1HAJA

A beta-hairpin structure in a 13-mer peptide that binds a-bungarotoxin with high affinity and neutralizes its toxicity
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/peptide
molecule keywords ALPHA-BUNGAROTOXIN
publication title A Beta-Hairpin Structure in a 13-mer Peptide that Binds Alpha-Bungarotoxin with High Affinity and Neutralizes its Toxicity
pubmed doi rcsb
total genus 8
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1hajA00
5DU1A 1ERGA 2CRSA 3ERAA 3VTSA 1IDGA 1FSCA 2H62C 2H64B 2BTXA 2CRTA 4QTIU 1NORA 2QJBC 4OM4A 4BIKB 1F94A 2CCXA 1KS6A 1FFJA 2MFAA 5IMTD 1TXBA 1COEA 1XT3A 1JE9A 3FEVA 2PJYC 2JQPA 1ERAA 2MHYA 1IK8A 1HOYA 1NTXA 2ERAA 1LSIA 1CRFA 4OM5A 2GOOB 3KFDI 3NDSA 1FASA 1ONJA 1MR6A 2HLQA 4IYEA 1CREA 1HC9B 1UG4A 1F8UB 3QB4B 2UX2A 1KBTA 2L03A 1YWHA 1CDSA 3LAQU 1RL5A 3NH7A 1IKCA 3BT1U 2MJ0A 1NTNA 2FD6U 2H62D 2L5SA 2CDXA 1FF4A 1FRAA 1S4YA 2QJ9C 4FAOE 1PLOA 1CDRA 1TXAA 1FSSB 1CDTA 2UWRA 1H0JA 2ABXA 1CHVS 2BHIA 3KFDE 4FAOC 1M9ZA 1HAAA 1DRSA 1NYUA 3U74U 1IDLA 1LJZA 3HH7A 1QKEA 1W6BA 2H7ZB 2HLRA 2PJYB 2N99A 2J8BA 4P7UA 5IMYC 2QJAC 4HQPF 3U73U 1ABTA 3EBXA 1LX5B 1CCQA 2MUPA 1REWC 1TGXA 2I9BE 1CODA 2QC1A 4RUDA 1IQ9A 1IJCA 1TFSA 1NYSA 1KTZB 1KL8A 1ES7B 2LA1A 1JBDA 4DO8A 4EY8B 3PLCA 3NEQA 4XJJA 1HC9A 1RGJA 2MJYA 1VB0A 1KXIA 1QM7A 2K3GA 1CXNA 2NBTA 1NXBA 4AEAA 1LXHA 2VLWA 5EBXA 1CDQA 1MAHF 1V6PA 1IDIA 4UY2C 1NEAA 1BXPA 5DO6A 2H5FA 4ZQYA 2X8BB 1KBSA 2MUOA 2OFSA 1KC4A 2H8UA 1KBAA 2CTXA 2GOOC 1CB9A 1BTEA 1QKDA 3EVSC 1HAJA 1CTXA 1KFHA 1ZADA 3BT2U 2MJ4A 1G6MA 1CXOA 1KU6B 1B41B 1JGKA 2JVEA 1LXGA 2LCRA 1CVOA 2H7ZA 4BDTB 1IDHA 1L4WA 1I02A 6EBXA 2H64C 4LFTA 5DZ5A
chains in the Genus database with same CATH superfamily
5DU1A 1ERGA 2CRSA 3ERAA 3VTSA 1IDGA 1FSCA 2H62C 2H64B 2BTXA 2CRTA 4QTIU 1NORA 2QJBC 4OM4A 4BIKB 1F94A 2CCXA 1KS6A 1FFJA 2MFAA 5IMTD 1TXBA 1COEA 1XT3A 1JE9A 3FEVA 2PJYC 2JQPA 1ERAA 2MHYA 1IK8A 1HOYA 1NTXA 2ERAA 1LSIA 1CRFA 4OM5A 2GOOB 3KFDI 3NDSA 1FASA 1ONJA 1MR6A 2HLQA 4IYEA 1CREA 1HC9B 1UG4A 1F8UB 3QB4B 2UX2A 1KBTA 2L03A 1YWHA 1CDSA 3LAQU 1RL5A 3NH7A 1IKCA 3BT1U 2MJ0A 1NTNA 2FD6U 2H62D 2L5SA 2CDXA 1FF4A 1FRAA 1S4YA 2QJ9C 4FAOE 1PLOA 1CDRA 1TXAA 1FSSB 1CDTA 2UWRA 1H0JA 2ABXA 1CHVS 2BHIA 3KFDE 4FAOC 1M9ZA 1HAAA 1DRSA 1NYUA 3U74U 1IDLA 1LJZA 3HH7A 1QKEA 1W6BA 2H7ZB 2HLRA 2PJYB 2N99A 2J8BA 4P7UA 5IMYC 2QJAC 4HQPF 3U73U 1ABTA 3EBXA 1LX5B 1CCQA 2MUPA 1REWC 1TGXA 2I9BE 1CODA 2QC1A 4RUDA 1IQ9A 1IJCA 1TFSA 1NYSA 1KTZB 1KL8A 1ES7B 2LA1A 1JBDA 4DO8A 4EY8B 3PLCA 3NEQA 4XJJA 1HC9A 1RGJA 2MJYA 1VB0A 1KXIA 1QM7A 2K3GA 1CXNA 2NBTA 1NXBA 4AEAA 1LXHA 2VLWA 5EBXA 1CDQA 1MAHF 1V6PA 1IDIA 4UY2C 1NEAA 1BXPA 5DO6A 2H5FA 4ZQYA 2X8BB 1KBSA 2MUOA 2OFSA 1KC4A 2H8UA 1KBAA 2CTXA 2GOOC 1CB9A 1BTEA 1QKDA 3EVSC 1HAJA 1CTXA 1KFHA 1ZADA 3BT2U 2MJ4A 1G6MA 1CXOA 1KU6B 1B41B 1JGKA 2JVEA 1LXGA 2LCRA 1CVOA 2H7ZA 4KSNA 4BDTB 1IDHA 1L4WA 1I02A 6EBXA 2H64C 4LFTA 5DZ5A
chains in the Genus database with same CATH topology
5DU1A 1ERGA 2CRSA 3ERAA 3VTSA 1IDGA 1FSCA 2H62C 2H64B 2BTXA 2CRTA 4QTIU 1NORA 2QJBC 4OM4A 4BIKB 1F94A 2CCXA 1KS6A 1FFJA 2MFAA 5IMTD 1TXBA 1COEA 1XT3A 1JE9A 3FEVA 2PJYC 2JQPA 1ERAA 2MHYA 1IK8A 1HOYA 1NTXA 2ERAA 1LSIA 1CRFA 4OM5A 2GOOB 3KFDI 3NDSA 1FASA 1ONJA 1MR6A 2HLQA 4IYEA 1CREA 1HC9B 1UG4A 1F8UB 3QB4B 2UX2A 1KBTA 2L03A 1YWHA 1CDSA 3LAQU 1RL5A 3NH7A 1IKCA 3BT1U 2MJ0A 1NTNA 2FD6U 2H62D 2L5SA 2CDXA 1FF4A 1FRAA 1S4YA 2QJ9C 4FAOE 1PLOA 1CDRA 1TXAA 1FSSB 1CDTA 2UWRA 1H0JA 2ABXA 1CHVS 2BHIA 3KFDE 4FAOC 1M9ZA 1HAAA 1DRSA 1NYUA 3U74U 1IDLA 1LJZA 3HH7A 1QKEA 1W6BA 2H7ZB 2HLRA 2PJYB 2N99A 2J8BA 4P7UA 5IMYC 2QJAC 4HQPF 3U73U 1ABTA 3EBXA 1LX5B 1CCQA 2MUPA 1REWC 1TGXA 2I9BE 1CODA 2QC1A 4RUDA 1IQ9A 1IJCA 1TFSA 1NYSA 1KTZB 1KL8A 1ES7B 2LA1A 1JBDA 4DO8A 4EY8B 3PLCA 3NEQA 4XJJA 1HC9A 1RGJA 2MJYA 1VB0A 1KXIA 1QM7A 2K3GA 1CXNA 2NBTA 1NXBA 4AEAA 1LXHA 2VLWA 5EBXA 1CDQA 1MAHF 1V6PA 1IDIA 4UY2C 1NEAA 1BXPA 5DO6A 2H5FA 4ZQYA 2X8BB 1KBSA 2MUOA 2OFSA 1KC4A 2H8UA 1KBAA 2CTXA 2GOOC 1CB9A 1BTEA 1QKDA 3EVSC 1HAJA 1CTXA 1KFHA 1ZADA 3BT2U 2MJ4A 1G6MA 1CXOA 1KU6B 1B41B 1JGKA 2JVEA 1LXGA 2LCRA 1CVOA 2H7ZA 4KSNA 4BDTB 1IDHA 1L4WA 1I02A 6EBXA 2H64C 4LFTA 5DZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DU1 A;  1ERG A;  2CRS A;  3ERA A;  3VTS A;  1IDG A;  1FSC A;  2H62 C;  2H64 B;  2BTX A;  2CRT A;  4QTI U;  1NOR A;  2QJB C;  4OM4 A;  4BIK B;  1F94 A;  2CCX A;  1KS6 A;  1FFJ A;  2MFA A;  5IMT D;  1TXB A;  1COE A;  1XT3 A;  1JE9 A;  3FEV A;  2PJY C;  2JQP A;  1ERA A;  2MHY A;  1IK8 A;  1HOY A;  1NTX A;  2ERA A;  1LSI A;  1CRF A;  4OM5 A;  2GOO B;  3KFD I;  3NDS A;  1FAS A;  1ONJ A;  1MR6 A;  2HLQ A;  4IYE A;  1CRE A;  1HC9 B;  1UG4 A;  1F8U B;  3QB4 B;  2UX2 A;  1KBT A;  2L03 A;  1YWH A;  1CDS A;  3LAQ U;  1RL5 A;  3NH7 A;  1IKC A;  3BT1 U;  2MJ0 A;  1NTN A;  2FD6 U;  2H62 D;  2L5S A;  2CDX A;  1FF4 A;  1FRA A;  1S4Y A;  2QJ9 C;  4FAO E;  1PLO A;  1CDR A;  1TXA A;  1FSS B;  1CDT A;  2UWR A;  1H0J A;  2ABX A;  1CHV S;  2BHI A;  3KFD E;  4FAO C;  1M9Z A;  1HAA A;  1DRS A;  1NYU A;  3U74 U;  1IDL A;  1LJZ A;  3HH7 A;  1QKE A;  1W6B A;  2H7Z B;  2HLR A;  2PJY B;  2N99 A;  2J8B A;  4P7U A;  5IMY C;  2QJA C;  4HQP F;  3U73 U;  1ABT A;  3EBX A;  1LX5 B;  1CCQ A;  2MUP A;  1REW C;  1TGX A;  2I9B E;  1COD A;  2QC1 A;  4RUD A;  1IQ9 A;  1IJC A;  1TFS A;  1NYS A;  1KTZ B;  1KL8 A;  1ES7 B;  2LA1 A;  1JBD A;  4DO8 A;  4EY8 B;  3PLC A;  3NEQ A;  4XJJ A;  1HC9 A;  1RGJ A;  2MJY A;  1VB0 A;  1KXI A;  1QM7 A;  2K3G A;  1CXN A;  2NBT A;  1NXB A;  4AEA A;  1LXH A;  2VLW A;  5EBX A;  1CDQ A;  1MAH F;  1V6P A;  1IDI A;  4UY2 C;  1NEA A;  1BXP A;  5DO6 A;  2H5F A;  4ZQY A;  2X8B B;  1KBS A;  2MUO A;  2OFS A;  1KC4 A;  2H8U A;  1KBA A;  2CTX A;  2GOO C;  1CB9 A;  1BTE A;  1QKD A;  3EVS C;  1HAJ A;  1CTX A;  1KFH A;  1ZAD A;  3BT2 U;  2MJ4 A;  1G6M A;  1CXO A;  1KU6 B;  1B41 B;  1JGK A;  2JVE A;  1LXG A;  2LCR A;  1CVO A;  2H7Z A;  4BDT B;  1IDH A;  1L4W A;  1I02 A;  6EBX A;  2H64 C;  4LFT A;  5DZ5 A; 
#chains in the Genus database with same CATH topology
 5DU1 A;  1ERG A;  2CRS A;  3ERA A;  3VTS A;  1IDG A;  1FSC A;  2H62 C;  2H64 B;  2BTX A;  2CRT A;  4QTI U;  1NOR A;  2QJB C;  4OM4 A;  4BIK B;  1F94 A;  2CCX A;  1KS6 A;  1FFJ A;  2MFA A;  5IMT D;  1TXB A;  1COE A;  1XT3 A;  1JE9 A;  3FEV A;  2PJY C;  2JQP A;  1ERA A;  2MHY A;  1IK8 A;  1HOY A;  1NTX A;  2ERA A;  1LSI A;  1CRF A;  4OM5 A;  2GOO B;  3KFD I;  3NDS A;  1FAS A;  1ONJ A;  1MR6 A;  2HLQ A;  4IYE A;  1CRE A;  1HC9 B;  1UG4 A;  1F8U B;  3QB4 B;  2UX2 A;  1KBT A;  2L03 A;  1YWH A;  1CDS A;  3LAQ U;  1RL5 A;  3NH7 A;  1IKC A;  3BT1 U;  2MJ0 A;  1NTN A;  2FD6 U;  2H62 D;  2L5S A;  2CDX A;  1FF4 A;  1FRA A;  1S4Y A;  2QJ9 C;  4FAO E;  1PLO A;  1CDR A;  1TXA A;  1FSS B;  1CDT A;  2UWR A;  1H0J A;  2ABX A;  1CHV S;  2BHI A;  3KFD E;  4FAO C;  1M9Z A;  1HAA A;  1DRS A;  1NYU A;  3U74 U;  1IDL A;  1LJZ A;  3HH7 A;  1QKE A;  1W6B A;  2H7Z B;  2HLR A;  2PJY B;  2N99 A;  2J8B A;  4P7U A;  5IMY C;  2QJA C;  4HQP F;  3U73 U;  1ABT A;  3EBX A;  1LX5 B;  1CCQ A;  2MUP A;  1REW C;  1TGX A;  2I9B E;  1COD A;  2QC1 A;  4RUD A;  1IQ9 A;  1IJC A;  1TFS A;  1NYS A;  1KTZ B;  1KL8 A;  1ES7 B;  2LA1 A;  1JBD A;  4DO8 A;  4EY8 B;  3PLC A;  3NEQ A;  4XJJ A;  1HC9 A;  1RGJ A;  2MJY A;  1VB0 A;  1KXI A;  1QM7 A;  2K3G A;  1CXN A;  2NBT A;  1NXB A;  4AEA A;  1LXH A;  2VLW A;  5EBX A;  1CDQ A;  1MAH F;  1V6P A;  1IDI A;  4UY2 C;  1NEA A;  1BXP A;  5DO6 A;  2H5F A;  4ZQY A;  2X8B B;  1KBS A;  2MUO A;  2OFS A;  1KC4 A;  2H8U A;  1KBA A;  2CTX A;  2GOO C;  1CB9 A;  1BTE A;  1QKD A;  3EVS C;  1HAJ A;  1CTX A;  1KFH A;  1ZAD A;  3BT2 U;  2MJ4 A;  1G6M A;  1CXO A;  1KU6 B;  1B41 B;  1JGK A;  2JVE A;  1LXG A;  2LCR A;  1CVO A;  2H7Z A;  4KSN A;  4BDT B;  1IDH A;  1L4W A;  1I02 A;  6EBX A;  2H64 C;  4LFT A;  5DZ5 A; 
#chains in the Genus database with same CATH homology
 5DU1 A;  1ERG A;  2CRS A;  3ERA A;  3VTS A;  1IDG A;  1FSC A;  2H62 C;  2H64 B;  2BTX A;  2CRT A;  4QTI U;  1NOR A;  2QJB C;  4OM4 A;  4BIK B;  1F94 A;  2CCX A;  1KS6 A;  1FFJ A;  2MFA A;  5IMT D;  1TXB A;  1COE A;  1XT3 A;  1JE9 A;  3FEV A;  2PJY C;  2JQP A;  1ERA A;  2MHY A;  1IK8 A;  1HOY A;  1NTX A;  2ERA A;  1LSI A;  1CRF A;  4OM5 A;  2GOO B;  3KFD I;  3NDS A;  1FAS A;  1ONJ A;  1MR6 A;  2HLQ A;  4IYE A;  1CRE A;  1HC9 B;  1UG4 A;  1F8U B;  3QB4 B;  2UX2 A;  1KBT A;  2L03 A;  1YWH A;  1CDS A;  3LAQ U;  1RL5 A;  3NH7 A;  1IKC A;  3BT1 U;  2MJ0 A;  1NTN A;  2FD6 U;  2H62 D;  2L5S A;  2CDX A;  1FF4 A;  1FRA A;  1S4Y A;  2QJ9 C;  4FAO E;  1PLO A;  1CDR A;  1TXA A;  1FSS B;  1CDT A;  2UWR A;  1H0J A;  2ABX A;  1CHV S;  2BHI A;  3KFD E;  4FAO C;  1M9Z A;  1HAA A;  1DRS A;  1NYU A;  3U74 U;  1IDL A;  1LJZ A;  3HH7 A;  1QKE A;  1W6B A;  2H7Z B;  2HLR A;  2PJY B;  2N99 A;  2J8B A;  4P7U A;  5IMY C;  2QJA C;  4HQP F;  3U73 U;  1ABT A;  3EBX A;  1LX5 B;  1CCQ A;  2MUP A;  1REW C;  1TGX A;  2I9B E;  1COD A;  2QC1 A;  4RUD A;  1IQ9 A;  1IJC A;  1TFS A;  1NYS A;  1KTZ B;  1KL8 A;  1ES7 B;  2LA1 A;  1JBD A;  4DO8 A;  4EY8 B;  3PLC A;  3NEQ A;  4XJJ A;  1HC9 A;  1RGJ A;  2MJY A;  1VB0 A;  1KXI A;  1QM7 A;  2K3G A;  1CXN A;  2NBT A;  1NXB A;  4AEA A;  1LXH A;  2VLW A;  5EBX A;  1CDQ A;  1MAH F;  1V6P A;  1IDI A;  4UY2 C;  1NEA A;  1BXP A;  5DO6 A;  2H5F A;  4ZQY A;  2X8B B;  1KBS A;  2MUO A;  2OFS A;  1KC4 A;  2H8U A;  1KBA A;  2CTX A;  2GOO C;  1CB9 A;  1BTE A;  1QKD A;  3EVS C;  1HAJ A;  1CTX A;  1KFH A;  1ZAD A;  3BT2 U;  2MJ4 A;  1G6M A;  1CXO A;  1KU6 B;  1B41 B;  1JGK A;  2JVE A;  1LXG A;  2LCR A;  1CVO A;  2H7Z A;  4KSN A;  4BDT B;  1IDH A;  1L4W A;  1I02 A;  6EBX A;  2H64 C;  4LFT A;  5DZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...