4HQPF

Alpha7 nicotinic receptor chimera and its complex with alpha bungarotoxin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural principles for Alpha-neurotoxin binding to and selectivity among nicotinic receptors
rcsb
source organism Homo sapiens, lymnaea stagnalis
molecule tags Protein binding
molecule keywords Alpha7 nicotinic receptor chimera
total genus 8
structure length 73
sequence length 73
chains with identical sequence G, H, I, J
ec nomenclature
pdb deposition date 2012-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4hqpF00
2CRTA 2H8UA 1HAJA 2JQPA 1MAHF 3VTSA 3BT2U 1IDHA 1ES7B 1JE9A 1ERAA 1F94A 4LFTA 2J8BA 4IYEA 3U73U 5IMTD 2CTXA 4BIKB 1IQ9A 2HLRA 1XT3A 2JVEA 2QJAC 2LCRA 2X8BB 1CB9A 4QTIU 1FSSB 3BT1U 1HC9B 1BXPA 1L4WA 1CCQA 1KTZB 1TFSA 4P7UA 1UG4A 1S4YA 1NORA 4DO8A 3HH7A 1QM7A 1VB0A 1LSIA 2QJ9C 1CXNA 1FASA 5DU1A 5DZ5A 1M9ZA 2H62C 3KFDI 2FD6U 3PLCA 2CRSA 1CHVS 1H0JA 2L5SA 2H7ZA 1FRAA 1CDTA 4FAOC 1JGKA 1JBDA 1FFJA 1ERGA 2CCXA 1KC4A 5EBXA 4ZQYA 3NDSA 3QB4B 3U74U 1BTEA 2OFSA 2MUOA 1G6MA 2LA1A 4AEAA 2H64C 1IDGA 3EBXA 1RL5A 1CVOA 2QJBC 4XJJA 1DRSA 1YWHA 1NYSA 3EVSC 1CRFA 1FF4A 1F8UB 1CTXA 1RGJA 2I9BE 1QKEA 1ABTA 3NEQA 1HC9A 1IJCA 1MR6A 1I02A 2BTXA 2MUPA 1FSCA 2N99A 2ERAA 1B41B 1CREA 2ABXA 2PJYB 4OM4A 3KFDE 2BHIA 1COEA 1NYUA 2MJ4A 1W6BA 1IK8A 4BDTB 2H64B 1HOYA 2CDXA 1CODA 2MJYA 2UX2A 1ONJA 3ERAA 1IKCA 1V6PA 1LX5B 1KBTA 1QKDA 4EY8B 1NEAA 4RUDA 1KFHA 2MJ0A 1PLOA 4HQPF 2VLWA 1IDLA 1HAAA 2UWRA 1KBAA 1TGXA 1CDSA 4OM5A 3LAQU 1KBSA 1LJZA 1KXIA 1LXHA 1KS6A 1IDIA 3NH7A 1LXGA 2H5FA 5DO6A 1TXBA 1NTNA 4FAOE 5IMYC 2NBTA 2HLQA 1NTXA 2H62D 2L03A 2MHYA 2PJYC 3FEVA 2H7ZB 1CDRA 1REWC 2K3GA 2MFAA 1KU6B 1CDQA 1NXBA 6EBXA 1KL8A 1ZADA 2GOOC 2GOOB 2QC1A 1TXAA 4UY2C 1CXOA
chains in the Genus database with same CATH superfamily
2CRTA 2H8UA 1HAJA 2JQPA 1MAHF 3VTSA 3BT2U 1IDHA 1ES7B 4KSNA 1JE9A 1ERAA 1F94A 4LFTA 2J8BA 4IYEA 3U73U 5IMTD 2CTXA 4BIKB 1IQ9A 2HLRA 1XT3A 2JVEA 2QJAC 2LCRA 2X8BB 1CB9A 4QTIU 1FSSB 3BT1U 1HC9B 1BXPA 1L4WA 1CCQA 1KTZB 1TFSA 4P7UA 1UG4A 1S4YA 1NORA 4DO8A 3HH7A 1QM7A 1VB0A 1LSIA 2QJ9C 1CXNA 1FASA 5DU1A 5DZ5A 1M9ZA 2H62C 3KFDI 2FD6U 3PLCA 2CRSA 1CHVS 1H0JA 2L5SA 2H7ZA 1FRAA 1CDTA 4FAOC 1JGKA 1JBDA 1FFJA 1ERGA 2CCXA 1KC4A 5EBXA 4ZQYA 3NDSA 3QB4B 3U74U 1BTEA 2OFSA 2MUOA 1G6MA 2LA1A 4AEAA 2H64C 1IDGA 3EBXA 1RL5A 1CVOA 2QJBC 4XJJA 1DRSA 1YWHA 1NYSA 3EVSC 1CRFA 1FF4A 1F8UB 1CTXA 1RGJA 2I9BE 1QKEA 1ABTA 3NEQA 1HC9A 1IJCA 1MR6A 1I02A 2BTXA 2MUPA 1FSCA 2N99A 2ERAA 1B41B 1CREA 2ABXA 2PJYB 4OM4A 3KFDE 2BHIA 1COEA 1NYUA 2MJ4A 1W6BA 1IK8A 4BDTB 2H64B 1HOYA 2CDXA 1CODA 2MJYA 2UX2A 1ONJA 3ERAA 1IKCA 1V6PA 1LX5B 1KBTA 1QKDA 4EY8B 1NEAA 4RUDA 1KFHA 2MJ0A 1PLOA 4HQPF 2VLWA 1IDLA 1HAAA 2UWRA 1KBAA 1TGXA 1CDSA 4OM5A 3LAQU 1KBSA 1LJZA 1KXIA 1LXHA 1KS6A 1IDIA 3NH7A 1LXGA 2H5FA 5DO6A 1TXBA 1NTNA 4FAOE 5IMYC 2NBTA 2HLQA 1NTXA 2H62D 2L03A 2MHYA 2PJYC 3FEVA 2H7ZB 1CDRA 1REWC 2K3GA 2MFAA 1KU6B 1CDQA 1NXBA 6EBXA 1KL8A 1ZADA 2GOOC 2GOOB 2QC1A 1TXAA 4UY2C 1CXOA
chains in the Genus database with same CATH topology
2CRTA 2H8UA 1HAJA 2JQPA 1MAHF 3VTSA 3BT2U 1IDHA 1ES7B 4KSNA 1JE9A 1ERAA 1F94A 4LFTA 2J8BA 4IYEA 3U73U 5IMTD 2CTXA 4BIKB 1IQ9A 2HLRA 1XT3A 2JVEA 2QJAC 2LCRA 2X8BB 1CB9A 4QTIU 1FSSB 3BT1U 1HC9B 1BXPA 1L4WA 1CCQA 1KTZB 1TFSA 4P7UA 1UG4A 1S4YA 1NORA 4DO8A 3HH7A 1QM7A 1VB0A 1LSIA 2QJ9C 1CXNA 1FASA 5DU1A 5DZ5A 1M9ZA 2H62C 3KFDI 2FD6U 3PLCA 2CRSA 1CHVS 1H0JA 2L5SA 2H7ZA 1FRAA 1CDTA 4FAOC 1JGKA 1JBDA 1FFJA 1ERGA 2CCXA 1KC4A 5EBXA 4ZQYA 3NDSA 3QB4B 3U74U 1BTEA 2OFSA 2MUOA 1G6MA 2LA1A 4AEAA 2H64C 1IDGA 3EBXA 1RL5A 1CVOA 2QJBC 4XJJA 1DRSA 1YWHA 1NYSA 3EVSC 1CRFA 1FF4A 1F8UB 1CTXA 1RGJA 2I9BE 1QKEA 1ABTA 3NEQA 1HC9A 1IJCA 1MR6A 1I02A 2BTXA 2MUPA 1FSCA 2N99A 2ERAA 1B41B 1CREA 2ABXA 2PJYB 4OM4A 3KFDE 2BHIA 1COEA 1NYUA 2MJ4A 1W6BA 1IK8A 4BDTB 2H64B 1HOYA 2CDXA 1CODA 2MJYA 2UX2A 1ONJA 3ERAA 1IKCA 1V6PA 1LX5B 1KBTA 1QKDA 4EY8B 1NEAA 4RUDA 1KFHA 2MJ0A 1PLOA 4HQPF 2VLWA 1IDLA 1HAAA 2UWRA 1KBAA 1TGXA 1CDSA 4OM5A 3LAQU 1KBSA 1LJZA 1KXIA 1LXHA 1KS6A 1IDIA 3NH7A 1LXGA 2H5FA 5DO6A 1TXBA 1NTNA 4FAOE 5IMYC 2NBTA 2HLQA 1NTXA 2H62D 2L03A 2MHYA 2PJYC 3FEVA 2H7ZB 1CDRA 1REWC 2K3GA 2MFAA 1KU6B 1CDQA 1NXBA 6EBXA 1KL8A 1ZADA 2GOOC 2GOOB 2QC1A 1TXAA 4UY2C 1CXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRT A;  2H8U A;  1HAJ A;  2JQP A;  1MAH F;  3VTS A;  3BT2 U;  1IDH A;  1ES7 B;  1JE9 A;  1ERA A;  1F94 A;  4LFT A;  2J8B A;  4IYE A;  3U73 U;  5IMT D;  2CTX A;  4BIK B;  1IQ9 A;  2HLR A;  1XT3 A;  2JVE A;  2QJA C;  2LCR A;  2X8B B;  1CB9 A;  4QTI U;  1FSS B;  3BT1 U;  1HC9 B;  1BXP A;  1L4W A;  1CCQ A;  1KTZ B;  1TFS A;  4P7U A;  1UG4 A;  1S4Y A;  1NOR A;  4DO8 A;  3HH7 A;  1QM7 A;  1VB0 A;  1LSI A;  2QJ9 C;  1CXN A;  1FAS A;  5DU1 A;  5DZ5 A;  1M9Z A;  2H62 C;  3KFD I;  2FD6 U;  3PLC A;  2CRS A;  1CHV S;  1H0J A;  2L5S A;  2H7Z A;  1FRA A;  1CDT A;  4FAO C;  1JGK A;  1JBD A;  1FFJ A;  1ERG A;  2CCX A;  1KC4 A;  5EBX A;  4ZQY A;  3NDS A;  3QB4 B;  3U74 U;  1BTE A;  2OFS A;  2MUO A;  1G6M A;  2LA1 A;  4AEA A;  2H64 C;  1IDG A;  3EBX A;  1RL5 A;  1CVO A;  2QJB C;  4XJJ A;  1DRS A;  1YWH A;  1NYS A;  3EVS C;  1CRF A;  1FF4 A;  1F8U B;  1CTX A;  1RGJ A;  2I9B E;  1QKE A;  1ABT A;  3NEQ A;  1HC9 A;  1IJC A;  1MR6 A;  1I02 A;  2BTX A;  2MUP A;  1FSC A;  2N99 A;  2ERA A;  1B41 B;  1CRE A;  2ABX A;  2PJY B;  4OM4 A;  3KFD E;  2BHI A;  1COE A;  1NYU A;  2MJ4 A;  1W6B A;  1IK8 A;  4BDT B;  2H64 B;  1HOY A;  2CDX A;  1COD A;  2MJY A;  2UX2 A;  1ONJ A;  3ERA A;  1IKC A;  1V6P A;  1LX5 B;  1KBT A;  1QKD A;  4EY8 B;  1NEA A;  4RUD A;  1KFH A;  2MJ0 A;  1PLO A;  4HQP F;  2VLW A;  1IDL A;  1HAA A;  2UWR A;  1KBA A;  1TGX A;  1CDS A;  4OM5 A;  3LAQ U;  1KBS A;  1LJZ A;  1KXI A;  1LXH A;  1KS6 A;  1IDI A;  3NH7 A;  1LXG A;  2H5F A;  5DO6 A;  1TXB A;  1NTN A;  4FAO E;  5IMY C;  2NBT A;  2HLQ A;  1NTX A;  2H62 D;  2L03 A;  2MHY A;  2PJY C;  3FEV A;  2H7Z B;  1CDR A;  1REW C;  2K3G A;  2MFA A;  1KU6 B;  1CDQ A;  1NXB A;  6EBX A;  1KL8 A;  1ZAD A;  2GOO C;  2GOO B;  2QC1 A;  1TXA A;  4UY2 C;  1CXO A; 
#chains in the Genus database with same CATH topology
 2CRT A;  2H8U A;  1HAJ A;  2JQP A;  1MAH F;  3VTS A;  3BT2 U;  1IDH A;  1ES7 B;  4KSN A;  1JE9 A;  1ERA A;  1F94 A;  4LFT A;  2J8B A;  4IYE A;  3U73 U;  5IMT D;  2CTX A;  4BIK B;  1IQ9 A;  2HLR A;  1XT3 A;  2JVE A;  2QJA C;  2LCR A;  2X8B B;  1CB9 A;  4QTI U;  1FSS B;  3BT1 U;  1HC9 B;  1BXP A;  1L4W A;  1CCQ A;  1KTZ B;  1TFS A;  4P7U A;  1UG4 A;  1S4Y A;  1NOR A;  4DO8 A;  3HH7 A;  1QM7 A;  1VB0 A;  1LSI A;  2QJ9 C;  1CXN A;  1FAS A;  5DU1 A;  5DZ5 A;  1M9Z A;  2H62 C;  3KFD I;  2FD6 U;  3PLC A;  2CRS A;  1CHV S;  1H0J A;  2L5S A;  2H7Z A;  1FRA A;  1CDT A;  4FAO C;  1JGK A;  1JBD A;  1FFJ A;  1ERG A;  2CCX A;  1KC4 A;  5EBX A;  4ZQY A;  3NDS A;  3QB4 B;  3U74 U;  1BTE A;  2OFS A;  2MUO A;  1G6M A;  2LA1 A;  4AEA A;  2H64 C;  1IDG A;  3EBX A;  1RL5 A;  1CVO A;  2QJB C;  4XJJ A;  1DRS A;  1YWH A;  1NYS A;  3EVS C;  1CRF A;  1FF4 A;  1F8U B;  1CTX A;  1RGJ A;  2I9B E;  1QKE A;  1ABT A;  3NEQ A;  1HC9 A;  1IJC A;  1MR6 A;  1I02 A;  2BTX A;  2MUP A;  1FSC A;  2N99 A;  2ERA A;  1B41 B;  1CRE A;  2ABX A;  2PJY B;  4OM4 A;  3KFD E;  2BHI A;  1COE A;  1NYU A;  2MJ4 A;  1W6B A;  1IK8 A;  4BDT B;  2H64 B;  1HOY A;  2CDX A;  1COD A;  2MJY A;  2UX2 A;  1ONJ A;  3ERA A;  1IKC A;  1V6P A;  1LX5 B;  1KBT A;  1QKD A;  4EY8 B;  1NEA A;  4RUD A;  1KFH A;  2MJ0 A;  1PLO A;  4HQP F;  2VLW A;  1IDL A;  1HAA A;  2UWR A;  1KBA A;  1TGX A;  1CDS A;  4OM5 A;  3LAQ U;  1KBS A;  1LJZ A;  1KXI A;  1LXH A;  1KS6 A;  1IDI A;  3NH7 A;  1LXG A;  2H5F A;  5DO6 A;  1TXB A;  1NTN A;  4FAO E;  5IMY C;  2NBT A;  2HLQ A;  1NTX A;  2H62 D;  2L03 A;  2MHY A;  2PJY C;  3FEV A;  2H7Z B;  1CDR A;  1REW C;  2K3G A;  2MFA A;  1KU6 B;  1CDQ A;  1NXB A;  6EBX A;  1KL8 A;  1ZAD A;  2GOO C;  2GOO B;  2QC1 A;  1TXA A;  4UY2 C;  1CXO A; 
#chains in the Genus database with same CATH homology
 2CRT A;  2H8U A;  1HAJ A;  2JQP A;  1MAH F;  3VTS A;  3BT2 U;  1IDH A;  1ES7 B;  4KSN A;  1JE9 A;  1ERA A;  1F94 A;  4LFT A;  2J8B A;  4IYE A;  3U73 U;  5IMT D;  2CTX A;  4BIK B;  1IQ9 A;  2HLR A;  1XT3 A;  2JVE A;  2QJA C;  2LCR A;  2X8B B;  1CB9 A;  4QTI U;  1FSS B;  3BT1 U;  1HC9 B;  1BXP A;  1L4W A;  1CCQ A;  1KTZ B;  1TFS A;  4P7U A;  1UG4 A;  1S4Y A;  1NOR A;  4DO8 A;  3HH7 A;  1QM7 A;  1VB0 A;  1LSI A;  2QJ9 C;  1CXN A;  1FAS A;  5DU1 A;  5DZ5 A;  1M9Z A;  2H62 C;  3KFD I;  2FD6 U;  3PLC A;  2CRS A;  1CHV S;  1H0J A;  2L5S A;  2H7Z A;  1FRA A;  1CDT A;  4FAO C;  1JGK A;  1JBD A;  1FFJ A;  1ERG A;  2CCX A;  1KC4 A;  5EBX A;  4ZQY A;  3NDS A;  3QB4 B;  3U74 U;  1BTE A;  2OFS A;  2MUO A;  1G6M A;  2LA1 A;  4AEA A;  2H64 C;  1IDG A;  3EBX A;  1RL5 A;  1CVO A;  2QJB C;  4XJJ A;  1DRS A;  1YWH A;  1NYS A;  3EVS C;  1CRF A;  1FF4 A;  1F8U B;  1CTX A;  1RGJ A;  2I9B E;  1QKE A;  1ABT A;  3NEQ A;  1HC9 A;  1IJC A;  1MR6 A;  1I02 A;  2BTX A;  2MUP A;  1FSC A;  2N99 A;  2ERA A;  1B41 B;  1CRE A;  2ABX A;  2PJY B;  4OM4 A;  3KFD E;  2BHI A;  1COE A;  1NYU A;  2MJ4 A;  1W6B A;  1IK8 A;  4BDT B;  2H64 B;  1HOY A;  2CDX A;  1COD A;  2MJY A;  2UX2 A;  1ONJ A;  3ERA A;  1IKC A;  1V6P A;  1LX5 B;  1KBT A;  1QKD A;  4EY8 B;  1NEA A;  4RUD A;  1KFH A;  2MJ0 A;  1PLO A;  4HQP F;  2VLW A;  1IDL A;  1HAA A;  2UWR A;  1KBA A;  1TGX A;  1CDS A;  4OM5 A;  3LAQ U;  1KBS A;  1LJZ A;  1KXI A;  1LXH A;  1KS6 A;  1IDI A;  3NH7 A;  1LXG A;  2H5F A;  5DO6 A;  1TXB A;  1NTN A;  4FAO E;  5IMY C;  2NBT A;  2HLQ A;  1NTX A;  2H62 D;  2L03 A;  2MHY A;  2PJY C;  3FEV A;  2H7Z B;  1CDR A;  1REW C;  2K3G A;  2MFA A;  1KU6 B;  1CDQ A;  1NXB A;  6EBX A;  1KL8 A;  1ZAD A;  2GOO C;  2GOO B;  2QC1 A;  1TXA A;  4UY2 C;  1CXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...