1CDRA

Structure of a soluble, glycosylated form of the human complement regulatory protein cd59
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
77
structure length
77
Chain Sequence
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD59
publication title Structure of a soluble, glycosylated form of the human complement regulatory protein CD59.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complement regulatory protein
total genus 5
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1994-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1cdrA00
4IYEA 1KC4A 1ONJA 1YWHA 1HAJA 1S4YA 1ZADA 2I9BE 1KTZB 2CDXA 2N99A 4QTIU 3VTSA 3NDSA 2PJYC 2OFSA 1CHVS 1CXNA 1CDQA 1RL5A 1IDGA 1FRAA 1ES7B 1RGJA 2L03A 3QB4B 1IQ9A 4RUDA 1FF4A 1KBTA 1HC9B 2QJ9C 4BIKB 3FEVA 1CCQA 1CRFA 2QJBC 1JBDA 1KBSA 1JGKA 2MJ4A 1KBAA 2MFAA 4ZQYA 1BXPA 5IMYC 1LX5B 1COEA 1NTNA 1BTEA 1DRSA 2CRSA 1CDTA 1LXGA 2MJYA 4XJJA 1QKEA 2MUOA 1TXBA 3NEQA 5IMTD 1NYUA 1IK8A 1LXHA 1CXOA 1JE9A 1HOYA 1IDHA 5EBXA 1F94A 1PLOA 1TFSA 1CB9A 1QM7A 1KU6B 2JQPA 3NH7A 3LAQU 1NORA 4DO8A 4FAOE 1IDLA 4EY8B 2ABXA 1LSIA 2H62C 1CREA 6EBXA 1VB0A 2VLWA 1H0JA 3KFDI 1MR6A 1REWC 2HLRA 3BT1U 2BHIA 3HH7A 2H5FA 1W6BA 1ERAA 1ABTA 4AEAA 2UX2A 1TXAA 2ERAA 2X8BB 2CCXA 1LJZA 2MHYA 4LFTA 2FD6U 3U73U 1CDRA 1L4WA 4P7UA 1G6MA 2GOOB 2H64B 1FSSB 3U74U 1XT3A 1M9ZA 2H7ZA 1TGXA 3ERAA 3EVSC 1CTXA 5DZ5A 3PLCA 4UY2C 2MJ0A 2CRTA 2H7ZB 2NBTA 1FASA 1IKCA 1NYSA 2LA1A 2H62D 1MAHF 2JVEA 3KFDE 1KFHA 1F8UB 4OM5A 1IJCA 2GOOC 2H64C 1B41B 2J8BA 1IDIA 1ERGA 1KL8A 1HC9A 1QKDA 4FAOC 2HLQA 1V6PA 1NTXA 2BTXA 2QJAC 1FSCA 2H8UA 1CVOA 2CTXA 1CODA 2UWRA 2MUPA 2QC1A 5DU1A 3BT2U 2PJYB 2K3GA 1NXBA 4OM4A 1I02A 1UG4A 3EBXA 1KS6A 2L5SA 1NEAA 4BDTB 2LCRA 4HQPF 1HAAA 1FFJA 1KXIA 1CDSA 5DO6A
chains in the Genus database with same CATH superfamily
4IYEA 1KC4A 1ONJA 1YWHA 1HAJA 1S4YA 1ZADA 2I9BE 1KTZB 2CDXA 2N99A 4QTIU 3VTSA 3NDSA 2PJYC 2OFSA 1CHVS 1CXNA 1CDQA 1RL5A 1IDGA 1FRAA 1ES7B 1RGJA 2L03A 3QB4B 1IQ9A 4RUDA 1FF4A 1KBTA 1HC9B 2QJ9C 4BIKB 3FEVA 1CCQA 1CRFA 2QJBC 1JBDA 1KBSA 1JGKA 2MJ4A 1KBAA 2MFAA 4ZQYA 1BXPA 5IMYC 1LX5B 1COEA 1NTNA 1BTEA 1DRSA 2CRSA 1CDTA 1LXGA 2MJYA 4XJJA 1QKEA 2MUOA 1TXBA 3NEQA 5IMTD 1NYUA 1IK8A 1LXHA 1CXOA 1JE9A 1HOYA 1IDHA 5EBXA 1F94A 1PLOA 1TFSA 1CB9A 1QM7A 1KU6B 2JQPA 3NH7A 3LAQU 1NORA 4DO8A 4FAOE 1IDLA 4EY8B 2ABXA 1LSIA 2H62C 1CREA 6EBXA 1VB0A 2VLWA 1H0JA 3KFDI 1MR6A 1REWC 2HLRA 3BT1U 2BHIA 3HH7A 2H5FA 1W6BA 1ERAA 1ABTA 4AEAA 2UX2A 1TXAA 2ERAA 2X8BB 2CCXA 1LJZA 2MHYA 4LFTA 2FD6U 3U73U 1CDRA 1L4WA 4P7UA 1G6MA 2GOOB 2H64B 1FSSB 3U74U 1XT3A 1M9ZA 2H7ZA 1TGXA 3ERAA 3EVSC 1CTXA 4KSNA 5DZ5A 3PLCA 4UY2C 2MJ0A 2CRTA 2H7ZB 2NBTA 1FASA 1IKCA 1NYSA 2LA1A 2H62D 1MAHF 2JVEA 3KFDE 1KFHA 1F8UB 4OM5A 1IJCA 2GOOC 2H64C 1B41B 2J8BA 1IDIA 1ERGA 1KL8A 1HC9A 1QKDA 4FAOC 2HLQA 1V6PA 1NTXA 2BTXA 2QJAC 1FSCA 2H8UA 1CVOA 2CTXA 1CODA 2UWRA 2MUPA 2QC1A 5DU1A 3BT2U 2PJYB 2K3GA 1NXBA 4OM4A 1I02A 1UG4A 3EBXA 1KS6A 2L5SA 1NEAA 4BDTB 2LCRA 4HQPF 1HAAA 1FFJA 1KXIA 1CDSA 5DO6A
chains in the Genus database with same CATH topology
4IYEA 1KC4A 1ONJA 1YWHA 1HAJA 1S4YA 1ZADA 2I9BE 1KTZB 2CDXA 2N99A 4QTIU 3VTSA 3NDSA 2PJYC 2OFSA 1CHVS 1CXNA 1CDQA 1RL5A 1IDGA 1FRAA 1ES7B 1RGJA 2L03A 3QB4B 1IQ9A 4RUDA 1FF4A 1KBTA 1HC9B 2QJ9C 4BIKB 3FEVA 1CCQA 1CRFA 2QJBC 1JBDA 1KBSA 1JGKA 2MJ4A 1KBAA 2MFAA 4ZQYA 1BXPA 5IMYC 1LX5B 1COEA 1NTNA 1BTEA 1DRSA 2CRSA 1CDTA 1LXGA 2MJYA 4XJJA 1QKEA 2MUOA 1TXBA 3NEQA 5IMTD 1NYUA 1IK8A 1LXHA 1CXOA 1JE9A 1HOYA 1IDHA 5EBXA 1F94A 1PLOA 1TFSA 1CB9A 1QM7A 1KU6B 2JQPA 3NH7A 3LAQU 1NORA 4DO8A 4FAOE 1IDLA 4EY8B 2ABXA 1LSIA 2H62C 1CREA 6EBXA 1VB0A 2VLWA 1H0JA 3KFDI 1MR6A 1REWC 2HLRA 3BT1U 2BHIA 3HH7A 2H5FA 1W6BA 1ERAA 1ABTA 4AEAA 2UX2A 1TXAA 2ERAA 2X8BB 2CCXA 1LJZA 2MHYA 4LFTA 2FD6U 3U73U 1CDRA 1L4WA 4P7UA 1G6MA 2GOOB 2H64B 1FSSB 3U74U 1XT3A 1M9ZA 2H7ZA 1TGXA 3ERAA 3EVSC 1CTXA 4KSNA 5DZ5A 3PLCA 4UY2C 2MJ0A 2CRTA 2H7ZB 2NBTA 1FASA 1IKCA 1NYSA 2LA1A 2H62D 1MAHF 2JVEA 3KFDE 1KFHA 1F8UB 4OM5A 1IJCA 2GOOC 2H64C 1B41B 2J8BA 1IDIA 1ERGA 1KL8A 1HC9A 1QKDA 4FAOC 2HLQA 1V6PA 1NTXA 2BTXA 2QJAC 1FSCA 2H8UA 1CVOA 2CTXA 1CODA 2UWRA 2MUPA 2QC1A 5DU1A 3BT2U 2PJYB 2K3GA 1NXBA 4OM4A 1I02A 1UG4A 3EBXA 1KS6A 2L5SA 1NEAA 4BDTB 2LCRA 4HQPF 1HAAA 1FFJA 1KXIA 1CDSA 5DO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IYE A;  1KC4 A;  1ONJ A;  1YWH A;  1HAJ A;  1S4Y A;  1ZAD A;  2I9B E;  1KTZ B;  2CDX A;  2N99 A;  4QTI U;  3VTS A;  3NDS A;  2PJY C;  2OFS A;  1CHV S;  1CXN A;  1CDQ A;  1RL5 A;  1IDG A;  1FRA A;  1ES7 B;  1RGJ A;  2L03 A;  3QB4 B;  1IQ9 A;  4RUD A;  1FF4 A;  1KBT A;  1HC9 B;  2QJ9 C;  4BIK B;  3FEV A;  1CCQ A;  1CRF A;  2QJB C;  1JBD A;  1KBS A;  1JGK A;  2MJ4 A;  1KBA A;  2MFA A;  4ZQY A;  1BXP A;  5IMY C;  1LX5 B;  1COE A;  1NTN A;  1BTE A;  1DRS A;  2CRS A;  1CDT A;  1LXG A;  2MJY A;  4XJJ A;  1QKE A;  2MUO A;  1TXB A;  3NEQ A;  5IMT D;  1NYU A;  1IK8 A;  1LXH A;  1CXO A;  1JE9 A;  1HOY A;  1IDH A;  5EBX A;  1F94 A;  1PLO A;  1TFS A;  1CB9 A;  1QM7 A;  1KU6 B;  2JQP A;  3NH7 A;  3LAQ U;  1NOR A;  4DO8 A;  4FAO E;  1IDL A;  4EY8 B;  2ABX A;  1LSI A;  2H62 C;  1CRE A;  6EBX A;  1VB0 A;  2VLW A;  1H0J A;  3KFD I;  1MR6 A;  1REW C;  2HLR A;  3BT1 U;  2BHI A;  3HH7 A;  2H5F A;  1W6B A;  1ERA A;  1ABT A;  4AEA A;  2UX2 A;  1TXA A;  2ERA A;  2X8B B;  2CCX A;  1LJZ A;  2MHY A;  4LFT A;  2FD6 U;  3U73 U;  1CDR A;  1L4W A;  4P7U A;  1G6M A;  2GOO B;  2H64 B;  1FSS B;  3U74 U;  1XT3 A;  1M9Z A;  2H7Z A;  1TGX A;  3ERA A;  3EVS C;  1CTX A;  5DZ5 A;  3PLC A;  4UY2 C;  2MJ0 A;  2CRT A;  2H7Z B;  2NBT A;  1FAS A;  1IKC A;  1NYS A;  2LA1 A;  2H62 D;  1MAH F;  2JVE A;  3KFD E;  1KFH A;  1F8U B;  4OM5 A;  1IJC A;  2GOO C;  2H64 C;  1B41 B;  2J8B A;  1IDI A;  1ERG A;  1KL8 A;  1HC9 A;  1QKD A;  4FAO C;  2HLQ A;  1V6P A;  1NTX A;  2BTX A;  2QJA C;  1FSC A;  2H8U A;  1CVO A;  2CTX A;  1COD A;  2UWR A;  2MUP A;  2QC1 A;  5DU1 A;  3BT2 U;  2PJY B;  2K3G A;  1NXB A;  4OM4 A;  1I02 A;  1UG4 A;  3EBX A;  1KS6 A;  2L5S A;  1NEA A;  4BDT B;  2LCR A;  4HQP F;  1HAA A;  1FFJ A;  1KXI A;  1CDS A;  5DO6 A; 
#chains in the Genus database with same CATH topology
 4IYE A;  1KC4 A;  1ONJ A;  1YWH A;  1HAJ A;  1S4Y A;  1ZAD A;  2I9B E;  1KTZ B;  2CDX A;  2N99 A;  4QTI U;  3VTS A;  3NDS A;  2PJY C;  2OFS A;  1CHV S;  1CXN A;  1CDQ A;  1RL5 A;  1IDG A;  1FRA A;  1ES7 B;  1RGJ A;  2L03 A;  3QB4 B;  1IQ9 A;  4RUD A;  1FF4 A;  1KBT A;  1HC9 B;  2QJ9 C;  4BIK B;  3FEV A;  1CCQ A;  1CRF A;  2QJB C;  1JBD A;  1KBS A;  1JGK A;  2MJ4 A;  1KBA A;  2MFA A;  4ZQY A;  1BXP A;  5IMY C;  1LX5 B;  1COE A;  1NTN A;  1BTE A;  1DRS A;  2CRS A;  1CDT A;  1LXG A;  2MJY A;  4XJJ A;  1QKE A;  2MUO A;  1TXB A;  3NEQ A;  5IMT D;  1NYU A;  1IK8 A;  1LXH A;  1CXO A;  1JE9 A;  1HOY A;  1IDH A;  5EBX A;  1F94 A;  1PLO A;  1TFS A;  1CB9 A;  1QM7 A;  1KU6 B;  2JQP A;  3NH7 A;  3LAQ U;  1NOR A;  4DO8 A;  4FAO E;  1IDL A;  4EY8 B;  2ABX A;  1LSI A;  2H62 C;  1CRE A;  6EBX A;  1VB0 A;  2VLW A;  1H0J A;  3KFD I;  1MR6 A;  1REW C;  2HLR A;  3BT1 U;  2BHI A;  3HH7 A;  2H5F A;  1W6B A;  1ERA A;  1ABT A;  4AEA A;  2UX2 A;  1TXA A;  2ERA A;  2X8B B;  2CCX A;  1LJZ A;  2MHY A;  4LFT A;  2FD6 U;  3U73 U;  1CDR A;  1L4W A;  4P7U A;  1G6M A;  2GOO B;  2H64 B;  1FSS B;  3U74 U;  1XT3 A;  1M9Z A;  2H7Z A;  1TGX A;  3ERA A;  3EVS C;  1CTX A;  4KSN A;  5DZ5 A;  3PLC A;  4UY2 C;  2MJ0 A;  2CRT A;  2H7Z B;  2NBT A;  1FAS A;  1IKC A;  1NYS A;  2LA1 A;  2H62 D;  1MAH F;  2JVE A;  3KFD E;  1KFH A;  1F8U B;  4OM5 A;  1IJC A;  2GOO C;  2H64 C;  1B41 B;  2J8B A;  1IDI A;  1ERG A;  1KL8 A;  1HC9 A;  1QKD A;  4FAO C;  2HLQ A;  1V6P A;  1NTX A;  2BTX A;  2QJA C;  1FSC A;  2H8U A;  1CVO A;  2CTX A;  1COD A;  2UWR A;  2MUP A;  2QC1 A;  5DU1 A;  3BT2 U;  2PJY B;  2K3G A;  1NXB A;  4OM4 A;  1I02 A;  1UG4 A;  3EBX A;  1KS6 A;  2L5S A;  1NEA A;  4BDT B;  2LCR A;  4HQP F;  1HAA A;  1FFJ A;  1KXI A;  1CDS A;  5DO6 A; 
#chains in the Genus database with same CATH homology
 4IYE A;  1KC4 A;  1ONJ A;  1YWH A;  1HAJ A;  1S4Y A;  1ZAD A;  2I9B E;  1KTZ B;  2CDX A;  2N99 A;  4QTI U;  3VTS A;  3NDS A;  2PJY C;  2OFS A;  1CHV S;  1CXN A;  1CDQ A;  1RL5 A;  1IDG A;  1FRA A;  1ES7 B;  1RGJ A;  2L03 A;  3QB4 B;  1IQ9 A;  4RUD A;  1FF4 A;  1KBT A;  1HC9 B;  2QJ9 C;  4BIK B;  3FEV A;  1CCQ A;  1CRF A;  2QJB C;  1JBD A;  1KBS A;  1JGK A;  2MJ4 A;  1KBA A;  2MFA A;  4ZQY A;  1BXP A;  5IMY C;  1LX5 B;  1COE A;  1NTN A;  1BTE A;  1DRS A;  2CRS A;  1CDT A;  1LXG A;  2MJY A;  4XJJ A;  1QKE A;  2MUO A;  1TXB A;  3NEQ A;  5IMT D;  1NYU A;  1IK8 A;  1LXH A;  1CXO A;  1JE9 A;  1HOY A;  1IDH A;  5EBX A;  1F94 A;  1PLO A;  1TFS A;  1CB9 A;  1QM7 A;  1KU6 B;  2JQP A;  3NH7 A;  3LAQ U;  1NOR A;  4DO8 A;  4FAO E;  1IDL A;  4EY8 B;  2ABX A;  1LSI A;  2H62 C;  1CRE A;  6EBX A;  1VB0 A;  2VLW A;  1H0J A;  3KFD I;  1MR6 A;  1REW C;  2HLR A;  3BT1 U;  2BHI A;  3HH7 A;  2H5F A;  1W6B A;  1ERA A;  1ABT A;  4AEA A;  2UX2 A;  1TXA A;  2ERA A;  2X8B B;  2CCX A;  1LJZ A;  2MHY A;  4LFT A;  2FD6 U;  3U73 U;  1CDR A;  1L4W A;  4P7U A;  1G6M A;  2GOO B;  2H64 B;  1FSS B;  3U74 U;  1XT3 A;  1M9Z A;  2H7Z A;  1TGX A;  3ERA A;  3EVS C;  1CTX A;  4KSN A;  5DZ5 A;  3PLC A;  4UY2 C;  2MJ0 A;  2CRT A;  2H7Z B;  2NBT A;  1FAS A;  1IKC A;  1NYS A;  2LA1 A;  2H62 D;  1MAH F;  2JVE A;  3KFD E;  1KFH A;  1F8U B;  4OM5 A;  1IJC A;  2GOO C;  2H64 C;  1B41 B;  2J8B A;  1IDI A;  1ERG A;  1KL8 A;  1HC9 A;  1QKD A;  4FAO C;  2HLQ A;  1V6P A;  1NTX A;  2BTX A;  2QJA C;  1FSC A;  2H8U A;  1CVO A;  2CTX A;  1COD A;  2UWR A;  2MUP A;  2QC1 A;  5DU1 A;  3BT2 U;  2PJY B;  2K3G A;  1NXB A;  4OM4 A;  1I02 A;  1UG4 A;  3EBX A;  1KS6 A;  2L5S A;  1NEA A;  4BDT B;  2LCR A;  4HQP F;  1HAA A;  1FFJ A;  1KXI A;  1CDS A;  5DO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...