4HQPF

Alpha7 nicotinic receptor chimera and its complex with alpha bungarotoxin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha7 nicotinic receptor chimera
publication title Structural principles for Alpha-neurotoxin binding to and selectivity among nicotinic receptors
rcsb
source organism Homo sapiens, lymnaea stagnalis
molecule tags Protein binding
total genus 8
structure length 73
sequence length 73
chains with identical sequence G, H, I, J
ec nomenclature
pdb deposition date 2012-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4hqpF00
2UWRA 2H7ZA 1ERGA 1CODA 2BHIA 1IDHA 1CCQA 1M9ZA 1LX5B 1W6BA 2QJAC 1NTXA 1IK8A 1QM7A 1CVOA 2FD6U 2H62D 1NXBA 1B41B 4UY2C 2VLWA 4FAOE 2QJBC 2MFAA 1CDSA 2MUPA 1KXIA 2LA1A 5DZ5A 2HLQA 1F94A 1RL5A 2MJYA 4BDTB 1KBAA 1PLOA 2L03A 3NDSA 1IKCA 4OM5A 2PJYB 2CRTA 1CTXA 4ZQYA 2CRSA 1LJZA 2MJ0A 3LAQU 1H0JA 5IMYC 3EVSC 1VB0A 1YWHA 1RGJA 4QTIU 4FAOC 1KS6A 1KBTA 1FSSB 1HAAA 1CDTA 1HC9A 1TXAA 2BTXA 1G6MA 1CDQA 1BTEA 2H5FA 1ABTA 1HOYA 1CRFA 1NTNA 1L4WA 4EY8B 6EBXA 1MAHF 3ERAA 1ERAA 1XT3A 3BT2U 1JGKA 2GOOC 3QB4B 1JE9A 1KU6B 5DU1A 2H64B 1CXOA 1KC4A 1KTZB 2QJ9C 3EBXA 4RUDA 2ABXA 1FFJA 1IJCA 1NORA 2MUOA 2CDXA 4BIKB 1F8UB 4HQPF 1KBSA 2ERAA 3HH7A 4DO8A 1FASA 1CREA 1LXHA 1IDGA 1NEAA 1V6PA 2L5SA 5DO6A 3NH7A 3BT1U 2NBTA 3VTSA 2I9BE 1IQ9A 2H7ZB 1NYUA 2PJYC 4P7UA 3KFDI 2MHYA 1IDIA 2K3GA 2LCRA 1TFSA 1ES7B 1KFHA 1QKDA 1BXPA 1I02A 1UG4A 1KL8A 2OFSA 4IYEA 1MR6A 1COEA 4AEAA 3U73U 2HLRA 1FF4A 2N99A 1CB9A 5IMTD 1FRAA 1ONJA 2JVEA 1DRSA 1HAJA 2JQPA 1CHVS 2CTXA 1IDLA 1ZADA 3FEVA 1QKEA 3KFDE 3NEQA 4LFTA 2H64C 3U74U 4OM4A 1LSIA 2CCXA 1FSCA 1S4YA 1CXNA 2X8BB 4XJJA 1LXGA 1NYSA 1TGXA 1JBDA 2UX2A 5EBXA 1TXBA 3PLCA 2H8UA 1HC9B 1CDRA 2J8BA 2GOOB 2H62C 2QC1A 2MJ4A 1REWC
chains in the Genus database with same CATH superfamily
2UWRA 2H7ZA 1ERGA 1CODA 2BHIA 1IDHA 1CCQA 1M9ZA 1LX5B 1W6BA 2QJAC 1NTXA 1IK8A 1QM7A 1CVOA 2FD6U 2H62D 1NXBA 1B41B 4UY2C 2VLWA 4FAOE 2QJBC 2MFAA 1CDSA 2MUPA 1KXIA 2LA1A 5DZ5A 2HLQA 1F94A 1RL5A 2MJYA 4BDTB 1KBAA 1PLOA 2L03A 3NDSA 1IKCA 4OM5A 2PJYB 2CRTA 1CTXA 4ZQYA 2CRSA 1LJZA 2MJ0A 3LAQU 1H0JA 5IMYC 3EVSC 1VB0A 1YWHA 1RGJA 4QTIU 4FAOC 1KS6A 1KBTA 1FSSB 1HAAA 1CDTA 1HC9A 1TXAA 2BTXA 1G6MA 1CDQA 1BTEA 2H5FA 1ABTA 1HOYA 1CRFA 1NTNA 1L4WA 4EY8B 6EBXA 1MAHF 3ERAA 1ERAA 1XT3A 3BT2U 1JGKA 2GOOC 3QB4B 1JE9A 1KU6B 5DU1A 2H64B 1CXOA 1KC4A 1KTZB 2QJ9C 3EBXA 4RUDA 2ABXA 1FFJA 1IJCA 4KSNA 1NORA 2MUOA 2CDXA 4BIKB 1F8UB 4HQPF 1KBSA 2ERAA 3HH7A 4DO8A 1FASA 1CREA 1LXHA 1IDGA 1NEAA 1V6PA 2L5SA 5DO6A 3NH7A 3BT1U 2NBTA 3VTSA 2I9BE 1IQ9A 2H7ZB 1NYUA 2PJYC 4P7UA 3KFDI 2MHYA 1IDIA 2K3GA 2LCRA 1TFSA 1ES7B 1KFHA 1QKDA 1BXPA 1I02A 1UG4A 1KL8A 2OFSA 4IYEA 1MR6A 1COEA 4AEAA 3U73U 2HLRA 1FF4A 2N99A 1CB9A 5IMTD 1FRAA 1ONJA 2JVEA 1DRSA 1HAJA 2JQPA 1CHVS 2CTXA 1IDLA 1ZADA 3FEVA 1QKEA 3KFDE 3NEQA 4LFTA 2H64C 3U74U 4OM4A 1LSIA 2CCXA 1FSCA 1S4YA 1CXNA 2X8BB 4XJJA 1LXGA 1NYSA 1TGXA 1JBDA 2UX2A 5EBXA 1TXBA 3PLCA 2H8UA 1HC9B 1CDRA 2J8BA 2GOOB 2H62C 2QC1A 2MJ4A 1REWC
chains in the Genus database with same CATH topology
2UWRA 2H7ZA 1ERGA 1CODA 2BHIA 1IDHA 1CCQA 1M9ZA 1LX5B 1W6BA 2QJAC 1NTXA 1IK8A 1QM7A 1CVOA 2FD6U 2H62D 1NXBA 1B41B 4UY2C 2VLWA 4FAOE 2QJBC 2MFAA 1CDSA 2MUPA 1KXIA 2LA1A 5DZ5A 2HLQA 1F94A 1RL5A 2MJYA 4BDTB 1KBAA 1PLOA 2L03A 3NDSA 1IKCA 4OM5A 2PJYB 2CRTA 1CTXA 4ZQYA 2CRSA 1LJZA 2MJ0A 3LAQU 1H0JA 5IMYC 3EVSC 1VB0A 1YWHA 1RGJA 4QTIU 4FAOC 1KS6A 1KBTA 1FSSB 1HAAA 1CDTA 1HC9A 1TXAA 2BTXA 1G6MA 1CDQA 1BTEA 2H5FA 1ABTA 1HOYA 1CRFA 1NTNA 1L4WA 4EY8B 6EBXA 1MAHF 3ERAA 1ERAA 1XT3A 3BT2U 1JGKA 2GOOC 3QB4B 1JE9A 1KU6B 5DU1A 2H64B 1CXOA 1KC4A 1KTZB 2QJ9C 3EBXA 4RUDA 2ABXA 1FFJA 1IJCA 4KSNA 1NORA 2MUOA 2CDXA 4BIKB 1F8UB 4HQPF 1KBSA 2ERAA 3HH7A 4DO8A 1FASA 1CREA 1LXHA 1IDGA 1NEAA 1V6PA 2L5SA 5DO6A 3NH7A 3BT1U 2NBTA 3VTSA 2I9BE 1IQ9A 2H7ZB 1NYUA 2PJYC 4P7UA 3KFDI 2MHYA 1IDIA 2K3GA 2LCRA 1TFSA 1ES7B 1KFHA 1QKDA 1BXPA 1I02A 1UG4A 1KL8A 2OFSA 4IYEA 1MR6A 1COEA 4AEAA 3U73U 2HLRA 1FF4A 2N99A 1CB9A 5IMTD 1FRAA 1ONJA 2JVEA 1DRSA 1HAJA 2JQPA 1CHVS 2CTXA 1IDLA 1ZADA 3FEVA 1QKEA 3KFDE 3NEQA 4LFTA 2H64C 3U74U 4OM4A 1LSIA 2CCXA 1FSCA 1S4YA 1CXNA 2X8BB 4XJJA 1LXGA 1NYSA 1TGXA 1JBDA 2UX2A 5EBXA 1TXBA 3PLCA 2H8UA 1HC9B 1CDRA 2J8BA 2GOOB 2H62C 2QC1A 2MJ4A 1REWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWR A;  2H7Z A;  1ERG A;  1COD A;  2BHI A;  1IDH A;  1CCQ A;  1M9Z A;  1LX5 B;  1W6B A;  2QJA C;  1NTX A;  1IK8 A;  1QM7 A;  1CVO A;  2FD6 U;  2H62 D;  1NXB A;  1B41 B;  4UY2 C;  2VLW A;  4FAO E;  2QJB C;  2MFA A;  1CDS A;  2MUP A;  1KXI A;  2LA1 A;  5DZ5 A;  2HLQ A;  1F94 A;  1RL5 A;  2MJY A;  4BDT B;  1KBA A;  1PLO A;  2L03 A;  3NDS A;  1IKC A;  4OM5 A;  2PJY B;  2CRT A;  1CTX A;  4ZQY A;  2CRS A;  1LJZ A;  2MJ0 A;  3LAQ U;  1H0J A;  5IMY C;  3EVS C;  1VB0 A;  1YWH A;  1RGJ A;  4QTI U;  4FAO C;  1KS6 A;  1KBT A;  1FSS B;  1HAA A;  1CDT A;  1HC9 A;  1TXA A;  2BTX A;  1G6M A;  1CDQ A;  1BTE A;  2H5F A;  1ABT A;  1HOY A;  1CRF A;  1NTN A;  1L4W A;  4EY8 B;  6EBX A;  1MAH F;  3ERA A;  1ERA A;  1XT3 A;  3BT2 U;  1JGK A;  2GOO C;  3QB4 B;  1JE9 A;  1KU6 B;  5DU1 A;  2H64 B;  1CXO A;  1KC4 A;  1KTZ B;  2QJ9 C;  3EBX A;  4RUD A;  2ABX A;  1FFJ A;  1IJC A;  1NOR A;  2MUO A;  2CDX A;  4BIK B;  1F8U B;  4HQP F;  1KBS A;  2ERA A;  3HH7 A;  4DO8 A;  1FAS A;  1CRE A;  1LXH A;  1IDG A;  1NEA A;  1V6P A;  2L5S A;  5DO6 A;  3NH7 A;  3BT1 U;  2NBT A;  3VTS A;  2I9B E;  1IQ9 A;  2H7Z B;  1NYU A;  2PJY C;  4P7U A;  3KFD I;  2MHY A;  1IDI A;  2K3G A;  2LCR A;  1TFS A;  1ES7 B;  1KFH A;  1QKD A;  1BXP A;  1I02 A;  1UG4 A;  1KL8 A;  2OFS A;  4IYE A;  1MR6 A;  1COE A;  4AEA A;  3U73 U;  2HLR A;  1FF4 A;  2N99 A;  1CB9 A;  5IMT D;  1FRA A;  1ONJ A;  2JVE A;  1DRS A;  1HAJ A;  2JQP A;  1CHV S;  2CTX A;  1IDL A;  1ZAD A;  3FEV A;  1QKE A;  3KFD E;  3NEQ A;  4LFT A;  2H64 C;  3U74 U;  4OM4 A;  1LSI A;  2CCX A;  1FSC A;  1S4Y A;  1CXN A;  2X8B B;  4XJJ A;  1LXG A;  1NYS A;  1TGX A;  1JBD A;  2UX2 A;  5EBX A;  1TXB A;  3PLC A;  2H8U A;  1HC9 B;  1CDR A;  2J8B A;  2GOO B;  2H62 C;  2QC1 A;  2MJ4 A;  1REW C; 
#chains in the Genus database with same CATH topology
 2UWR A;  2H7Z A;  1ERG A;  1COD A;  2BHI A;  1IDH A;  1CCQ A;  1M9Z A;  1LX5 B;  1W6B A;  2QJA C;  1NTX A;  1IK8 A;  1QM7 A;  1CVO A;  2FD6 U;  2H62 D;  1NXB A;  1B41 B;  4UY2 C;  2VLW A;  4FAO E;  2QJB C;  2MFA A;  1CDS A;  2MUP A;  1KXI A;  2LA1 A;  5DZ5 A;  2HLQ A;  1F94 A;  1RL5 A;  2MJY A;  4BDT B;  1KBA A;  1PLO A;  2L03 A;  3NDS A;  1IKC A;  4OM5 A;  2PJY B;  2CRT A;  1CTX A;  4ZQY A;  2CRS A;  1LJZ A;  2MJ0 A;  3LAQ U;  1H0J A;  5IMY C;  3EVS C;  1VB0 A;  1YWH A;  1RGJ A;  4QTI U;  4FAO C;  1KS6 A;  1KBT A;  1FSS B;  1HAA A;  1CDT A;  1HC9 A;  1TXA A;  2BTX A;  1G6M A;  1CDQ A;  1BTE A;  2H5F A;  1ABT A;  1HOY A;  1CRF A;  1NTN A;  1L4W A;  4EY8 B;  6EBX A;  1MAH F;  3ERA A;  1ERA A;  1XT3 A;  3BT2 U;  1JGK A;  2GOO C;  3QB4 B;  1JE9 A;  1KU6 B;  5DU1 A;  2H64 B;  1CXO A;  1KC4 A;  1KTZ B;  2QJ9 C;  3EBX A;  4RUD A;  2ABX A;  1FFJ A;  1IJC A;  4KSN A;  1NOR A;  2MUO A;  2CDX A;  4BIK B;  1F8U B;  4HQP F;  1KBS A;  2ERA A;  3HH7 A;  4DO8 A;  1FAS A;  1CRE A;  1LXH A;  1IDG A;  1NEA A;  1V6P A;  2L5S A;  5DO6 A;  3NH7 A;  3BT1 U;  2NBT A;  3VTS A;  2I9B E;  1IQ9 A;  2H7Z B;  1NYU A;  2PJY C;  4P7U A;  3KFD I;  2MHY A;  1IDI A;  2K3G A;  2LCR A;  1TFS A;  1ES7 B;  1KFH A;  1QKD A;  1BXP A;  1I02 A;  1UG4 A;  1KL8 A;  2OFS A;  4IYE A;  1MR6 A;  1COE A;  4AEA A;  3U73 U;  2HLR A;  1FF4 A;  2N99 A;  1CB9 A;  5IMT D;  1FRA A;  1ONJ A;  2JVE A;  1DRS A;  1HAJ A;  2JQP A;  1CHV S;  2CTX A;  1IDL A;  1ZAD A;  3FEV A;  1QKE A;  3KFD E;  3NEQ A;  4LFT A;  2H64 C;  3U74 U;  4OM4 A;  1LSI A;  2CCX A;  1FSC A;  1S4Y A;  1CXN A;  2X8B B;  4XJJ A;  1LXG A;  1NYS A;  1TGX A;  1JBD A;  2UX2 A;  5EBX A;  1TXB A;  3PLC A;  2H8U A;  1HC9 B;  1CDR A;  2J8B A;  2GOO B;  2H62 C;  2QC1 A;  2MJ4 A;  1REW C; 
#chains in the Genus database with same CATH homology
 2UWR A;  2H7Z A;  1ERG A;  1COD A;  2BHI A;  1IDH A;  1CCQ A;  1M9Z A;  1LX5 B;  1W6B A;  2QJA C;  1NTX A;  1IK8 A;  1QM7 A;  1CVO A;  2FD6 U;  2H62 D;  1NXB A;  1B41 B;  4UY2 C;  2VLW A;  4FAO E;  2QJB C;  2MFA A;  1CDS A;  2MUP A;  1KXI A;  2LA1 A;  5DZ5 A;  2HLQ A;  1F94 A;  1RL5 A;  2MJY A;  4BDT B;  1KBA A;  1PLO A;  2L03 A;  3NDS A;  1IKC A;  4OM5 A;  2PJY B;  2CRT A;  1CTX A;  4ZQY A;  2CRS A;  1LJZ A;  2MJ0 A;  3LAQ U;  1H0J A;  5IMY C;  3EVS C;  1VB0 A;  1YWH A;  1RGJ A;  4QTI U;  4FAO C;  1KS6 A;  1KBT A;  1FSS B;  1HAA A;  1CDT A;  1HC9 A;  1TXA A;  2BTX A;  1G6M A;  1CDQ A;  1BTE A;  2H5F A;  1ABT A;  1HOY A;  1CRF A;  1NTN A;  1L4W A;  4EY8 B;  6EBX A;  1MAH F;  3ERA A;  1ERA A;  1XT3 A;  3BT2 U;  1JGK A;  2GOO C;  3QB4 B;  1JE9 A;  1KU6 B;  5DU1 A;  2H64 B;  1CXO A;  1KC4 A;  1KTZ B;  2QJ9 C;  3EBX A;  4RUD A;  2ABX A;  1FFJ A;  1IJC A;  4KSN A;  1NOR A;  2MUO A;  2CDX A;  4BIK B;  1F8U B;  4HQP F;  1KBS A;  2ERA A;  3HH7 A;  4DO8 A;  1FAS A;  1CRE A;  1LXH A;  1IDG A;  1NEA A;  1V6P A;  2L5S A;  5DO6 A;  3NH7 A;  3BT1 U;  2NBT A;  3VTS A;  2I9B E;  1IQ9 A;  2H7Z B;  1NYU A;  2PJY C;  4P7U A;  3KFD I;  2MHY A;  1IDI A;  2K3G A;  2LCR A;  1TFS A;  1ES7 B;  1KFH A;  1QKD A;  1BXP A;  1I02 A;  1UG4 A;  1KL8 A;  2OFS A;  4IYE A;  1MR6 A;  1COE A;  4AEA A;  3U73 U;  2HLR A;  1FF4 A;  2N99 A;  1CB9 A;  5IMT D;  1FRA A;  1ONJ A;  2JVE A;  1DRS A;  1HAJ A;  2JQP A;  1CHV S;  2CTX A;  1IDL A;  1ZAD A;  3FEV A;  1QKE A;  3KFD E;  3NEQ A;  4LFT A;  2H64 C;  3U74 U;  4OM4 A;  1LSI A;  2CCX A;  1FSC A;  1S4Y A;  1CXN A;  2X8B B;  4XJJ A;  1LXG A;  1NYS A;  1TGX A;  1JBD A;  2UX2 A;  5EBX A;  1TXB A;  3PLC A;  2H8U A;  1HC9 B;  1CDR A;  2J8B A;  2GOO B;  2H62 C;  2QC1 A;  2MJ4 A;  1REW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...