSA 1LSIA 1ERAA 1IDLA 1CODA 1ES7B 1IDIA 1REWC 3U73U 3U74U 2MFAA 2VLWA 1CXOA 5EBXA 3HH7A 4RUDA 1HC9A 1JE9A 3VTSA 4FAOC 3BT2U 1H0JA 1V6PA 1KFHA 4ZQYA 2H62D 2JQPA 1CRFA 1CDSA 5IMYC 1IJCA 4BDTB 1BTEA 2MHYA 2NBTA 2PJYC 4P7UA 5DU1A 1S4YA 2BTXA 1W6BA 1LXHA 2MJ4A 4EY8B 1ABTA 3EBXA 2PJYB 5IMTD 1VB0A 1KS6A 1NXBA 1KXIA 1NYSA 3PLCA 2OFSA 2GOOC 2UX2A 2X8BB 2N99A 2HLRA 1IDGA 1BXPA 1I02A 1KU6B 4AEAA 3KFDI 3FEVA 1B41B 1COEA 3BT1U 4OM4A 1RL5A 3NEQA 4QTIU 1CDTA 1KTZB 1TXAA 1QM7A 3QB4B 1NEAA 2MJYA 2LCRA 1FRAA 4IYEA 1JGKA 1CHVS 1NYUA 1FASA 3NH7A 1CCQA 1QKDA 4LFTA 1IK8A 4BIKB 2BHIA 1KL8A
chains in the Genus database with same CATH superfamily
2ERAA 1KBTA 4FAOE 1FF4A 1LXGA 1KBAA 1HAJA 2CCXA 3EVSC 1KC4A 1G6MA 2L5SA 2QJAC 3KFDE 2QC1A 5DZ5A 1KBSA 1HOYA 1DRSA 2CRTA 1FSCA 2GOOB 4OM5A 2MJ0A 1CTXA 1JBDA 2H7ZB 1TFSA 2FD6U 2MUOA 2CDXA 2H62C 2J8BA 1L4WA 5DO6A 1YWHA 1IKCA 2K3GA 3NDSA 1CXNA 1NTXA 1NORA 1ERGA 3LAQU 1IDHA 2H8UA 1HAAA 2ABXA 1FFJA 1ONJA 1LX5B 1IQ9A 2LA1A 2I9BE 1HC9B 2QJ9C 4HQPF 2MUPA 1CREA 1CDQA 2H64C 1ZADA 1CVOA 1F94A 1XT3A 2H64B 1MR6A 1PLOA 4DO8A 2JVEA 1F8UB 1RGJA 3ERAA 2HLQA 2H5FA 4UY2C 1M9ZA 1CDRA 2CTXA 6EBXA 2QJBC 2L03A 1LJZA 1TGXA 2H7ZA 1TXBA 1QKEA 2UWRA 1UG4A 1CB9A 1FSSB 1NTNA 4XJJA 1MAHF 2CRSA 1LSIA 1ERAA 1IDLA 1CODA 1ES7B 1IDIA 1REWC 3U73U 3U74U 2MFAA 2VLWA 1CXOA 5EBXA 3HH7A 4RUDA 1HC9A 1JE9A 3VTSA 4FAOC 4KSNA 3BT2U 1H0JA 1V6PA 1KFHA 4ZQYA 2H62D 2JQPA 1CRFA 1CDSA 5IMYC 1IJCA 4BDTB 1BTEA 2MHYA 2NBTA 2PJYC 4P7UA 5DU1A 1S4YA 2BTXA 1W6BA 1LXHA 2MJ4A 4EY8B 1ABTA 3EBXA 2PJYB 5IMTD 1VB0A 1KS6A 1NXBA 1KXIA 1NYSA 3PLCA 2OFSA 2GOOC 2UX2A 2X8BB 2N99A 2HLRA 1IDGA 1BXPA 1I02A 1KU6B 4AEAA 3KFDI 3FEVA 1B41B 1COEA 3BT1U 4OM4A 1RL5A 3NEQA 4QTIU 1CDTA 1KTZB 1TXAA 1QM7A 3QB4B 1NEAA 2MJYA 2LCRA 1FRAA 4IYEA 1JGKA 1CHVS 1NYUA 1FASA 3NH7A 1CCQA 1QKDA 4LFTA 1IK8A 4BIKB 2BHIA 1KL8A
chains in the Genus database with same CATH topology
2ERAA 1KBTA 4FAOE 1FF4A 1LXGA 1KBAA 1HAJA 2CCXA 3EVSC 1KC4A 1G6MA 2L5SA 2QJAC 3KFDE 2QC1A 5DZ5A 1KBSA 1HOYA 1DRSA 2CRTA 1FSCA 2GOOB 4OM5A 2MJ0A 1CTXA 1JBDA 2H7ZB 1TFSA 2FD6U 2MUOA 2CDXA 2H62C 2J8BA 1L4WA 5DO6A 1YWHA 1IKCA 2K3GA 3NDSA 1CXNA 1NTXA 1NORA 1ERGA 3LAQU 1IDHA 2H8UA 1HAAA 2ABXA 1FFJA 1ONJA 1LX5B 1IQ9A 2LA1A 2I9BE 1HC9B 2QJ9C 4HQPF 2MUPA 1CREA 1CDQA 2H64C 1ZADA 1CVOA 1F94A 1XT3A 2H64B 1MR6A 1PLOA 4DO8A 2JVEA 1F8UB 1RGJA 3ERAA 2HLQA 2H5FA 4UY2C 1M9ZA 1CDRA 2CTXA 6EBXA 2QJBC 2L03A 1LJZA 1TGXA 2H7ZA 1TXBA 1QKEA 2UWRA 1UG4A 1CB9A 1FSSB 1NTNA 4XJJA 1MAHF 2CRSA 1LSIA 1ERAA 1IDLA 1CODA 1ES7B 1IDIA 1REWC 3U73U 3U74U 2MFAA 2VLWA 1CXOA 5EBXA 3HH7A 4RUDA 1HC9A 1JE9A 3VTSA 4FAOC 4KSNA 3BT2U 1H0JA 1V6PA 1KFHA 4ZQYA 2H62D 2JQPA 1CRFA 1CDSA 5IMYC 1IJCA 4BDTB 1BTEA 2MHYA 2NBTA 2PJYC 4P7UA 5DU1A 1S4YA 2BTXA 1W6BA 1LXHA 2MJ4A 4EY8B 1ABTA 3EBXA 2PJYB 5IMTD 1VB0A 1KS6A 1NXBA 1KXIA 1NYSA 3PLCA 2OFSA 2GOOC 2UX2A 2X8BB 2N99A 2HLRA 1IDGA 1BXPA 1I02A 1KU6B 4AEAA 3KFDI 3FEVA 1B41B 1COEA 3BT1U 4OM4A 1RL5A 3NEQA 4QTIU 1CDTA 1KTZB 1TXAA 1QM7A 3QB4B 1NEAA 2MJYA 2LCRA 1FRAA 4IYEA 1JGKA 1CHVS 1NYUA 1FASA 3NH7A 1CCQA 1QKDA 4LFTA 1IK8A 4BIKB 2BHIA 1KL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERA A;  1KBT A;  4FAO E;  1FF4 A;  1LXG A;  1KBA A;  1HAJ A;  2CCX A;  3EVS C;  1KC4 A;  1G6M A;  2L5S A;  2QJA C;  3KFD E;  2QC1 A;  5DZ5 A;  1KBS A;  1HOY A;  1DRS A;  2CRT A;  1FSC A;  2GOO B;  4OM5 A;  2MJ0 A;  1CTX A;  1JBD A;  2H7Z B;  1TFS A;  2FD6 U;  2MUO A;  2CDX A;  2H62 C;  2J8B A;  1L4W A;  5DO6 A;  1YWH A;  1IKC A;  2K3G A;  3NDS A;  1CXN A;  1NTX A;  1NOR A;  1ERG A;  3LAQ U;  1IDH A;  2H8U A;  1HAA A;  2ABX A;  1FFJ A;  1ONJ A;  1LX5 B;  1IQ9 A;  2LA1 A;  2I9B E;  1HC9 B;  2QJ9 C;  4HQP F;  2MUP A;  1CRE A;  1CDQ A;  2H64 C;  1ZAD A;  1CVO A;  1F94 A;  1XT3 A;  2H64 B;  1MR6 A;  1PLO A;  4DO8 A;  2JVE A;  1F8U B;  1RGJ A;  3ERA A;  2HLQ A;  2H5F A;  4UY2 C;  1M9Z A;  1CDR A;  2CTX A;  6EBX A;  2QJB C;  2L03 A;  1LJZ A;  1TGX A;  2H7Z A;  1TXB A;  1QKE A;  2UWR A;  1UG4 A;  1CB9 A;  1FSS B;  1NTN A;  4XJJ A;  1MAH F;  2CRS A;  1LSI A;  1ERA A;  1IDL A;  1COD A;  1ES7 B;  1IDI A;  1REW C;  3U73 U;  3U74 U;  2MFA A;  2VLW A;  1CXO A;  5EBX A;  3HH7 A;  4RUD A;  1HC9 A;  1JE9 A;  3VTS A;  4FAO C;  3BT2 U;  1H0J A;  1V6P A;  1KFH A;  4ZQY A;  2H62 D;  2JQP A;  1CRF A;  1CDS A;  5IMY C;  1IJC A;  4BDT B;  1BTE A;  2MHY A;  2NBT A;  2PJY C;  4P7U A;  5DU1 A;  1S4Y A;  2BTX A;  1W6B A;  1LXH A;  2MJ4 A;  4EY8 B;  1ABT A;  3EBX A;  2PJY B;  5IMT D;  1VB0 A;  1KS6 A;  1NXB A;  1KXI A;  1NYS A;  3PLC A;  2OFS A;  2GOO C;  2UX2 A;  2X8B B;  2N99 A;  2HLR A;  1IDG A;  1BXP A;  1I02 A;  1KU6 B;  4AEA A;  3KFD I;  3FEV A;  1B41 B;  1COE A;  3BT1 U;  4OM4 A;  1RL5 A;  3NEQ A;  4QTI U;  1CDT A;  1KTZ B;  1TXA A;  1QM7 A;  3QB4 B;  1NEA A;  2MJY A;  2LCR A;  1FRA A;  4IYE A;  1JGK A;  1CHV S;  1NYU A;  1FAS A;  3NH7 A;  1CCQ A;  1QKD A;  4LFT A;  1IK8 A;  4BIK B;  2BHI A;  1KL8 A; 
#chains in the Genus database with same CATH topology
 2ERA A;  1KBT A;  4FAO E;  1FF4 A;  1LXG A;  1KBA A;  1HAJ A;  2CCX A;  3EVS C;  1KC4 A;  1G6M A;  2L5S A;  2QJA C;  3KFD E;  2QC1 A;  5DZ5 A;  1KBS A;  1HOY A;  1DRS A;  2CRT A;  1FSC A;  2GOO B;  4OM5 A;  2MJ0 A;  1CTX A;  1JBD A;  2H7Z B;  1TFS A;  2FD6 U;  2MUO A;  2CDX A;  2H62 C;  2J8B A;  1L4W A;  5DO6 A;  1YWH A;  1IKC A;  2K3G A;  3NDS A;  1CXN A;  1NTX A;  1NOR A;  1ERG A;  3LAQ U;  1IDH A;  2H8U A;  1HAA A;  2ABX A;  1FFJ A;  1ONJ A;  1LX5 B;  1IQ9 A;  2LA1 A;  2I9B E;  1HC9 B;  2QJ9 C;  4HQP F;  2MUP A;  1CRE A;  1CDQ A;  2H64 C;  1ZAD A;  1CVO A;  1F94 A;  1XT3 A;  2H64 B;  1MR6 A;  1PLO A;  4DO8 A;  2JVE A;  1F8U B;  1RGJ A;  3ERA A;  2HLQ A;  2H5F A;  4UY2 C;  1M9Z A;  1CDR A;  2CTX A;  6EBX A;  2QJB C;  2L03 A;  1LJZ A;  1TGX A;  2H7Z A;  1TXB A;  1QKE A;  2UWR A;  1UG4 A;  1CB9 A;  1FSS B;  1NTN A;  4XJJ A;  1MAH F;  2CRS A;  1LSI A;  1ERA A;  1IDL A;  1COD A;  1ES7 B;  1IDI A;  1REW C;  3U73 U;  3U74 U;  2MFA A;  2VLW A;  1CXO A;  5EBX A;  3HH7 A;  4RUD A;  1HC9 A;  1JE9 A;  3VTS A;  4FAO C;  4KSN A;  3BT2 U;  1H0J A;  1V6P A;  1KFH A;  4ZQY A;  2H62 D;  2JQP A;  1CRF A;  1CDS A;  5IMY C;  1IJC A;  4BDT B;  1BTE A;  2MHY A;  2NBT A;  2PJY C;  4P7U A;  5DU1 A;  1S4Y A;  2BTX A;  1W6B A;  1LXH A;  2MJ4 A;  4EY8 B;  1ABT A;  3EBX A;  2PJY B;  5IMT D;  1VB0 A;  1KS6 A;  1NXB A;  1KXI A;  1NYS A;  3PLC A;  2OFS A;  2GOO C;  2UX2 A;  2X8B B;  2N99 A;  2HLR A;  1IDG A;  1BXP A;  1I02 A;  1KU6 B;  4AEA A;  3KFD I;  3FEV A;  1B41 B;  1COE A;  3BT1 U;  4OM4 A;  1RL5 A;  3NEQ A;  4QTI U;  1CDT A;  1KTZ B;  1TXA A;  1QM7 A;  3QB4 B;  1NEA A;  2MJY A;  2LCR A;  1FRA A;  4IYE A;  1JGK A;  1CHV S;  1NYU A;  1FAS A;  3NH7 A;  1CCQ A;  1QKD A;  4LFT A;  1IK8 A;  4BIK B;  2BHI A;  1KL8 A; 
#chains in the Genus database with same CATH homology
 2ERA A;  1KBT A;  4FAO E;  1FF4 A;  1LXG A;  1KBA A;  1HAJ A;  2CCX A;  3EVS C;  1KC4 A;  1G6M A;  2L5S A;  2QJA C;  3KFD E;  2QC1 A;  5DZ5 A;  1KBS A;  1HOY A;  1DRS A;  2CRT A;  1FSC A;  2GOO B;  4OM5 A;  2MJ0 A;  1CTX A;  1JBD A;  2H7Z B;  1TFS A;  2FD6 U;  2MUO A;  2CDX A;  2H62 C;  2J8B A;  1L4W A;  5DO6 A;  1YWH A;  1IKC A;  2K3G A;  3NDS A;  1CXN A;  1NTX A;  1NOR A;  1ERG A;  3LAQ U;  1IDH A;  2H8U A;  1HAA A;  2ABX A;  1FFJ A;  1ONJ A;  1LX5 B;  1IQ9 A;  2LA1 A;  2I9B E;  1HC9 B;  2QJ9 C;  4HQP F;  2MUP A;  1CRE A;  1CDQ A;  2H64 C;  1ZAD A;  1CVO A;  1F94 A;  1XT3 A;  2H64 B;  1MR6 A;  1PLO A;  4DO8 A;  2JVE A;  1F8U B;  1RGJ A;  3ERA A;  2HLQ A;  2H5F A;  4UY2 C;  1M9Z A;  1CDR A;  2CTX A;  6EBX A;  2QJB C;  2L03 A;  1LJZ A;  1TGX A;  2H7Z A;  1TXB A;  1QKE A;  2UWR A;  1UG4 A;  1CB9 A;  1FSS B;  1NTN A;  4XJJ A;  1MAH F;  2CRS A;  1LSI A;  1ERA A;  1IDL A;  1COD A;  1ES7 B;  1IDI A;  1REW C;  3U73 U;  3U74 U;  2MFA A;  2VLW A;  1CXO A;  5EBX A;  3HH7 A;  4RUD A;  1HC9 A;  1JE9 A;  3VTS A;  4FAO C;  4KSN A;  3BT2 U;  1H0J A;  1V6P A;  1KFH A;  4ZQY A;  2H62 D;  2JQP A;  1CRF A;  1CDS A;  5IMY C;  1IJC A;  4BDT B;  1BTE A;  2MHY A;  2NBT A;  2PJY C;  4P7U A;  5DU1 A;  1S4Y A;  2BTX A;  1W6B A;  1LXH A;  2MJ4 A;  4EY8 B;  1ABT A;  3EBX A;  2PJY B;  5IMT D;  1VB0 A;  1KS6 A;  1NXB A;  1KXI A;  1NYS A;  3PLC A;  2OFS A;  2GOO C;  2UX2 A;  2X8B B;  2N99 A;  2HLR A;  1IDG A;  1BXP A;  1I02 A;  1KU6 B;  4AEA A;  3KFD I;  3FEV A;  1B41 B;  1COE A;  3BT1 U;  4OM4 A;  1RL5 A;  3NEQ A;  4QTI U;  1CDT A;  1KTZ B;  1TXA A;  1QM7 A;  3QB4 B;  1NEA A;  2MJY A;  2LCR A;  1FRA A;  4IYE A;  1JGK A;  1CHV S;  1NYU A;  1FAS A;  3NH7 A;  1CCQ A;  1QKD A;  4LFT A;  1IK8 A;  4BIK B;  2BHI A;  1KL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...