1JE9A

Nmr solution structure of nt2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
61
structure length
61
Chain Sequence
LECHNQQSSQAPTTKTCSGETNCYKKWWSDHRGTIIERGCGCPKVKPGVNLNCCRTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords SHORT NEUROTOXIN II
publication title Structure-function relationship of three neurotoxins from the venom of Naja kaouthia: a comparison between the NMR-derived structure of NT2 with its homologues, NT1 and NT3
pubmed doi rcsb
total genus 7
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2001-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1je9A00
1JBDA 1NTXA 3BT1U 1CB9A 1IKCA 2H5FA 1CDRA 1FSCA 1COEA 3FEVA 3NDSA 4HQPF 4ZQYA 2MHYA 1QKEA 1IQ9A 2X8BB 1V6PA 1LJZA 2GOOB 2I9BE 2QJBC 2CTXA 1CTXA 2H62C 2JVEA 2UX2A 5EBXA 5IMYC 1XT3A 1REWC 3PLCA 1CRFA 1FASA 3HH7A 2CRTA 3U74U 1RL5A 1FF4A 6EBXA 1ONJA 3KFDE 5DO6A 4AEAA 1L4WA 2JQPA 4DO8A 1LSIA 1CVOA 1YWHA 1BTEA 3U73U 1LXGA 2L5SA 1HC9B 1IDGA 1QKDA 2NBTA 1FRAA 4LFTA 1CDSA 1M9ZA 1G6MA 2H64C 3QB4B 3NH7A 2N99A 1KL8A 2CDXA 3ERAA 1KS6A 1NORA 1CDTA 1FSSB 3VTSA 2H7ZA 2ABXA 1HOYA 1KC4A 2LA1A 2MUOA 2LCRA 4OM5A 3EVSC 1NYSA 1S4YA 1TFSA 2BHIA 1I02A 1KFHA 1IDHA 4FAOC 2BTXA 1TXAA 1PLOA 1F8UB 2PJYC 1CODA 2J8BA 1ERGA 4P7UA 1KTZB 1CDQA 4UY2C 4OM4A 1IJCA 4QTIU 2K3GA 2CCXA 2H62D 2QJAC 1NTNA 1ERAA 1VB0A 3BT2U 2HLRA 2OFSA 4XJJA 4RUDA 1BXPA 1FFJA 1H0JA 1LXHA 2ERAA 1ES7B 1HAAA 1JE9A 1LX5B 1DRSA 1JGKA 5DZ5A 1IDLA 4FAOE 2H64B 1HAJA 4BDTB 1CHVS 1KXIA 2H8UA 5IMTD 2VLWA 1MAHF 1MR6A 4EY8B 1NYUA 1QM7A 2MUPA 1CXOA 1KU6B 1CXNA 3EBXA 2HLQA 1RGJA 2GOOC 2PJYB 1HC9A 1IK8A 1UG4A 1KBSA 2H7ZB 2L03A 1KBTA 2MJ4A 3KFDI 2QJ9C 1ZADA 4IYEA 1TGXA 2FD6U 1CREA 2CRSA 2MFAA 2MJYA 3NEQA 1KBAA 5DU1A 1NEAA 2MJ0A 1CCQA 1B41B 1F94A 4BIKB 2UWRA 1NXBA 2QC1A 1IDIA 1W6BA 3LAQU 1TXBA 1ABTA
chains in the Genus database with same CATH superfamily
1JBDA 4KSNA 1NTXA 3BT1U 1CB9A 1IKCA 2H5FA 1CDRA 1FSCA 1COEA 3FEVA 3NDSA 4HQPF 4ZQYA 2MHYA 1QKEA 1IQ9A 2X8BB 1V6PA 1LJZA 2GOOB 2I9BE 2QJBC 2CTXA 1CTXA 2H62C 2JVEA 2UX2A 5EBXA 5IMYC 1XT3A 1REWC 3PLCA 1CRFA 1FASA 3HH7A 2CRTA 3U74U 1RL5A 1FF4A 6EBXA 1ONJA 3KFDE 5DO6A 4AEAA 1L4WA 2JQPA 4DO8A 1LSIA 1CVOA 1YWHA 1BTEA 3U73U 1LXGA 2L5SA 1HC9B 1IDGA 1QKDA 2NBTA 1FRAA 4LFTA 1CDSA 1M9ZA 1G6MA 2H64C 3QB4B 3NH7A 2N99A 1KL8A 2CDXA 3ERAA 1KS6A 1NORA 1CDTA 1FSSB 3VTSA 2H7ZA 2ABXA 1HOYA 1KC4A 2LA1A 2MUOA 2LCRA 4OM5A 3EVSC 1NYSA 1S4YA 1TFSA 2BHIA 1I02A 1KFHA 1IDHA 4FAOC 2BTXA 1TXAA 1PLOA 1F8UB 2PJYC 1CODA 2J8BA 1ERGA 4P7UA 1KTZB 1CDQA 4UY2C 4OM4A 1IJCA 4QTIU 2K3GA 2CCXA 2H62D 2QJAC 1NTNA 1ERAA 1VB0A 3BT2U 2HLRA 2OFSA 4XJJA 4RUDA 1BXPA 1FFJA 1H0JA 1LXHA 2ERAA 1ES7B 1HAAA 1JE9A 1LX5B 1DRSA 1JGKA 5DZ5A 1IDLA 4FAOE 2H64B 1HAJA 4BDTB 1CHVS 1KXIA 2H8UA 5IMTD 2VLWA 1MAHF 1MR6A 4EY8B 1NYUA 1QM7A 2MUPA 1CXOA 1KU6B 1CXNA 3EBXA 2HLQA 1RGJA 2GOOC 2PJYB 1HC9A 1IK8A 1UG4A 1KBSA 2H7ZB 2L03A 1KBTA 2MJ4A 3KFDI 2QJ9C 1ZADA 4IYEA 1TGXA 2FD6U 1CREA 2CRSA 2MFAA 2MJYA 3NEQA 1KBAA 5DU1A 1NEAA 2MJ0A 1CCQA 1B41B 1F94A 4BIKB 2UWRA 1NXBA 2QC1A 1IDIA 1W6BA 3LAQU 1TXBA 1ABTA
chains in the Genus database with same CATH topology
1JBDA 4KSNA 1NTXA 3BT1U 1CB9A 1IKCA 2H5FA 1CDRA 1FSCA 1COEA 3FEVA 3NDSA 4HQPF 4ZQYA 2MHYA 1QKEA 1IQ9A 2X8BB 1V6PA 1LJZA 2GOOB 2I9BE 2QJBC 2CTXA 1CTXA 2H62C 2JVEA 2UX2A 5EBXA 5IMYC 1XT3A 1REWC 3PLCA 1CRFA 1FASA 3HH7A 2CRTA 3U74U 1RL5A 1FF4A 6EBXA 1ONJA 3KFDE 5DO6A 4AEAA 1L4WA 2JQPA 4DO8A 1LSIA 1CVOA 1YWHA 1BTEA 3U73U 1LXGA 2L5SA 1HC9B 1IDGA 1QKDA 2NBTA 1FRAA 4LFTA 1CDSA 1M9ZA 1G6MA 2H64C 3QB4B 3NH7A 2N99A 1KL8A 2CDXA 3ERAA 1KS6A 1NORA 1CDTA 1FSSB 3VTSA 2H7ZA 2ABXA 1HOYA 1KC4A 2LA1A 2MUOA 2LCRA 4OM5A 3EVSC 1NYSA 1S4YA 1TFSA 2BHIA 1I02A 1KFHA 1IDHA 4FAOC 2BTXA 1TXAA 1PLOA 1F8UB 2PJYC 1CODA 2J8BA 1ERGA 4P7UA 1KTZB 1CDQA 4UY2C 4OM4A 1IJCA 4QTIU 2K3GA 2CCXA 2H62D 2QJAC 1NTNA 1ERAA 1VB0A 3BT2U 2HLRA 2OFSA 4XJJA 4RUDA 1BXPA 1FFJA 1H0JA 1LXHA 2ERAA 1ES7B 1HAAA 1JE9A 1LX5B 1DRSA 1JGKA 5DZ5A 1IDLA 4FAOE 2H64B 1HAJA 4BDTB 1CHVS 1KXIA 2H8UA 5IMTD 2VLWA 1MAHF 1MR6A 4EY8B 1NYUA 1QM7A 2MUPA 1CXOA 1KU6B 1CXNA 3EBXA 2HLQA 1RGJA 2GOOC 2PJYB 1HC9A 1IK8A 1UG4A 1KBSA 2H7ZB 2L03A 1KBTA 2MJ4A 3KFDI 2QJ9C 1ZADA 4IYEA 1TGXA 2FD6U 1CREA 2CRSA 2MFAA 2MJYA 3NEQA 1KBAA 5DU1A 1NEAA 2MJ0A 1CCQA 1B41B 1F94A 4BIKB 2UWRA 1NXBA 2QC1A 1IDIA 1W6BA 3LAQU 1TXBA 1ABTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JBD A;  1NTX A;  3BT1 U;  1CB9 A;  1IKC A;  2H5F A;  1CDR A;  1FSC A;  1COE A;  3FEV A;  3NDS A;  4HQP F;  4ZQY A;  2MHY A;  1QKE A;  1IQ9 A;  2X8B B;  1V6P A;  1LJZ A;  2GOO B;  2I9B E;  2QJB C;  2CTX A;  1CTX A;  2H62 C;  2JVE A;  2UX2 A;  5EBX A;  5IMY C;  1XT3 A;  1REW C;  3PLC A;  1CRF A;  1FAS A;  3HH7 A;  2CRT A;  3U74 U;  1RL5 A;  1FF4 A;  6EBX A;  1ONJ A;  3KFD E;  5DO6 A;  4AEA A;  1L4W A;  2JQP A;  4DO8 A;  1LSI A;  1CVO A;  1YWH A;  1BTE A;  3U73 U;  1LXG A;  2L5S A;  1HC9 B;  1IDG A;  1QKD A;  2NBT A;  1FRA A;  4LFT A;  1CDS A;  1M9Z A;  1G6M A;  2H64 C;  3QB4 B;  3NH7 A;  2N99 A;  1KL8 A;  2CDX A;  3ERA A;  1KS6 A;  1NOR A;  1CDT A;  1FSS B;  3VTS A;  2H7Z A;  2ABX A;  1HOY A;  1KC4 A;  2LA1 A;  2MUO A;  2LCR A;  4OM5 A;  3EVS C;  1NYS A;  1S4Y A;  1TFS A;  2BHI A;  1I02 A;  1KFH A;  1IDH A;  4FAO C;  2BTX A;  1TXA A;  1PLO A;  1F8U B;  2PJY C;  1COD A;  2J8B A;  1ERG A;  4P7U A;  1KTZ B;  1CDQ A;  4UY2 C;  4OM4 A;  1IJC A;  4QTI U;  2K3G A;  2CCX A;  2H62 D;  2QJA C;  1NTN A;  1ERA A;  1VB0 A;  3BT2 U;  2HLR A;  2OFS A;  4XJJ A;  4RUD A;  1BXP A;  1FFJ A;  1H0J A;  1LXH A;  2ERA A;  1ES7 B;  1HAA A;  1JE9 A;  1LX5 B;  1DRS A;  1JGK A;  5DZ5 A;  1IDL A;  4FAO E;  2H64 B;  1HAJ A;  4BDT B;  1CHV S;  1KXI A;  2H8U A;  5IMT D;  2VLW A;  1MAH F;  1MR6 A;  4EY8 B;  1NYU A;  1QM7 A;  2MUP A;  1CXO A;  1KU6 B;  1CXN A;  3EBX A;  2HLQ A;  1RGJ A;  2GOO C;  2PJY B;  1HC9 A;  1IK8 A;  1UG4 A;  1KBS A;  2H7Z B;  2L03 A;  1KBT A;  2MJ4 A;  3KFD I;  2QJ9 C;  1ZAD A;  4IYE A;  1TGX A;  2FD6 U;  1CRE A;  2CRS A;  2MFA A;  2MJY A;  3NEQ A;  1KBA A;  5DU1 A;  1NEA A;  2MJ0 A;  1CCQ A;  1B41 B;  1F94 A;  4BIK B;  2UWR A;  1NXB A;  2QC1 A;  1IDI A;  1W6B A;  3LAQ U;  1TXB A;  1ABT A; 
#chains in the Genus database with same CATH topology
 1JBD A;  4KSN A;  1NTX A;  3BT1 U;  1CB9 A;  1IKC A;  2H5F A;  1CDR A;  1FSC A;  1COE A;  3FEV A;  3NDS A;  4HQP F;  4ZQY A;  2MHY A;  1QKE A;  1IQ9 A;  2X8B B;  1V6P A;  1LJZ A;  2GOO B;  2I9B E;  2QJB C;  2CTX A;  1CTX A;  2H62 C;  2JVE A;  2UX2 A;  5EBX A;  5IMY C;  1XT3 A;  1REW C;  3PLC A;  1CRF A;  1FAS A;  3HH7 A;  2CRT A;  3U74 U;  1RL5 A;  1FF4 A;  6EBX A;  1ONJ A;  3KFD E;  5DO6 A;  4AEA A;  1L4W A;  2JQP A;  4DO8 A;  1LSI A;  1CVO A;  1YWH A;  1BTE A;  3U73 U;  1LXG A;  2L5S A;  1HC9 B;  1IDG A;  1QKD A;  2NBT A;  1FRA A;  4LFT A;  1CDS A;  1M9Z A;  1G6M A;  2H64 C;  3QB4 B;  3NH7 A;  2N99 A;  1KL8 A;  2CDX A;  3ERA A;  1KS6 A;  1NOR A;  1CDT A;  1FSS B;  3VTS A;  2H7Z A;  2ABX A;  1HOY A;  1KC4 A;  2LA1 A;  2MUO A;  2LCR A;  4OM5 A;  3EVS C;  1NYS A;  1S4Y A;  1TFS A;  2BHI A;  1I02 A;  1KFH A;  1IDH A;  4FAO C;  2BTX A;  1TXA A;  1PLO A;  1F8U B;  2PJY C;  1COD A;  2J8B A;  1ERG A;  4P7U A;  1KTZ B;  1CDQ A;  4UY2 C;  4OM4 A;  1IJC A;  4QTI U;  2K3G A;  2CCX A;  2H62 D;  2QJA C;  1NTN A;  1ERA A;  1VB0 A;  3BT2 U;  2HLR A;  2OFS A;  4XJJ A;  4RUD A;  1BXP A;  1FFJ A;  1H0J A;  1LXH A;  2ERA A;  1ES7 B;  1HAA A;  1JE9 A;  1LX5 B;  1DRS A;  1JGK A;  5DZ5 A;  1IDL A;  4FAO E;  2H64 B;  1HAJ A;  4BDT B;  1CHV S;  1KXI A;  2H8U A;  5IMT D;  2VLW A;  1MAH F;  1MR6 A;  4EY8 B;  1NYU A;  1QM7 A;  2MUP A;  1CXO A;  1KU6 B;  1CXN A;  3EBX A;  2HLQ A;  1RGJ A;  2GOO C;  2PJY B;  1HC9 A;  1IK8 A;  1UG4 A;  1KBS A;  2H7Z B;  2L03 A;  1KBT A;  2MJ4 A;  3KFD I;  2QJ9 C;  1ZAD A;  4IYE A;  1TGX A;  2FD6 U;  1CRE A;  2CRS A;  2MFA A;  2MJY A;  3NEQ A;  1KBA A;  5DU1 A;  1NEA A;  2MJ0 A;  1CCQ A;  1B41 B;  1F94 A;  4BIK B;  2UWR A;  1NXB A;  2QC1 A;  1IDI A;  1W6B A;  3LAQ U;  1TXB A;  1ABT A; 
#chains in the Genus database with same CATH homology
 1JBD A;  4KSN A;  1NTX A;  3BT1 U;  1CB9 A;  1IKC A;  2H5F A;  1CDR A;  1FSC A;  1COE A;  3FEV A;  3NDS A;  4HQP F;  4ZQY A;  2MHY A;  1QKE A;  1IQ9 A;  2X8B B;  1V6P A;  1LJZ A;  2GOO B;  2I9B E;  2QJB C;  2CTX A;  1CTX A;  2H62 C;  2JVE A;  2UX2 A;  5EBX A;  5IMY C;  1XT3 A;  1REW C;  3PLC A;  1CRF A;  1FAS A;  3HH7 A;  2CRT A;  3U74 U;  1RL5 A;  1FF4 A;  6EBX A;  1ONJ A;  3KFD E;  5DO6 A;  4AEA A;  1L4W A;  2JQP A;  4DO8 A;  1LSI A;  1CVO A;  1YWH A;  1BTE A;  3U73 U;  1LXG A;  2L5S A;  1HC9 B;  1IDG A;  1QKD A;  2NBT A;  1FRA A;  4LFT A;  1CDS A;  1M9Z A;  1G6M A;  2H64 C;  3QB4 B;  3NH7 A;  2N99 A;  1KL8 A;  2CDX A;  3ERA A;  1KS6 A;  1NOR A;  1CDT A;  1FSS B;  3VTS A;  2H7Z A;  2ABX A;  1HOY A;  1KC4 A;  2LA1 A;  2MUO A;  2LCR A;  4OM5 A;  3EVS C;  1NYS A;  1S4Y A;  1TFS A;  2BHI A;  1I02 A;  1KFH A;  1IDH A;  4FAO C;  2BTX A;  1TXA A;  1PLO A;  1F8U B;  2PJY C;  1COD A;  2J8B A;  1ERG A;  4P7U A;  1KTZ B;  1CDQ A;  4UY2 C;  4OM4 A;  1IJC A;  4QTI U;  2K3G A;  2CCX A;  2H62 D;  2QJA C;  1NTN A;  1ERA A;  1VB0 A;  3BT2 U;  2HLR A;  2OFS A;  4XJJ A;  4RUD A;  1BXP A;  1FFJ A;  1H0J A;  1LXH A;  2ERA A;  1ES7 B;  1HAA A;  1JE9 A;  1LX5 B;  1DRS A;  1JGK A;  5DZ5 A;  1IDL A;  4FAO E;  2H64 B;  1HAJ A;  4BDT B;  1CHV S;  1KXI A;  2H8U A;  5IMT D;  2VLW A;  1MAH F;  1MR6 A;  4EY8 B;  1NYU A;  1QM7 A;  2MUP A;  1CXO A;  1KU6 B;  1CXN A;  3EBX A;  2HLQ A;  1RGJ A;  2GOO C;  2PJY B;  1HC9 A;  1IK8 A;  1UG4 A;  1KBS A;  2H7Z B;  2L03 A;  1KBT A;  2MJ4 A;  3KFD I;  2QJ9 C;  1ZAD A;  4IYE A;  1TGX A;  2FD6 U;  1CRE A;  2CRS A;  2MFA A;  2MJY A;  3NEQ A;  1KBA A;  5DU1 A;  1NEA A;  2MJ0 A;  1CCQ A;  1B41 B;  1F94 A;  4BIK B;  2UWR A;  1NXB A;  2QC1 A;  1IDI A;  1W6B A;  3LAQ U;  1TXB A;  1ABT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...