1HAJA

A beta-hairpin structure in a 13-mer peptide that binds a-bungarotoxin with high affinity and neutralizes its toxicity
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-BUNGAROTOXIN
publication title A Beta-Hairpin Structure in a 13-mer Peptide that Binds Alpha-Bungarotoxin with High Affinity and Neutralizes its Toxicity
pubmed doi rcsb
molecule tags Toxin/peptide
total genus 8
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1hajA00
1DRSA 3HH7A 1KFHA 1CREA 4FAOC 2L03A 2MHYA 1F8UB 1ERAA 5IMYC 1KBTA 2I9BE 1LJZA 2MFAA 1KBAA 1RL5A 2PJYB 3BT2U 1CXNA 1JE9A 2JQPA 3ERAA 1F94A 1W6BA 3U74U 1I02A 1NYSA 2NBTA 4HQPF 1ES7B 1CXOA 2H62C 5DO6A 1NYUA 1CTXA 2QJ9C 2PJYC 5DU1A 3NDSA 2BHIA 2FD6U 1REWC 2CTXA 1TGXA 2H8UA 1UG4A 1ONJA 1LXHA 1L4WA 1LXGA 1FF4A 1XT3A 2ERAA 5EBXA 2CCXA 2N99A 1CCQA 1BTEA 1CHVS 2MJ4A 1FSSB 1NORA 2H62D 1CB9A 1FRAA 1CDSA 1JBDA 2H5FA 2MUPA 3PLCA 1IDHA 1B41B 1QKEA 4ZQYA 3FEVA 2CRTA 4QTIU 4BDTB 1YWHA 3EBXA 1FSCA 3U73U 1TXBA 1ABTA 1QKDA 4EY8B 1TFSA 1LX5B 2LCRA 4XJJA 1KU6B 4UY2C 2K3GA 2LA1A 1KXIA 2MUOA 2MJ0A 1G6MA 2H7ZB 2UWRA 1S4YA 1RGJA 2BTXA 1IDLA 1COEA 2OFSA 1IDIA 3EVSC 1FASA 2MJYA 2VLWA 5IMTD 1NEAA 4OM5A 1HC9B 1V6PA 4FAOE 1MR6A 2L5SA 1NTNA 1CODA 2CDXA 1CVOA 4AEAA 3KFDE 3NH7A 1KBSA 2H7ZA 4RUDA 4DO8A 1LSIA 2QJAC 1CRFA 2JVEA 2CRSA 4P7UA 2GOOB 2QC1A 1KC4A 1KL8A 2HLQA 2ABXA 1HC9A 1KS6A 1IK8A 3KFDI 2H64B 1H0JA 2GOOC 1VB0A 2UX2A 4LFTA 1IQ9A 1IDGA 4OM4A 1MAHF 1JGKA 1FFJA 1IKCA 1HAAA 1NXBA 1HOYA 1QM7A 2J8BA 1IJCA 1CDRA 2HLRA 1NTXA 1CDQA 2H64C 1BXPA 3BT1U 2X8BB 5DZ5A 2QJBC 4BIKB 1HAJA 1PLOA 1TXAA 4IYEA 6EBXA 1ERGA 1KTZB 3NEQA 1ZADA 3LAQU 3QB4B 3VTSA 1CDTA 1M9ZA
chains in the Genus database with same CATH superfamily
1DRSA 3HH7A 1KFHA 1CREA 4FAOC 2L03A 4KSNA 2MHYA 1F8UB 1ERAA 5IMYC 1KBTA 2I9BE 1LJZA 2MFAA 1KBAA 1RL5A 2PJYB 3BT2U 1CXNA 1JE9A 2JQPA 3ERAA 1F94A 1W6BA 3U74U 1I02A 1NYSA 2NBTA 4HQPF 1ES7B 1CXOA 2H62C 5DO6A 1NYUA 1CTXA 2QJ9C 2PJYC 5DU1A 3NDSA 2BHIA 2FD6U 1REWC 2CTXA 1TGXA 2H8UA 1UG4A 1ONJA 1LXHA 1L4WA 1LXGA 1FF4A 1XT3A 2ERAA 5EBXA 2CCXA 2N99A 1CCQA 1BTEA 1CHVS 2MJ4A 1FSSB 1NORA 2H62D 1CB9A 1FRAA 1CDSA 1JBDA 2H5FA 2MUPA 3PLCA 1IDHA 1B41B 1QKEA 4ZQYA 3FEVA 2CRTA 4QTIU 4BDTB 1YWHA 3EBXA 1FSCA 3U73U 1TXBA 1ABTA 1QKDA 4EY8B 1TFSA 1LX5B 2LCRA 4XJJA 1KU6B 4UY2C 2K3GA 2LA1A 1KXIA 2MUOA 2MJ0A 1G6MA 2H7ZB 2UWRA 1S4YA 1RGJA 2BTXA 1IDLA 1COEA 2OFSA 1IDIA 3EVSC 1FASA 2MJYA 2VLWA 5IMTD 1NEAA 4OM5A 1HC9B 1V6PA 4FAOE 1MR6A 2L5SA 1NTNA 1CODA 2CDXA 1CVOA 4AEAA 3KFDE 3NH7A 1KBSA 2H7ZA 4RUDA 4DO8A 1LSIA 2QJAC 1CRFA 2JVEA 2CRSA 4P7UA 2GOOB 2QC1A 1KC4A 1KL8A 2HLQA 2ABXA 1HC9A 1KS6A 1IK8A 3KFDI 2H64B 1H0JA 2GOOC 1VB0A 2UX2A 4LFTA 1IQ9A 1IDGA 4OM4A 1MAHF 1JGKA 1FFJA 1IKCA 1HAAA 1NXBA 1HOYA 1QM7A 2J8BA 1IJCA 1CDRA 2HLRA 1NTXA 1CDQA 2H64C 1BXPA 3BT1U 2X8BB 5DZ5A 2QJBC 4BIKB 1HAJA 1PLOA 1TXAA 4IYEA 6EBXA 1ERGA 1KTZB 3NEQA 1ZADA 3LAQU 3QB4B 3VTSA 1CDTA 1M9ZA
chains in the Genus database with same CATH topology
1DRSA 3HH7A 1KFHA 1CREA 4FAOC 2L03A 4KSNA 2MHYA 1F8UB 1ERAA 5IMYC 1KBTA 2I9BE 1LJZA 2MFAA 1KBAA 1RL5A 2PJYB 3BT2U 1CXNA 1JE9A 2JQPA 3ERAA 1F94A 1W6BA 3U74U 1I02A 1NYSA 2NBTA 4HQPF 1ES7B 1CXOA 2H62C 5DO6A 1NYUA 1CTXA 2QJ9C 2PJYC 5DU1A 3NDSA 2BHIA 2FD6U 1REWC 2CTXA 1TGXA 2H8UA 1UG4A 1ONJA 1LXHA 1L4WA 1LXGA 1FF4A 1XT3A 2ERAA 5EBXA 2CCXA 2N99A 1CCQA 1BTEA 1CHVS 2MJ4A 1FSSB 1NORA 2H62D 1CB9A 1FRAA 1CDSA 1JBDA 2H5FA 2MUPA 3PLCA 1IDHA 1B41B 1QKEA 4ZQYA 3FEVA 2CRTA 4QTIU 4BDTB 1YWHA 3EBXA 1FSCA 3U73U 1TXBA 1ABTA 1QKDA 4EY8B 1TFSA 1LX5B 2LCRA 4XJJA 1KU6B 4UY2C 2K3GA 2LA1A 1KXIA 2MUOA 2MJ0A 1G6MA 2H7ZB 2UWRA 1S4YA 1RGJA 2BTXA 1IDLA 1COEA 2OFSA 1IDIA 3EVSC 1FASA 2MJYA 2VLWA 5IMTD 1NEAA 4OM5A 1HC9B 1V6PA 4FAOE 1MR6A 2L5SA 1NTNA 1CODA 2CDXA 1CVOA 4AEAA 3KFDE 3NH7A 1KBSA 2H7ZA 4RUDA 4DO8A 1LSIA 2QJAC 1CRFA 2JVEA 2CRSA 4P7UA 2GOOB 2QC1A 1KC4A 1KL8A 2HLQA 2ABXA 1HC9A 1KS6A 1IK8A 3KFDI 2H64B 1H0JA 2GOOC 1VB0A 2UX2A 4LFTA 1IQ9A 1IDGA 4OM4A 1MAHF 1JGKA 1FFJA 1IKCA 1HAAA 1NXBA 1HOYA 1QM7A 2J8BA 1IJCA 1CDRA 2HLRA 1NTXA 1CDQA 2H64C 1BXPA 3BT1U 2X8BB 5DZ5A 2QJBC 4BIKB 1HAJA 1PLOA 1TXAA 4IYEA 6EBXA 1ERGA 1KTZB 3NEQA 1ZADA 3LAQU 3QB4B 3VTSA 1CDTA 1M9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DRS A;  3HH7 A;  1KFH A;  1CRE A;  4FAO C;  2L03 A;  2MHY A;  1F8U B;  1ERA A;  5IMY C;  1KBT A;  2I9B E;  1LJZ A;  2MFA A;  1KBA A;  1RL5 A;  2PJY B;  3BT2 U;  1CXN A;  1JE9 A;  2JQP A;  3ERA A;  1F94 A;  1W6B A;  3U74 U;  1I02 A;  1NYS A;  2NBT A;  4HQP F;  1ES7 B;  1CXO A;  2H62 C;  5DO6 A;  1NYU A;  1CTX A;  2QJ9 C;  2PJY C;  5DU1 A;  3NDS A;  2BHI A;  2FD6 U;  1REW C;  2CTX A;  1TGX A;  2H8U A;  1UG4 A;  1ONJ A;  1LXH A;  1L4W A;  1LXG A;  1FF4 A;  1XT3 A;  2ERA A;  5EBX A;  2CCX A;  2N99 A;  1CCQ A;  1BTE A;  1CHV S;  2MJ4 A;  1FSS B;  1NOR A;  2H62 D;  1CB9 A;  1FRA A;  1CDS A;  1JBD A;  2H5F A;  2MUP A;  3PLC A;  1IDH A;  1B41 B;  1QKE A;  4ZQY A;  3FEV A;  2CRT A;  4QTI U;  4BDT B;  1YWH A;  3EBX A;  1FSC A;  3U73 U;  1TXB A;  1ABT A;  1QKD A;  4EY8 B;  1TFS A;  1LX5 B;  2LCR A;  4XJJ A;  1KU6 B;  4UY2 C;  2K3G A;  2LA1 A;  1KXI A;  2MUO A;  2MJ0 A;  1G6M A;  2H7Z B;  2UWR A;  1S4Y A;  1RGJ A;  2BTX A;  1IDL A;  1COE A;  2OFS A;  1IDI A;  3EVS C;  1FAS A;  2MJY A;  2VLW A;  5IMT D;  1NEA A;  4OM5 A;  1HC9 B;  1V6P A;  4FAO E;  1MR6 A;  2L5S A;  1NTN A;  1COD A;  2CDX A;  1CVO A;  4AEA A;  3KFD E;  3NH7 A;  1KBS A;  2H7Z A;  4RUD A;  4DO8 A;  1LSI A;  2QJA C;  1CRF A;  2JVE A;  2CRS A;  4P7U A;  2GOO B;  2QC1 A;  1KC4 A;  1KL8 A;  2HLQ A;  2ABX A;  1HC9 A;  1KS6 A;  1IK8 A;  3KFD I;  2H64 B;  1H0J A;  2GOO C;  1VB0 A;  2UX2 A;  4LFT A;  1IQ9 A;  1IDG A;  4OM4 A;  1MAH F;  1JGK A;  1FFJ A;  1IKC A;  1HAA A;  1NXB A;  1HOY A;  1QM7 A;  2J8B A;  1IJC A;  1CDR A;  2HLR A;  1NTX A;  1CDQ A;  2H64 C;  1BXP A;  3BT1 U;  2X8B B;  5DZ5 A;  2QJB C;  4BIK B;  1HAJ A;  1PLO A;  1TXA A;  4IYE A;  6EBX A;  1ERG A;  1KTZ B;  3NEQ A;  1ZAD A;  3LAQ U;  3QB4 B;  3VTS A;  1CDT A;  1M9Z A; 
#chains in the Genus database with same CATH topology
 1DRS A;  3HH7 A;  1KFH A;  1CRE A;  4FAO C;  2L03 A;  4KSN A;  2MHY A;  1F8U B;  1ERA A;  5IMY C;  1KBT A;  2I9B E;  1LJZ A;  2MFA A;  1KBA A;  1RL5 A;  2PJY B;  3BT2 U;  1CXN A;  1JE9 A;  2JQP A;  3ERA A;  1F94 A;  1W6B A;  3U74 U;  1I02 A;  1NYS A;  2NBT A;  4HQP F;  1ES7 B;  1CXO A;  2H62 C;  5DO6 A;  1NYU A;  1CTX A;  2QJ9 C;  2PJY C;  5DU1 A;  3NDS A;  2BHI A;  2FD6 U;  1REW C;  2CTX A;  1TGX A;  2H8U A;  1UG4 A;  1ONJ A;  1LXH A;  1L4W A;  1LXG A;  1FF4 A;  1XT3 A;  2ERA A;  5EBX A;  2CCX A;  2N99 A;  1CCQ A;  1BTE A;  1CHV S;  2MJ4 A;  1FSS B;  1NOR A;  2H62 D;  1CB9 A;  1FRA A;  1CDS A;  1JBD A;  2H5F A;  2MUP A;  3PLC A;  1IDH A;  1B41 B;  1QKE A;  4ZQY A;  3FEV A;  2CRT A;  4QTI U;  4BDT B;  1YWH A;  3EBX A;  1FSC A;  3U73 U;  1TXB A;  1ABT A;  1QKD A;  4EY8 B;  1TFS A;  1LX5 B;  2LCR A;  4XJJ A;  1KU6 B;  4UY2 C;  2K3G A;  2LA1 A;  1KXI A;  2MUO A;  2MJ0 A;  1G6M A;  2H7Z B;  2UWR A;  1S4Y A;  1RGJ A;  2BTX A;  1IDL A;  1COE A;  2OFS A;  1IDI A;  3EVS C;  1FAS A;  2MJY A;  2VLW A;  5IMT D;  1NEA A;  4OM5 A;  1HC9 B;  1V6P A;  4FAO E;  1MR6 A;  2L5S A;  1NTN A;  1COD A;  2CDX A;  1CVO A;  4AEA A;  3KFD E;  3NH7 A;  1KBS A;  2H7Z A;  4RUD A;  4DO8 A;  1LSI A;  2QJA C;  1CRF A;  2JVE A;  2CRS A;  4P7U A;  2GOO B;  2QC1 A;  1KC4 A;  1KL8 A;  2HLQ A;  2ABX A;  1HC9 A;  1KS6 A;  1IK8 A;  3KFD I;  2H64 B;  1H0J A;  2GOO C;  1VB0 A;  2UX2 A;  4LFT A;  1IQ9 A;  1IDG A;  4OM4 A;  1MAH F;  1JGK A;  1FFJ A;  1IKC A;  1HAA A;  1NXB A;  1HOY A;  1QM7 A;  2J8B A;  1IJC A;  1CDR A;  2HLR A;  1NTX A;  1CDQ A;  2H64 C;  1BXP A;  3BT1 U;  2X8B B;  5DZ5 A;  2QJB C;  4BIK B;  1HAJ A;  1PLO A;  1TXA A;  4IYE A;  6EBX A;  1ERG A;  1KTZ B;  3NEQ A;  1ZAD A;  3LAQ U;  3QB4 B;  3VTS A;  1CDT A;  1M9Z A; 
#chains in the Genus database with same CATH homology
 1DRS A;  3HH7 A;  1KFH A;  1CRE A;  4FAO C;  2L03 A;  4KSN A;  2MHY A;  1F8U B;  1ERA A;  5IMY C;  1KBT A;  2I9B E;  1LJZ A;  2MFA A;  1KBA A;  1RL5 A;  2PJY B;  3BT2 U;  1CXN A;  1JE9 A;  2JQP A;  3ERA A;  1F94 A;  1W6B A;  3U74 U;  1I02 A;  1NYS A;  2NBT A;  4HQP F;  1ES7 B;  1CXO A;  2H62 C;  5DO6 A;  1NYU A;  1CTX A;  2QJ9 C;  2PJY C;  5DU1 A;  3NDS A;  2BHI A;  2FD6 U;  1REW C;  2CTX A;  1TGX A;  2H8U A;  1UG4 A;  1ONJ A;  1LXH A;  1L4W A;  1LXG A;  1FF4 A;  1XT3 A;  2ERA A;  5EBX A;  2CCX A;  2N99 A;  1CCQ A;  1BTE A;  1CHV S;  2MJ4 A;  1FSS B;  1NOR A;  2H62 D;  1CB9 A;  1FRA A;  1CDS A;  1JBD A;  2H5F A;  2MUP A;  3PLC A;  1IDH A;  1B41 B;  1QKE A;  4ZQY A;  3FEV A;  2CRT A;  4QTI U;  4BDT B;  1YWH A;  3EBX A;  1FSC A;  3U73 U;  1TXB A;  1ABT A;  1QKD A;  4EY8 B;  1TFS A;  1LX5 B;  2LCR A;  4XJJ A;  1KU6 B;  4UY2 C;  2K3G A;  2LA1 A;  1KXI A;  2MUO A;  2MJ0 A;  1G6M A;  2H7Z B;  2UWR A;  1S4Y A;  1RGJ A;  2BTX A;  1IDL A;  1COE A;  2OFS A;  1IDI A;  3EVS C;  1FAS A;  2MJY A;  2VLW A;  5IMT D;  1NEA A;  4OM5 A;  1HC9 B;  1V6P A;  4FAO E;  1MR6 A;  2L5S A;  1NTN A;  1COD A;  2CDX A;  1CVO A;  4AEA A;  3KFD E;  3NH7 A;  1KBS A;  2H7Z A;  4RUD A;  4DO8 A;  1LSI A;  2QJA C;  1CRF A;  2JVE A;  2CRS A;  4P7U A;  2GOO B;  2QC1 A;  1KC4 A;  1KL8 A;  2HLQ A;  2ABX A;  1HC9 A;  1KS6 A;  1IK8 A;  3KFD I;  2H64 B;  1H0J A;  2GOO C;  1VB0 A;  2UX2 A;  4LFT A;  1IQ9 A;  1IDG A;  4OM4 A;  1MAH F;  1JGK A;  1FFJ A;  1IKC A;  1HAA A;  1NXB A;  1HOY A;  1QM7 A;  2J8B A;  1IJC A;  1CDR A;  2HLR A;  1NTX A;  1CDQ A;  2H64 C;  1BXP A;  3BT1 U;  2X8B B;  5DZ5 A;  2QJB C;  4BIK B;  1HAJ A;  1PLO A;  1TXA A;  4IYE A;  6EBX A;  1ERG A;  1KTZ B;  3NEQ A;  1ZAD A;  3LAQ U;  3QB4 B;  3VTS A;  1CDT A;  1M9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...