4HQPF

Alpha7 nicotinic receptor chimera and its complex with alpha bungarotoxin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
b'IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha7 nicotinic receptor chimera
publication title Structural principles for Alpha-neurotoxin binding to and selectivity among nicotinic receptors
rcsb
source organism Homo sapiens, lymnaea stagnalis
molecule tags Protein binding
total genus 8
structure length 73
sequence length 73
chains with identical sequence G, H, I, J
ec nomenclature
pdb deposition date 2012-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4hqpF00
1IDIA 1KC4A 1NEAA 1TXAA 3EBXA 1BTEA 1KL8A 4DO8A 2GOOB 1IDGA 2JVEA 1DRSA 2CCXA 1XT3A 1CTXA 2X8BB 1KBTA 1CDQA 1ERGA 2MJYA 1COEA 2N99A 1HC9A 3ERAA 1CVOA 4P7UA 2J8BA 1F8UB 1I02A 1CCQA 1REWC 1CB9A 1FFJA 1QKEA 2H62D 2MUOA 3FEVA 2UWRA 3QB4B 1MAHF 5DZ5A 5EBXA 4IYEA 3EVSC 3KFDI 1IDHA 1ERAA 1NYSA 1FSCA 1KBSA 1KS6A 1L4WA 1FF4A 1KU6B 4XJJA 2QJAC 4EY8B 4QTIU 2H64C 2QJ9C 1LXHA 2HLRA 3NEQA 1G6MA 2LCRA 2CRTA 2H8UA 1IKCA 1NORA 4ZQYA 1JE9A 1FASA 1HOYA 1QM7A 2L5SA 4RUDA 1CXNA 2HLQA 1UG4A 1ABTA 1CODA 1CXOA 1NYUA 3KFDE 1JBDA 2BTXA 2ERAA 2L03A 1TGXA 1LXGA 1B41B 2PJYC 2MFAA 1KTZB 1JGKA 1TXBA 2H7ZB 2MJ0A 2FD6U 1VB0A 2I9BE 2BHIA 3NDSA 2CDXA 3PLCA 1PLOA 3VTSA 1KXIA 1CDTA 2MHYA 2NBTA 6EBXA 4FAOC 1IJCA 1HAJA 2GOOC 1MR6A 1LX5B 2H64B 1FSSB 1H0JA 1NXBA 3BT2U 1ZADA 2H5FA 1ONJA 2MUPA 4HQPF 1IQ9A 2UX2A 1HC9B 2OFSA 2QJBC 4OM5A 3BT1U 3HH7A 3U73U 4BDTB 1KBAA 2MJ4A 1V6PA 1HAAA 1F94A 5IMTD 3U74U 1FRAA 1RL5A 1CREA 1RGJA 1ES7B 1NTXA 1M9ZA 2LA1A 1BXPA 1CDSA 5DU1A 1KFHA 2JQPA 2PJYB 1CHVS 1S4YA 1LJZA 2QC1A 4OM4A 1CRFA 1YWHA 1W6BA 2CTXA 2ABXA 4UY2C 2H7ZA 1TFSA 2VLWA 1LSIA 2H62C 3NH7A 1NTNA 5DO6A 5IMYC 1IDLA 4FAOE 4LFTA 1QKDA 3LAQU 1CDRA 2K3GA 1IK8A 4AEAA 2CRSA 4BIKB
chains in the Genus database with same CATH superfamily
1IDIA 1KC4A 1NEAA 1TXAA 3EBXA 1BTEA 1KL8A 4DO8A 2GOOB 1IDGA 2JVEA 1DRSA 2CCXA 1XT3A 1CTXA 2X8BB 1KBTA 1CDQA 1ERGA 2MJYA 1COEA 2N99A 1HC9A 3ERAA 1CVOA 4P7UA 2J8BA 1F8UB 1I02A 1CCQA 1REWC 1CB9A 1FFJA 1QKEA 2H62D 2MUOA 3FEVA 2UWRA 3QB4B 1MAHF 5DZ5A 5EBXA 4IYEA 3EVSC 3KFDI 1IDHA 1ERAA 1NYSA 1FSCA 1KBSA 1KS6A 1L4WA 1FF4A 1KU6B 4XJJA 2QJAC 4EY8B 4QTIU 2H64C 2QJ9C 1LXHA 2HLRA 3NEQA 1G6MA 2LCRA 2CRTA 2H8UA 1IKCA 1NORA 4ZQYA 1JE9A 1FASA 4KSNA 1HOYA 1QM7A 2L5SA 4RUDA 1CXNA 2HLQA 1UG4A 1ABTA 1CODA 1CXOA 1NYUA 3KFDE 1JBDA 2BTXA 2ERAA 2L03A 1TGXA 1LXGA 1B41B 2PJYC 2MFAA 1KTZB 1JGKA 1TXBA 2H7ZB 2MJ0A 2FD6U 1VB0A 2I9BE 2BHIA 3NDSA 2CDXA 3PLCA 1PLOA 3VTSA 1KXIA 1CDTA 2MHYA 2NBTA 6EBXA 4FAOC 1IJCA 1HAJA 2GOOC 1MR6A 1LX5B 2H64B 1FSSB 1H0JA 1NXBA 3BT2U 1ZADA 2H5FA 1ONJA 2MUPA 4HQPF 1IQ9A 2UX2A 1HC9B 2OFSA 2QJBC 4OM5A 3BT1U 3HH7A 3U73U 4BDTB 1KBAA 2MJ4A 1V6PA 1HAAA 1F94A 5IMTD 3U74U 1FRAA 1RL5A 1CREA 1RGJA 1ES7B 1NTXA 1M9ZA 2LA1A 1BXPA 1CDSA 5DU1A 1KFHA 2JQPA 2PJYB 1CHVS 1S4YA 1LJZA 2QC1A 4OM4A 1CRFA 1YWHA 1W6BA 2CTXA 2ABXA 4UY2C 2H7ZA 1TFSA 2VLWA 1LSIA 2H62C 3NH7A 1NTNA 5DO6A 5IMYC 1IDLA 4FAOE 4LFTA 1QKDA 3LAQU 1CDRA 2K3GA 1IK8A 4AEAA 2CRSA 4BIKB
chains in the Genus database with same CATH topology
1IDIA 1KC4A 1NEAA 1TXAA 3EBXA 1BTEA 1KL8A 4DO8A 2GOOB 1IDGA 2JVEA 1DRSA 2CCXA 1XT3A 1CTXA 2X8BB 1KBTA 1CDQA 1ERGA 2MJYA 1COEA 2N99A 1HC9A 3ERAA 1CVOA 4P7UA 2J8BA 1F8UB 1I02A 1CCQA 1REWC 1CB9A 1FFJA 1QKEA 2H62D 2MUOA 3FEVA 2UWRA 3QB4B 1MAHF 5DZ5A 5EBXA 4IYEA 3EVSC 3KFDI 1IDHA 1ERAA 1NYSA 1FSCA 1KBSA 1KS6A 1L4WA 1FF4A 1KU6B 4XJJA 2QJAC 4EY8B 4QTIU 2H64C 2QJ9C 1LXHA 2HLRA 3NEQA 1G6MA 2LCRA 2CRTA 2H8UA 1IKCA 1NORA 4ZQYA 1JE9A 1FASA 4KSNA 1HOYA 1QM7A 2L5SA 4RUDA 1CXNA 2HLQA 1UG4A 1ABTA 1CODA 1CXOA 1NYUA 3KFDE 1JBDA 2BTXA 2ERAA 2L03A 1TGXA 1LXGA 1B41B 2PJYC 2MFAA 1KTZB 1JGKA 1TXBA 2H7ZB 2MJ0A 2FD6U 1VB0A 2I9BE 2BHIA 3NDSA 2CDXA 3PLCA 1PLOA 3VTSA 1KXIA 1CDTA 2MHYA 2NBTA 6EBXA 4FAOC 1IJCA 1HAJA 2GOOC 1MR6A 1LX5B 2H64B 1FSSB 1H0JA 1NXBA 3BT2U 1ZADA 2H5FA 1ONJA 2MUPA 4HQPF 1IQ9A 2UX2A 1HC9B 2OFSA 2QJBC 4OM5A 3BT1U 3HH7A 3U73U 4BDTB 1KBAA 2MJ4A 1V6PA 1HAAA 1F94A 5IMTD 3U74U 1FRAA 1RL5A 1CREA 1RGJA 1ES7B 1NTXA 1M9ZA 2LA1A 1BXPA 1CDSA 5DU1A 1KFHA 2JQPA 2PJYB 1CHVS 1S4YA 1LJZA 2QC1A 4OM4A 1CRFA 1YWHA 1W6BA 2CTXA 2ABXA 4UY2C 2H7ZA 1TFSA 2VLWA 1LSIA 2H62C 3NH7A 1NTNA 5DO6A 5IMYC 1IDLA 4FAOE 4LFTA 1QKDA 3LAQU 1CDRA 2K3GA 1IK8A 4AEAA 2CRSA 4BIKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDI A;  1KC4 A;  1NEA A;  1TXA A;  3EBX A;  1BTE A;  1KL8 A;  4DO8 A;  2GOO B;  1IDG A;  2JVE A;  1DRS A;  2CCX A;  1XT3 A;  1CTX A;  2X8B B;  1KBT A;  1CDQ A;  1ERG A;  2MJY A;  1COE A;  2N99 A;  1HC9 A;  3ERA A;  1CVO A;  4P7U A;  2J8B A;  1F8U B;  1I02 A;  1CCQ A;  1REW C;  1CB9 A;  1FFJ A;  1QKE A;  2H62 D;  2MUO A;  3FEV A;  2UWR A;  3QB4 B;  1MAH F;  5DZ5 A;  5EBX A;  4IYE A;  3EVS C;  3KFD I;  1IDH A;  1ERA A;  1NYS A;  1FSC A;  1KBS A;  1KS6 A;  1L4W A;  1FF4 A;  1KU6 B;  4XJJ A;  2QJA C;  4EY8 B;  4QTI U;  2H64 C;  2QJ9 C;  1LXH A;  2HLR A;  3NEQ A;  1G6M A;  2LCR A;  2CRT A;  2H8U A;  1IKC A;  1NOR A;  4ZQY A;  1JE9 A;  1FAS A;  1HOY A;  1QM7 A;  2L5S A;  4RUD A;  1CXN A;  2HLQ A;  1UG4 A;  1ABT A;  1COD A;  1CXO A;  1NYU A;  3KFD E;  1JBD A;  2BTX A;  2ERA A;  2L03 A;  1TGX A;  1LXG A;  1B41 B;  2PJY C;  2MFA A;  1KTZ B;  1JGK A;  1TXB A;  2H7Z B;  2MJ0 A;  2FD6 U;  1VB0 A;  2I9B E;  2BHI A;  3NDS A;  2CDX A;  3PLC A;  1PLO A;  3VTS A;  1KXI A;  1CDT A;  2MHY A;  2NBT A;  6EBX A;  4FAO C;  1IJC A;  1HAJ A;  2GOO C;  1MR6 A;  1LX5 B;  2H64 B;  1FSS B;  1H0J A;  1NXB A;  3BT2 U;  1ZAD A;  2H5F A;  1ONJ A;  2MUP A;  4HQP F;  1IQ9 A;  2UX2 A;  1HC9 B;  2OFS A;  2QJB C;  4OM5 A;  3BT1 U;  3HH7 A;  3U73 U;  4BDT B;  1KBA A;  2MJ4 A;  1V6P A;  1HAA A;  1F94 A;  5IMT D;  3U74 U;  1FRA A;  1RL5 A;  1CRE A;  1RGJ A;  1ES7 B;  1NTX A;  1M9Z A;  2LA1 A;  1BXP A;  1CDS A;  5DU1 A;  1KFH A;  2JQP A;  2PJY B;  1CHV S;  1S4Y A;  1LJZ A;  2QC1 A;  4OM4 A;  1CRF A;  1YWH A;  1W6B A;  2CTX A;  2ABX A;  4UY2 C;  2H7Z A;  1TFS A;  2VLW A;  1LSI A;  2H62 C;  3NH7 A;  1NTN A;  5DO6 A;  5IMY C;  1IDL A;  4FAO E;  4LFT A;  1QKD A;  3LAQ U;  1CDR A;  2K3G A;  1IK8 A;  4AEA A;  2CRS A;  4BIK B; 
#chains in the Genus database with same CATH topology
 1IDI A;  1KC4 A;  1NEA A;  1TXA A;  3EBX A;  1BTE A;  1KL8 A;  4DO8 A;  2GOO B;  1IDG A;  2JVE A;  1DRS A;  2CCX A;  1XT3 A;  1CTX A;  2X8B B;  1KBT A;  1CDQ A;  1ERG A;  2MJY A;  1COE A;  2N99 A;  1HC9 A;  3ERA A;  1CVO A;  4P7U A;  2J8B A;  1F8U B;  1I02 A;  1CCQ A;  1REW C;  1CB9 A;  1FFJ A;  1QKE A;  2H62 D;  2MUO A;  3FEV A;  2UWR A;  3QB4 B;  1MAH F;  5DZ5 A;  5EBX A;  4IYE A;  3EVS C;  3KFD I;  1IDH A;  1ERA A;  1NYS A;  1FSC A;  1KBS A;  1KS6 A;  1L4W A;  1FF4 A;  1KU6 B;  4XJJ A;  2QJA C;  4EY8 B;  4QTI U;  2H64 C;  2QJ9 C;  1LXH A;  2HLR A;  3NEQ A;  1G6M A;  2LCR A;  2CRT A;  2H8U A;  1IKC A;  1NOR A;  4ZQY A;  1JE9 A;  1FAS A;  4KSN A;  1HOY A;  1QM7 A;  2L5S A;  4RUD A;  1CXN A;  2HLQ A;  1UG4 A;  1ABT A;  1COD A;  1CXO A;  1NYU A;  3KFD E;  1JBD A;  2BTX A;  2ERA A;  2L03 A;  1TGX A;  1LXG A;  1B41 B;  2PJY C;  2MFA A;  1KTZ B;  1JGK A;  1TXB A;  2H7Z B;  2MJ0 A;  2FD6 U;  1VB0 A;  2I9B E;  2BHI A;  3NDS A;  2CDX A;  3PLC A;  1PLO A;  3VTS A;  1KXI A;  1CDT A;  2MHY A;  2NBT A;  6EBX A;  4FAO C;  1IJC A;  1HAJ A;  2GOO C;  1MR6 A;  1LX5 B;  2H64 B;  1FSS B;  1H0J A;  1NXB A;  3BT2 U;  1ZAD A;  2H5F A;  1ONJ A;  2MUP A;  4HQP F;  1IQ9 A;  2UX2 A;  1HC9 B;  2OFS A;  2QJB C;  4OM5 A;  3BT1 U;  3HH7 A;  3U73 U;  4BDT B;  1KBA A;  2MJ4 A;  1V6P A;  1HAA A;  1F94 A;  5IMT D;  3U74 U;  1FRA A;  1RL5 A;  1CRE A;  1RGJ A;  1ES7 B;  1NTX A;  1M9Z A;  2LA1 A;  1BXP A;  1CDS A;  5DU1 A;  1KFH A;  2JQP A;  2PJY B;  1CHV S;  1S4Y A;  1LJZ A;  2QC1 A;  4OM4 A;  1CRF A;  1YWH A;  1W6B A;  2CTX A;  2ABX A;  4UY2 C;  2H7Z A;  1TFS A;  2VLW A;  1LSI A;  2H62 C;  3NH7 A;  1NTN A;  5DO6 A;  5IMY C;  1IDL A;  4FAO E;  4LFT A;  1QKD A;  3LAQ U;  1CDR A;  2K3G A;  1IK8 A;  4AEA A;  2CRS A;  4BIK B; 
#chains in the Genus database with same CATH homology
 1IDI A;  1KC4 A;  1NEA A;  1TXA A;  3EBX A;  1BTE A;  1KL8 A;  4DO8 A;  2GOO B;  1IDG A;  2JVE A;  1DRS A;  2CCX A;  1XT3 A;  1CTX A;  2X8B B;  1KBT A;  1CDQ A;  1ERG A;  2MJY A;  1COE A;  2N99 A;  1HC9 A;  3ERA A;  1CVO A;  4P7U A;  2J8B A;  1F8U B;  1I02 A;  1CCQ A;  1REW C;  1CB9 A;  1FFJ A;  1QKE A;  2H62 D;  2MUO A;  3FEV A;  2UWR A;  3QB4 B;  1MAH F;  5DZ5 A;  5EBX A;  4IYE A;  3EVS C;  3KFD I;  1IDH A;  1ERA A;  1NYS A;  1FSC A;  1KBS A;  1KS6 A;  1L4W A;  1FF4 A;  1KU6 B;  4XJJ A;  2QJA C;  4EY8 B;  4QTI U;  2H64 C;  2QJ9 C;  1LXH A;  2HLR A;  3NEQ A;  1G6M A;  2LCR A;  2CRT A;  2H8U A;  1IKC A;  1NOR A;  4ZQY A;  1JE9 A;  1FAS A;  4KSN A;  1HOY A;  1QM7 A;  2L5S A;  4RUD A;  1CXN A;  2HLQ A;  1UG4 A;  1ABT A;  1COD A;  1CXO A;  1NYU A;  3KFD E;  1JBD A;  2BTX A;  2ERA A;  2L03 A;  1TGX A;  1LXG A;  1B41 B;  2PJY C;  2MFA A;  1KTZ B;  1JGK A;  1TXB A;  2H7Z B;  2MJ0 A;  2FD6 U;  1VB0 A;  2I9B E;  2BHI A;  3NDS A;  2CDX A;  3PLC A;  1PLO A;  3VTS A;  1KXI A;  1CDT A;  2MHY A;  2NBT A;  6EBX A;  4FAO C;  1IJC A;  1HAJ A;  2GOO C;  1MR6 A;  1LX5 B;  2H64 B;  1FSS B;  1H0J A;  1NXB A;  3BT2 U;  1ZAD A;  2H5F A;  1ONJ A;  2MUP A;  4HQP F;  1IQ9 A;  2UX2 A;  1HC9 B;  2OFS A;  2QJB C;  4OM5 A;  3BT1 U;  3HH7 A;  3U73 U;  4BDT B;  1KBA A;  2MJ4 A;  1V6P A;  1HAA A;  1F94 A;  5IMT D;  3U74 U;  1FRA A;  1RL5 A;  1CRE A;  1RGJ A;  1ES7 B;  1NTX A;  1M9Z A;  2LA1 A;  1BXP A;  1CDS A;  5DU1 A;  1KFH A;  2JQP A;  2PJY B;  1CHV S;  1S4Y A;  1LJZ A;  2QC1 A;  4OM4 A;  1CRF A;  1YWH A;  1W6B A;  2CTX A;  2ABX A;  4UY2 C;  2H7Z A;  1TFS A;  2VLW A;  1LSI A;  2H62 C;  3NH7 A;  1NTN A;  5DO6 A;  5IMY C;  1IDL A;  4FAO E;  4LFT A;  1QKD A;  3LAQ U;  1CDR A;  2K3G A;  1IK8 A;  4AEA A;  2CRS A;  4BIK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...