1CDRA

Structure of a soluble, glycosylated form of the human complement regulatory protein cd59
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
77
structure length
77
Chain Sequence
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a soluble, glycosylated form of the human complement regulatory protein CD59.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complement regulatory protein
molecule keywords CD59
total genus 5
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1994-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1cdrA00
2CTXA 1KBSA 2J8BA 3NDSA 1FFJA 1NXBA 2H5FA 4BIKB 1IDGA 4FAOC 1BXPA 1CDRA 2X8BB 3U74U 1NORA 1KL8A 3ERAA 1CDQA 1COEA 1CHVS 1KBAA 4HQPF 4UY2C 5EBXA 1ERAA 1HAJA 1LXGA 4RUDA 1PLOA 3KFDI 2BHIA 3BT1U 2QJAC 1FSSB 3EVSC 4P7UA 1IJCA 1NYUA 2NBTA 2BTXA 2CRTA 2N99A 1KC4A 1KU6B 2H8UA 4EY8B 2MFAA 2H64C 2QJ9C 1ABTA 1UG4A 3NH7A 1ONJA 1TFSA 4QTIU 1JE9A 2HLQA 1DRSA 5DO6A 1IDHA 2CCXA 1I02A 2PJYC 2MJYA 1IQ9A 3LAQU 1B41B 1M9ZA 3VTSA 1VB0A 2OFSA 4OM5A 1KTZB 4AEAA 6EBXA 2LA1A 1CDTA 3BT2U 4LFTA 2CRSA 1QKDA 1IDLA 3QB4B 2VLWA 2CDXA 1CDSA 1BTEA 2H7ZA 3FEVA 4BDTB 2GOOC 1RL5A 2H64B 1F8UB 1CRFA 2L5SA 1MR6A 5IMYC 4ZQYA 1CTXA 1QM7A 1HC9A 1NEAA 2JQPA 1W6BA 1TGXA 2UX2A 1LJZA 1YWHA 1FF4A 1CXNA 1FASA 1CB9A 1CODA 2MUOA 1JGKA 1KXIA 1NTXA 1FSCA 2H62C 1HAAA 4IYEA 1H0JA 1LSIA 1S4YA 2HLRA 4DO8A 1REWC 2GOOB 1MAHF 2ERAA 1FRAA 1XT3A 1G6MA 2QC1A 2LCRA 1CVOA 1F94A 1TXBA 1KS6A 1CCQA 1KBTA 2QJBC 2I9BE 2MUPA 1RGJA 2H62D 1QKEA 2FD6U 4FAOE 1CREA 2PJYB 5DU1A 1TXAA 1JBDA 5IMTD 1ZADA 3HH7A 3KFDE 2MHYA 2ABXA 1IK8A 2MJ0A 3NEQA 4OM4A 2UWRA 1LXHA 3PLCA 1ES7B 1NTNA 1IKCA 5DZ5A 1HOYA 1CXOA 3U73U 2JVEA 1ERGA 2K3GA 1NYSA 1IDIA 2H7ZB 4XJJA 2MJ4A 1KFHA 3EBXA 1L4WA 1LX5B 1V6PA 1HC9B 2L03A
chains in the Genus database with same CATH superfamily
2CTXA 1KBSA 2J8BA 3NDSA 1FFJA 1NXBA 2H5FA 4BIKB 1IDGA 4FAOC 1BXPA 1CDRA 2X8BB 3U74U 1NORA 1KL8A 3ERAA 1CDQA 1COEA 1CHVS 1KBAA 4HQPF 4UY2C 5EBXA 1ERAA 1HAJA 1LXGA 4RUDA 1PLOA 3KFDI 2BHIA 3BT1U 2QJAC 1FSSB 3EVSC 4P7UA 1IJCA 1NYUA 2NBTA 2BTXA 2CRTA 2N99A 4KSNA 1KC4A 1KU6B 2H8UA 4EY8B 2MFAA 2H64C 2QJ9C 1ABTA 1UG4A 3NH7A 1ONJA 1TFSA 4QTIU 1JE9A 2HLQA 1DRSA 5DO6A 1IDHA 2CCXA 1I02A 2PJYC 2MJYA 1IQ9A 3LAQU 1B41B 1M9ZA 3VTSA 1VB0A 2OFSA 4OM5A 1KTZB 4AEAA 6EBXA 2LA1A 1CDTA 3BT2U 4LFTA 2CRSA 1QKDA 1IDLA 3QB4B 2VLWA 2CDXA 1CDSA 1BTEA 2H7ZA 3FEVA 4BDTB 2GOOC 1RL5A 2H64B 1F8UB 1CRFA 2L5SA 1MR6A 5IMYC 4ZQYA 1CTXA 1QM7A 1HC9A 1NEAA 2JQPA 1W6BA 1TGXA 2UX2A 1LJZA 1YWHA 1FF4A 1CXNA 1FASA 1CB9A 1CODA 2MUOA 1JGKA 1KXIA 1NTXA 1FSCA 2H62C 1HAAA 4IYEA 1H0JA 1LSIA 1S4YA 2HLRA 4DO8A 1REWC 2GOOB 1MAHF 2ERAA 1FRAA 1XT3A 1G6MA 2QC1A 2LCRA 1CVOA 1F94A 1TXBA 1KS6A 1CCQA 1KBTA 2QJBC 2I9BE 2MUPA 1RGJA 2H62D 1QKEA 2FD6U 4FAOE 1CREA 2PJYB 5DU1A 1TXAA 1JBDA 5IMTD 1ZADA 3HH7A 3KFDE 2MHYA 2ABXA 1IK8A 2MJ0A 3NEQA 4OM4A 2UWRA 1LXHA 3PLCA 1ES7B 1NTNA 1IKCA 5DZ5A 1HOYA 1CXOA 3U73U 2JVEA 1ERGA 2K3GA 1NYSA 1IDIA 2H7ZB 4XJJA 2MJ4A 1KFHA 3EBXA 1L4WA 1LX5B 1V6PA 1HC9B 2L03A
chains in the Genus database with same CATH topology
2CTXA 1KBSA 2J8BA 3NDSA 1FFJA 1NXBA 2H5FA 4BIKB 1IDGA 4FAOC 1BXPA 1CDRA 2X8BB 3U74U 1NORA 1KL8A 3ERAA 1CDQA 1COEA 1CHVS 1KBAA 4HQPF 4UY2C 5EBXA 1ERAA 1HAJA 1LXGA 4RUDA 1PLOA 3KFDI 2BHIA 3BT1U 2QJAC 1FSSB 3EVSC 4P7UA 1IJCA 1NYUA 2NBTA 2BTXA 2CRTA 2N99A 4KSNA 1KC4A 1KU6B 2H8UA 4EY8B 2MFAA 2H64C 2QJ9C 1ABTA 1UG4A 3NH7A 1ONJA 1TFSA 4QTIU 1JE9A 2HLQA 1DRSA 5DO6A 1IDHA 2CCXA 1I02A 2PJYC 2MJYA 1IQ9A 3LAQU 1B41B 1M9ZA 3VTSA 1VB0A 2OFSA 4OM5A 1KTZB 4AEAA 6EBXA 2LA1A 1CDTA 3BT2U 4LFTA 2CRSA 1QKDA 1IDLA 3QB4B 2VLWA 2CDXA 1CDSA 1BTEA 2H7ZA 3FEVA 4BDTB 2GOOC 1RL5A 2H64B 1F8UB 1CRFA 2L5SA 1MR6A 5IMYC 4ZQYA 1CTXA 1QM7A 1HC9A 1NEAA 2JQPA 1W6BA 1TGXA 2UX2A 1LJZA 1YWHA 1FF4A 1CXNA 1FASA 1CB9A 1CODA 2MUOA 1JGKA 1KXIA 1NTXA 1FSCA 2H62C 1HAAA 4IYEA 1H0JA 1LSIA 1S4YA 2HLRA 4DO8A 1REWC 2GOOB 1MAHF 2ERAA 1FRAA 1XT3A 1G6MA 2QC1A 2LCRA 1CVOA 1F94A 1TXBA 1KS6A 1CCQA 1KBTA 2QJBC 2I9BE 2MUPA 1RGJA 2H62D 1QKEA 2FD6U 4FAOE 1CREA 2PJYB 5DU1A 1TXAA 1JBDA 5IMTD 1ZADA 3HH7A 3KFDE 2MHYA 2ABXA 1IK8A 2MJ0A 3NEQA 4OM4A 2UWRA 1LXHA 3PLCA 1ES7B 1NTNA 1IKCA 5DZ5A 1HOYA 1CXOA 3U73U 2JVEA 1ERGA 2K3GA 1NYSA 1IDIA 2H7ZB 4XJJA 2MJ4A 1KFHA 3EBXA 1L4WA 1LX5B 1V6PA 1HC9B 2L03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTX A;  1KBS A;  2J8B A;  3NDS A;  1FFJ A;  1NXB A;  2H5F A;  4BIK B;  1IDG A;  4FAO C;  1BXP A;  1CDR A;  2X8B B;  3U74 U;  1NOR A;  1KL8 A;  3ERA A;  1CDQ A;  1COE A;  1CHV S;  1KBA A;  4HQP F;  4UY2 C;  5EBX A;  1ERA A;  1HAJ A;  1LXG A;  4RUD A;  1PLO A;  3KFD I;  2BHI A;  3BT1 U;  2QJA C;  1FSS B;  3EVS C;  4P7U A;  1IJC A;  1NYU A;  2NBT A;  2BTX A;  2CRT A;  2N99 A;  1KC4 A;  1KU6 B;  2H8U A;  4EY8 B;  2MFA A;  2H64 C;  2QJ9 C;  1ABT A;  1UG4 A;  3NH7 A;  1ONJ A;  1TFS A;  4QTI U;  1JE9 A;  2HLQ A;  1DRS A;  5DO6 A;  1IDH A;  2CCX A;  1I02 A;  2PJY C;  2MJY A;  1IQ9 A;  3LAQ U;  1B41 B;  1M9Z A;  3VTS A;  1VB0 A;  2OFS A;  4OM5 A;  1KTZ B;  4AEA A;  6EBX A;  2LA1 A;  1CDT A;  3BT2 U;  4LFT A;  2CRS A;  1QKD A;  1IDL A;  3QB4 B;  2VLW A;  2CDX A;  1CDS A;  1BTE A;  2H7Z A;  3FEV A;  4BDT B;  2GOO C;  1RL5 A;  2H64 B;  1F8U B;  1CRF A;  2L5S A;  1MR6 A;  5IMY C;  4ZQY A;  1CTX A;  1QM7 A;  1HC9 A;  1NEA A;  2JQP A;  1W6B A;  1TGX A;  2UX2 A;  1LJZ A;  1YWH A;  1FF4 A;  1CXN A;  1FAS A;  1CB9 A;  1COD A;  2MUO A;  1JGK A;  1KXI A;  1NTX A;  1FSC A;  2H62 C;  1HAA A;  4IYE A;  1H0J A;  1LSI A;  1S4Y A;  2HLR A;  4DO8 A;  1REW C;  2GOO B;  1MAH F;  2ERA A;  1FRA A;  1XT3 A;  1G6M A;  2QC1 A;  2LCR A;  1CVO A;  1F94 A;  1TXB A;  1KS6 A;  1CCQ A;  1KBT A;  2QJB C;  2I9B E;  2MUP A;  1RGJ A;  2H62 D;  1QKE A;  2FD6 U;  4FAO E;  1CRE A;  2PJY B;  5DU1 A;  1TXA A;  1JBD A;  5IMT D;  1ZAD A;  3HH7 A;  3KFD E;  2MHY A;  2ABX A;  1IK8 A;  2MJ0 A;  3NEQ A;  4OM4 A;  2UWR A;  1LXH A;  3PLC A;  1ES7 B;  1NTN A;  1IKC A;  5DZ5 A;  1HOY A;  1CXO A;  3U73 U;  2JVE A;  1ERG A;  2K3G A;  1NYS A;  1IDI A;  2H7Z B;  4XJJ A;  2MJ4 A;  1KFH A;  3EBX A;  1L4W A;  1LX5 B;  1V6P A;  1HC9 B;  2L03 A; 
#chains in the Genus database with same CATH topology
 2CTX A;  1KBS A;  2J8B A;  3NDS A;  1FFJ A;  1NXB A;  2H5F A;  4BIK B;  1IDG A;  4FAO C;  1BXP A;  1CDR A;  2X8B B;  3U74 U;  1NOR A;  1KL8 A;  3ERA A;  1CDQ A;  1COE A;  1CHV S;  1KBA A;  4HQP F;  4UY2 C;  5EBX A;  1ERA A;  1HAJ A;  1LXG A;  4RUD A;  1PLO A;  3KFD I;  2BHI A;  3BT1 U;  2QJA C;  1FSS B;  3EVS C;  4P7U A;  1IJC A;  1NYU A;  2NBT A;  2BTX A;  2CRT A;  2N99 A;  4KSN A;  1KC4 A;  1KU6 B;  2H8U A;  4EY8 B;  2MFA A;  2H64 C;  2QJ9 C;  1ABT A;  1UG4 A;  3NH7 A;  1ONJ A;  1TFS A;  4QTI U;  1JE9 A;  2HLQ A;  1DRS A;  5DO6 A;  1IDH A;  2CCX A;  1I02 A;  2PJY C;  2MJY A;  1IQ9 A;  3LAQ U;  1B41 B;  1M9Z A;  3VTS A;  1VB0 A;  2OFS A;  4OM5 A;  1KTZ B;  4AEA A;  6EBX A;  2LA1 A;  1CDT A;  3BT2 U;  4LFT A;  2CRS A;  1QKD A;  1IDL A;  3QB4 B;  2VLW A;  2CDX A;  1CDS A;  1BTE A;  2H7Z A;  3FEV A;  4BDT B;  2GOO C;  1RL5 A;  2H64 B;  1F8U B;  1CRF A;  2L5S A;  1MR6 A;  5IMY C;  4ZQY A;  1CTX A;  1QM7 A;  1HC9 A;  1NEA A;  2JQP A;  1W6B A;  1TGX A;  2UX2 A;  1LJZ A;  1YWH A;  1FF4 A;  1CXN A;  1FAS A;  1CB9 A;  1COD A;  2MUO A;  1JGK A;  1KXI A;  1NTX A;  1FSC A;  2H62 C;  1HAA A;  4IYE A;  1H0J A;  1LSI A;  1S4Y A;  2HLR A;  4DO8 A;  1REW C;  2GOO B;  1MAH F;  2ERA A;  1FRA A;  1XT3 A;  1G6M A;  2QC1 A;  2LCR A;  1CVO A;  1F94 A;  1TXB A;  1KS6 A;  1CCQ A;  1KBT A;  2QJB C;  2I9B E;  2MUP A;  1RGJ A;  2H62 D;  1QKE A;  2FD6 U;  4FAO E;  1CRE A;  2PJY B;  5DU1 A;  1TXA A;  1JBD A;  5IMT D;  1ZAD A;  3HH7 A;  3KFD E;  2MHY A;  2ABX A;  1IK8 A;  2MJ0 A;  3NEQ A;  4OM4 A;  2UWR A;  1LXH A;  3PLC A;  1ES7 B;  1NTN A;  1IKC A;  5DZ5 A;  1HOY A;  1CXO A;  3U73 U;  2JVE A;  1ERG A;  2K3G A;  1NYS A;  1IDI A;  2H7Z B;  4XJJ A;  2MJ4 A;  1KFH A;  3EBX A;  1L4W A;  1LX5 B;  1V6P A;  1HC9 B;  2L03 A; 
#chains in the Genus database with same CATH homology
 2CTX A;  1KBS A;  2J8B A;  3NDS A;  1FFJ A;  1NXB A;  2H5F A;  4BIK B;  1IDG A;  4FAO C;  1BXP A;  1CDR A;  2X8B B;  3U74 U;  1NOR A;  1KL8 A;  3ERA A;  1CDQ A;  1COE A;  1CHV S;  1KBA A;  4HQP F;  4UY2 C;  5EBX A;  1ERA A;  1HAJ A;  1LXG A;  4RUD A;  1PLO A;  3KFD I;  2BHI A;  3BT1 U;  2QJA C;  1FSS B;  3EVS C;  4P7U A;  1IJC A;  1NYU A;  2NBT A;  2BTX A;  2CRT A;  2N99 A;  4KSN A;  1KC4 A;  1KU6 B;  2H8U A;  4EY8 B;  2MFA A;  2H64 C;  2QJ9 C;  1ABT A;  1UG4 A;  3NH7 A;  1ONJ A;  1TFS A;  4QTI U;  1JE9 A;  2HLQ A;  1DRS A;  5DO6 A;  1IDH A;  2CCX A;  1I02 A;  2PJY C;  2MJY A;  1IQ9 A;  3LAQ U;  1B41 B;  1M9Z A;  3VTS A;  1VB0 A;  2OFS A;  4OM5 A;  1KTZ B;  4AEA A;  6EBX A;  2LA1 A;  1CDT A;  3BT2 U;  4LFT A;  2CRS A;  1QKD A;  1IDL A;  3QB4 B;  2VLW A;  2CDX A;  1CDS A;  1BTE A;  2H7Z A;  3FEV A;  4BDT B;  2GOO C;  1RL5 A;  2H64 B;  1F8U B;  1CRF A;  2L5S A;  1MR6 A;  5IMY C;  4ZQY A;  1CTX A;  1QM7 A;  1HC9 A;  1NEA A;  2JQP A;  1W6B A;  1TGX A;  2UX2 A;  1LJZ A;  1YWH A;  1FF4 A;  1CXN A;  1FAS A;  1CB9 A;  1COD A;  2MUO A;  1JGK A;  1KXI A;  1NTX A;  1FSC A;  2H62 C;  1HAA A;  4IYE A;  1H0J A;  1LSI A;  1S4Y A;  2HLR A;  4DO8 A;  1REW C;  2GOO B;  1MAH F;  2ERA A;  1FRA A;  1XT3 A;  1G6M A;  2QC1 A;  2LCR A;  1CVO A;  1F94 A;  1TXB A;  1KS6 A;  1CCQ A;  1KBT A;  2QJB C;  2I9B E;  2MUP A;  1RGJ A;  2H62 D;  1QKE A;  2FD6 U;  4FAO E;  1CRE A;  2PJY B;  5DU1 A;  1TXA A;  1JBD A;  5IMT D;  1ZAD A;  3HH7 A;  3KFD E;  2MHY A;  2ABX A;  1IK8 A;  2MJ0 A;  3NEQ A;  4OM4 A;  2UWR A;  1LXH A;  3PLC A;  1ES7 B;  1NTN A;  1IKC A;  5DZ5 A;  1HOY A;  1CXO A;  3U73 U;  2JVE A;  1ERG A;  2K3G A;  1NYS A;  1IDI A;  2H7Z B;  4XJJ A;  2MJ4 A;  1KFH A;  3EBX A;  1L4W A;  1LX5 B;  1V6P A;  1HC9 B;  2L03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...