1CHVS

Elucidation of the solution structure of cardiotoxin analogue v from the taiwan cobra (naja naja atra) venom
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNKMVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PROTEIN (CARDIOTOXIN ANALOGUE V)
publication title Elucidation of the solution structure of cardiotoxin analogue V from the Taiwan cobra (Naja naja atra)--identification of structural features important for the lethal action of snake venom cardiotoxins
pubmed rcsb
total genus 7
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1999-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1chvS00
2H8UA 2OFSA 1UG4A 1CVOA 1XT3A 2MFAA 3PLCA 1M9ZA 1L4WA 3VTSA 1TGXA 2H7ZB 1ERGA 2QC1A 1B41B 1IDGA 1KBAA 1LX5B 3LAQU 1DRSA 1CTXA 1CDQA 1FSSB 1KU6B 1FF4A 1S4YA 1FASA 2J8BA 4FAOE 3KFDI 3KFDE 1JBDA 1KBSA 2VLWA 5EBXA 1CREA 2MUOA 2GOOB 1JE9A 2BHIA 2X8BB 2LA1A 4IYEA 1CXNA 2I9BE 1KL8A 1ERAA 2CDXA 1NYUA 1ONJA 3BT2U 2K3GA 1CHVS 1RL5A 3QB4B 1RGJA 2BTXA 2MJ4A 1IK8A 5DZ5A 1CDTA 1HAAA 2CRTA 2JQPA 1JGKA 1IDLA 1CRFA 2UX2A 1CB9A 4EY8B 1FFJA 1ES7B 1VB0A 1BXPA 5IMYC 2N99A 1YWHA 2QJ9C 3NEQA 1I02A 1HC9A 3NH7A 1NORA 2PJYC 2MJYA 2LCRA 2CTXA 1F8UB 1CDSA 2HLRA 1NTNA 4QTIU 5DO6A 4AEAA 2CCXA 3EBXA 4DO8A 1F94A 1TXAA 2JVEA 2MJ0A 4RUDA 4XJJA 1KXIA 1TXBA 1NXBA 1QKDA 1G6MA 1NTXA 1IJCA 1BTEA 4FAOC 2HLQA 1TFSA 4UY2C 4ZQYA 1LXHA 1LJZA 3ERAA 3U74U 2CRSA 1KTZB 1LSIA 2QJBC 1KFHA 2MUPA 2H7ZA 4P7UA 3U73U 1PLOA 1CDRA 1HOYA 2NBTA 1QKEA 2H64C 2PJYB 2L03A 1W6BA 1KBTA 1MAHF 4HQPF 4OM5A 2ABXA 1NEAA 1IKCA 1NYSA 1COEA 2QJAC 1CODA 5DU1A 1FRAA 1IDIA 3HH7A 6EBXA 4OM4A 1REWC 2FD6U 3BT1U 1HC9B 4BIKB 3FEVA 1FSCA 3EVSC 2L5SA 1ABTA 1IDHA 2UWRA 1CXOA 1H0JA 1HAJA 2H5FA 2H62C 1CCQA 1KC4A 1ZADA 4LFTA 1QM7A 2H64B 5IMTD 1IQ9A 1V6PA 2GOOC 4BDTB 1KS6A 1MR6A 2H62D 3NDSA 2ERAA 2MHYA 1LXGA
chains in the Genus database with same CATH superfamily
2H8UA 2OFSA 1UG4A 1CVOA 1XT3A 2MFAA 3PLCA 1M9ZA 1L4WA 3VTSA 1TGXA 2H7ZB 1ERGA 2QC1A 1B41B 1IDGA 1KBAA 1LX5B 3LAQU 1DRSA 1CTXA 1CDQA 1FSSB 1KU6B 1FF4A 1S4YA 1FASA 2J8BA 4FAOE 3KFDI 3KFDE 1JBDA 1KBSA 2VLWA 5EBXA 1CREA 2MUOA 2GOOB 1JE9A 2BHIA 2X8BB 2LA1A 4IYEA 1CXNA 2I9BE 1KL8A 1ERAA 2CDXA 1NYUA 1ONJA 3BT2U 2K3GA 1CHVS 1RL5A 3QB4B 1RGJA 2BTXA 2MJ4A 1IK8A 5DZ5A 1CDTA 1HAAA 2CRTA 2JQPA 1JGKA 1IDLA 1CRFA 4KSNA 2UX2A 1CB9A 4EY8B 1FFJA 1ES7B 1VB0A 1BXPA 5IMYC 2N99A 1YWHA 2QJ9C 3NEQA 1I02A 1HC9A 3NH7A 1NORA 2PJYC 2MJYA 2LCRA 2CTXA 1F8UB 1CDSA 2HLRA 1NTNA 4QTIU 5DO6A 4AEAA 2CCXA 3EBXA 4DO8A 1F94A 1TXAA 2JVEA 2MJ0A 4RUDA 4XJJA 1KXIA 1TXBA 1NXBA 1QKDA 1G6MA 1NTXA 1IJCA 1BTEA 4FAOC 2HLQA 1TFSA 4UY2C 4ZQYA 1LXHA 1LJZA 3ERAA 3U74U 2CRSA 1KTZB 1LSIA 2QJBC 1KFHA 2MUPA 2H7ZA 4P7UA 3U73U 1PLOA 1CDRA 1HOYA 2NBTA 1QKEA 2H64C 2PJYB 2L03A 1W6BA 1KBTA 1MAHF 4HQPF 4OM5A 2ABXA 1NEAA 1IKCA 1NYSA 1COEA 2QJAC 1CODA 5DU1A 1FRAA 1IDIA 3HH7A 6EBXA 4OM4A 1REWC 2FD6U 3BT1U 1HC9B 4BIKB 3FEVA 1FSCA 3EVSC 2L5SA 1ABTA 1IDHA 2UWRA 1CXOA 1H0JA 1HAJA 2H5FA 2H62C 1CCQA 1KC4A 1ZADA 4LFTA 1QM7A 2H64B 5IMTD 1IQ9A 1V6PA 2GOOC 4BDTB 1KS6A 1MR6A 2H62D 3NDSA 2ERAA 2MHYA 1LXGA
chains in the Genus database with same CATH topology
2H8UA 2OFSA 1UG4A 1CVOA 1XT3A 2MFAA 3PLCA 1M9ZA 1L4WA 3VTSA 1TGXA 2H7ZB 1ERGA 2QC1A 1B41B 1IDGA 1KBAA 1LX5B 3LAQU 1DRSA 1CTXA 1CDQA 1FSSB 1KU6B 1FF4A 1S4YA 1FASA 2J8BA 4FAOE 3KFDI 3KFDE 1JBDA 1KBSA 2VLWA 5EBXA 1CREA 2MUOA 2GOOB 1JE9A 2BHIA 2X8BB 2LA1A 4IYEA 1CXNA 2I9BE 1KL8A 1ERAA 2CDXA 1NYUA 1ONJA 3BT2U 2K3GA 1CHVS 1RL5A 3QB4B 1RGJA 2BTXA 2MJ4A 1IK8A 5DZ5A 1CDTA 1HAAA 2CRTA 2JQPA 1JGKA 1IDLA 1CRFA 4KSNA 2UX2A 1CB9A 4EY8B 1FFJA 1ES7B 1VB0A 1BXPA 5IMYC 2N99A 1YWHA 2QJ9C 3NEQA 1I02A 1HC9A 3NH7A 1NORA 2PJYC 2MJYA 2LCRA 2CTXA 1F8UB 1CDSA 2HLRA 1NTNA 4QTIU 5DO6A 4AEAA 2CCXA 3EBXA 4DO8A 1F94A 1TXAA 2JVEA 2MJ0A 4RUDA 4XJJA 1KXIA 1TXBA 1NXBA 1QKDA 1G6MA 1NTXA 1IJCA 1BTEA 4FAOC 2HLQA 1TFSA 4UY2C 4ZQYA 1LXHA 1LJZA 3ERAA 3U74U 2CRSA 1KTZB 1LSIA 2QJBC 1KFHA 2MUPA 2H7ZA 4P7UA 3U73U 1PLOA 1CDRA 1HOYA 2NBTA 1QKEA 2H64C 2PJYB 2L03A 1W6BA 1KBTA 1MAHF 4HQPF 4OM5A 2ABXA 1NEAA 1IKCA 1NYSA 1COEA 2QJAC 1CODA 5DU1A 1FRAA 1IDIA 3HH7A 6EBXA 4OM4A 1REWC 2FD6U 3BT1U 1HC9B 4BIKB 3FEVA 1FSCA 3EVSC 2L5SA 1ABTA 1IDHA 2UWRA 1CXOA 1H0JA 1HAJA 2H5FA 2H62C 1CCQA 1KC4A 1ZADA 4LFTA 1QM7A 2H64B 5IMTD 1IQ9A 1V6PA 2GOOC 4BDTB 1KS6A 1MR6A 2H62D 3NDSA 2ERAA 2MHYA 1LXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8U A;  2OFS A;  1UG4 A;  1CVO A;  1XT3 A;  2MFA A;  3PLC A;  1M9Z A;  1L4W A;  3VTS A;  1TGX A;  2H7Z B;  1ERG A;  2QC1 A;  1B41 B;  1IDG A;  1KBA A;  1LX5 B;  3LAQ U;  1DRS A;  1CTX A;  1CDQ A;  1FSS B;  1KU6 B;  1FF4 A;  1S4Y A;  1FAS A;  2J8B A;  4FAO E;  3KFD I;  3KFD E;  1JBD A;  1KBS A;  2VLW A;  5EBX A;  1CRE A;  2MUO A;  2GOO B;  1JE9 A;  2BHI A;  2X8B B;  2LA1 A;  4IYE A;  1CXN A;  2I9B E;  1KL8 A;  1ERA A;  2CDX A;  1NYU A;  1ONJ A;  3BT2 U;  2K3G A;  1CHV S;  1RL5 A;  3QB4 B;  1RGJ A;  2BTX A;  2MJ4 A;  1IK8 A;  5DZ5 A;  1CDT A;  1HAA A;  2CRT A;  2JQP A;  1JGK A;  1IDL A;  1CRF A;  2UX2 A;  1CB9 A;  4EY8 B;  1FFJ A;  1ES7 B;  1VB0 A;  1BXP A;  5IMY C;  2N99 A;  1YWH A;  2QJ9 C;  3NEQ A;  1I02 A;  1HC9 A;  3NH7 A;  1NOR A;  2PJY C;  2MJY A;  2LCR A;  2CTX A;  1F8U B;  1CDS A;  2HLR A;  1NTN A;  4QTI U;  5DO6 A;  4AEA A;  2CCX A;  3EBX A;  4DO8 A;  1F94 A;  1TXA A;  2JVE A;  2MJ0 A;  4RUD A;  4XJJ A;  1KXI A;  1TXB A;  1NXB A;  1QKD A;  1G6M A;  1NTX A;  1IJC A;  1BTE A;  4FAO C;  2HLQ A;  1TFS A;  4UY2 C;  4ZQY A;  1LXH A;  1LJZ A;  3ERA A;  3U74 U;  2CRS A;  1KTZ B;  1LSI A;  2QJB C;  1KFH A;  2MUP A;  2H7Z A;  4P7U A;  3U73 U;  1PLO A;  1CDR A;  1HOY A;  2NBT A;  1QKE A;  2H64 C;  2PJY B;  2L03 A;  1W6B A;  1KBT A;  1MAH F;  4HQP F;  4OM5 A;  2ABX A;  1NEA A;  1IKC A;  1NYS A;  1COE A;  2QJA C;  1COD A;  5DU1 A;  1FRA A;  1IDI A;  3HH7 A;  6EBX A;  4OM4 A;  1REW C;  2FD6 U;  3BT1 U;  1HC9 B;  4BIK B;  3FEV A;  1FSC A;  3EVS C;  2L5S A;  1ABT A;  1IDH A;  2UWR A;  1CXO A;  1H0J A;  1HAJ A;  2H5F A;  2H62 C;  1CCQ A;  1KC4 A;  1ZAD A;  4LFT A;  1QM7 A;  2H64 B;  5IMT D;  1IQ9 A;  1V6P A;  2GOO C;  4BDT B;  1KS6 A;  1MR6 A;  2H62 D;  3NDS A;  2ERA A;  2MHY A;  1LXG A; 
#chains in the Genus database with same CATH topology
 2H8U A;  2OFS A;  1UG4 A;  1CVO A;  1XT3 A;  2MFA A;  3PLC A;  1M9Z A;  1L4W A;  3VTS A;  1TGX A;  2H7Z B;  1ERG A;  2QC1 A;  1B41 B;  1IDG A;  1KBA A;  1LX5 B;  3LAQ U;  1DRS A;  1CTX A;  1CDQ A;  1FSS B;  1KU6 B;  1FF4 A;  1S4Y A;  1FAS A;  2J8B A;  4FAO E;  3KFD I;  3KFD E;  1JBD A;  1KBS A;  2VLW A;  5EBX A;  1CRE A;  2MUO A;  2GOO B;  1JE9 A;  2BHI A;  2X8B B;  2LA1 A;  4IYE A;  1CXN A;  2I9B E;  1KL8 A;  1ERA A;  2CDX A;  1NYU A;  1ONJ A;  3BT2 U;  2K3G A;  1CHV S;  1RL5 A;  3QB4 B;  1RGJ A;  2BTX A;  2MJ4 A;  1IK8 A;  5DZ5 A;  1CDT A;  1HAA A;  2CRT A;  2JQP A;  1JGK A;  1IDL A;  1CRF A;  4KSN A;  2UX2 A;  1CB9 A;  4EY8 B;  1FFJ A;  1ES7 B;  1VB0 A;  1BXP A;  5IMY C;  2N99 A;  1YWH A;  2QJ9 C;  3NEQ A;  1I02 A;  1HC9 A;  3NH7 A;  1NOR A;  2PJY C;  2MJY A;  2LCR A;  2CTX A;  1F8U B;  1CDS A;  2HLR A;  1NTN A;  4QTI U;  5DO6 A;  4AEA A;  2CCX A;  3EBX A;  4DO8 A;  1F94 A;  1TXA A;  2JVE A;  2MJ0 A;  4RUD A;  4XJJ A;  1KXI A;  1TXB A;  1NXB A;  1QKD A;  1G6M A;  1NTX A;  1IJC A;  1BTE A;  4FAO C;  2HLQ A;  1TFS A;  4UY2 C;  4ZQY A;  1LXH A;  1LJZ A;  3ERA A;  3U74 U;  2CRS A;  1KTZ B;  1LSI A;  2QJB C;  1KFH A;  2MUP A;  2H7Z A;  4P7U A;  3U73 U;  1PLO A;  1CDR A;  1HOY A;  2NBT A;  1QKE A;  2H64 C;  2PJY B;  2L03 A;  1W6B A;  1KBT A;  1MAH F;  4HQP F;  4OM5 A;  2ABX A;  1NEA A;  1IKC A;  1NYS A;  1COE A;  2QJA C;  1COD A;  5DU1 A;  1FRA A;  1IDI A;  3HH7 A;  6EBX A;  4OM4 A;  1REW C;  2FD6 U;  3BT1 U;  1HC9 B;  4BIK B;  3FEV A;  1FSC A;  3EVS C;  2L5S A;  1ABT A;  1IDH A;  2UWR A;  1CXO A;  1H0J A;  1HAJ A;  2H5F A;  2H62 C;  1CCQ A;  1KC4 A;  1ZAD A;  4LFT A;  1QM7 A;  2H64 B;  5IMT D;  1IQ9 A;  1V6P A;  2GOO C;  4BDT B;  1KS6 A;  1MR6 A;  2H62 D;  3NDS A;  2ERA A;  2MHY A;  1LXG A; 
#chains in the Genus database with same CATH homology
 2H8U A;  2OFS A;  1UG4 A;  1CVO A;  1XT3 A;  2MFA A;  3PLC A;  1M9Z A;  1L4W A;  3VTS A;  1TGX A;  2H7Z B;  1ERG A;  2QC1 A;  1B41 B;  1IDG A;  1KBA A;  1LX5 B;  3LAQ U;  1DRS A;  1CTX A;  1CDQ A;  1FSS B;  1KU6 B;  1FF4 A;  1S4Y A;  1FAS A;  2J8B A;  4FAO E;  3KFD I;  3KFD E;  1JBD A;  1KBS A;  2VLW A;  5EBX A;  1CRE A;  2MUO A;  2GOO B;  1JE9 A;  2BHI A;  2X8B B;  2LA1 A;  4IYE A;  1CXN A;  2I9B E;  1KL8 A;  1ERA A;  2CDX A;  1NYU A;  1ONJ A;  3BT2 U;  2K3G A;  1CHV S;  1RL5 A;  3QB4 B;  1RGJ A;  2BTX A;  2MJ4 A;  1IK8 A;  5DZ5 A;  1CDT A;  1HAA A;  2CRT A;  2JQP A;  1JGK A;  1IDL A;  1CRF A;  4KSN A;  2UX2 A;  1CB9 A;  4EY8 B;  1FFJ A;  1ES7 B;  1VB0 A;  1BXP A;  5IMY C;  2N99 A;  1YWH A;  2QJ9 C;  3NEQ A;  1I02 A;  1HC9 A;  3NH7 A;  1NOR A;  2PJY C;  2MJY A;  2LCR A;  2CTX A;  1F8U B;  1CDS A;  2HLR A;  1NTN A;  4QTI U;  5DO6 A;  4AEA A;  2CCX A;  3EBX A;  4DO8 A;  1F94 A;  1TXA A;  2JVE A;  2MJ0 A;  4RUD A;  4XJJ A;  1KXI A;  1TXB A;  1NXB A;  1QKD A;  1G6M A;  1NTX A;  1IJC A;  1BTE A;  4FAO C;  2HLQ A;  1TFS A;  4UY2 C;  4ZQY A;  1LXH A;  1LJZ A;  3ERA A;  3U74 U;  2CRS A;  1KTZ B;  1LSI A;  2QJB C;  1KFH A;  2MUP A;  2H7Z A;  4P7U A;  3U73 U;  1PLO A;  1CDR A;  1HOY A;  2NBT A;  1QKE A;  2H64 C;  2PJY B;  2L03 A;  1W6B A;  1KBT A;  1MAH F;  4HQP F;  4OM5 A;  2ABX A;  1NEA A;  1IKC A;  1NYS A;  1COE A;  2QJA C;  1COD A;  5DU1 A;  1FRA A;  1IDI A;  3HH7 A;  6EBX A;  4OM4 A;  1REW C;  2FD6 U;  3BT1 U;  1HC9 B;  4BIK B;  3FEV A;  1FSC A;  3EVS C;  2L5S A;  1ABT A;  1IDH A;  2UWR A;  1CXO A;  1H0J A;  1HAJ A;  2H5F A;  2H62 C;  1CCQ A;  1KC4 A;  1ZAD A;  4LFT A;  1QM7 A;  2H64 B;  5IMT D;  1IQ9 A;  1V6P A;  2GOO C;  4BDT B;  1KS6 A;  1MR6 A;  2H62 D;  3NDS A;  2ERA A;  2MHY A;  1LXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...