4HQPF

Alpha7 nicotinic receptor chimera and its complex with alpha bungarotoxin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Alpha7 nicotinic receptor chimera
publication title Structural principles for Alpha-neurotoxin binding to and selectivity among nicotinic receptors
rcsb
source organism Homo sapiens, lymnaea stagnalis
total genus 8
structure length 73
sequence length 73
chains with identical sequence G, H, I, J
ec nomenclature
pdb deposition date 2012-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4hqpF00
1ERGA 2PJYC 2CRTA 3HH7A 1ES7B 1FFJA 2LA1A 3PLCA 2GOOC 1NTXA 1KFHA 2H7ZA 4FAOC 1FRAA 2BTXA 2MUPA 3KFDE 1IDLA 3KFDI 1S4YA 2H62C 1FASA 1NYSA 1V6PA 2QC1A 1CVOA 1KTZB 2PJYB 1IDHA 1IK8A 1I02A 2MJ0A 1IJCA 2JVEA 1B41B 3FEVA 1KU6B 3EBXA 1LXHA 1KC4A 1IQ9A 4XJJA 1CDRA 1ERAA 1KBSA 3QB4B 4IYEA 1QKDA 3U73U 1HOYA 3ERAA 2H8UA 2HLQA 1KS6A 2MUOA 3U74U 2L5SA 1JBDA 1FSSB 1L4WA 1TFSA 4BIKB 1H0JA 4OM4A 1REWC 4DO8A 1JE9A 4P7UA 1CRFA 1PLOA 1CDTA 2I9BE 5IMYC 1KBAA 1CDQA 1CHVS 1CXNA 3VTSA 1CXOA 5IMTD 2CRSA 1TXBA 4AEAA 6EBXA 1FSCA 2H64B 2LCRA 3NH7A 2OFSA 1RGJA 3EVSC 1QM7A 1CCQA 1YWHA 2J8BA 1G6MA 1NTNA 4BDTB 2CTXA 1BXPA 1XT3A 1CB9A 1IDIA 1MAHF 5DU1A 1CDSA 2H64C 4QTIU 1ABTA 2H7ZB 2MHYA 2FD6U 1TXAA 2MFAA 3BT1U 1FF4A 2ERAA 2BHIA 1W6BA 2QJBC 1ONJA 2HLRA 1NORA 4UY2C 5DO6A 4RUDA 3BT2U 1KBTA 3LAQU 2H62D 1HC9A 1LX5B 1CREA 1F94A 2ABXA 1MR6A 2N99A 2H5FA 2L03A 4EY8B 3NEQA 2CDXA 1BTEA 1F8UB 2MJYA 1TGXA 1CODA 1NXBA 1QKEA 1ZADA 1M9ZA 2VLWA 1LJZA 1JGKA 4FAOE 4OM5A 1LXGA 1NYUA 2QJ9C 4HQPF 2JQPA 2QJAC 2UWRA 1HAAA 1NEAA 3NDSA 1UG4A 1COEA 1HC9B 2MJ4A 1LSIA 1KL8A 2GOOB 1IKCA 1DRSA 2UX2A 5DZ5A 4ZQYA 1IDGA 2K3GA 2X8BB 1CTXA 2NBTA 4LFTA 1VB0A 1HAJA 5EBXA 1KXIA 1RL5A 2CCXA
chains in the Genus database with same CATH superfamily
1ERGA 2PJYC 2CRTA 3HH7A 1ES7B 1FFJA 2LA1A 3PLCA 2GOOC 1NTXA 1KFHA 2H7ZA 4FAOC 1FRAA 2BTXA 2MUPA 3KFDE 1IDLA 3KFDI 1S4YA 2H62C 1FASA 1NYSA 1V6PA 2QC1A 1CVOA 1KTZB 2PJYB 1IDHA 1IK8A 1I02A 2MJ0A 1IJCA 2JVEA 1B41B 3FEVA 1KU6B 3EBXA 1LXHA 1KC4A 1IQ9A 4XJJA 1CDRA 1ERAA 1KBSA 3QB4B 4IYEA 1QKDA 3U73U 1HOYA 3ERAA 2H8UA 2HLQA 1KS6A 2MUOA 3U74U 2L5SA 1JBDA 1FSSB 1L4WA 1TFSA 4BIKB 1H0JA 4OM4A 1REWC 4DO8A 1JE9A 4P7UA 1CRFA 1PLOA 1CDTA 2I9BE 5IMYC 1KBAA 1CDQA 1CHVS 1CXNA 3VTSA 1CXOA 5IMTD 2CRSA 1TXBA 4AEAA 6EBXA 1FSCA 2H64B 2LCRA 3NH7A 2OFSA 1RGJA 3EVSC 1QM7A 1CCQA 1YWHA 2J8BA 1G6MA 1NTNA 4BDTB 2CTXA 1BXPA 1XT3A 1CB9A 1IDIA 1MAHF 5DU1A 1CDSA 2H64C 4QTIU 1ABTA 2H7ZB 2MHYA 2FD6U 1TXAA 2MFAA 3BT1U 1FF4A 2ERAA 2BHIA 1W6BA 2QJBC 1ONJA 2HLRA 1NORA 4UY2C 5DO6A 4RUDA 3BT2U 1KBTA 3LAQU 2H62D 1HC9A 1LX5B 1CREA 1F94A 2ABXA 1MR6A 4KSNA 2N99A 2H5FA 2L03A 4EY8B 3NEQA 2CDXA 1BTEA 1F8UB 2MJYA 1TGXA 1CODA 1NXBA 1QKEA 1ZADA 1M9ZA 2VLWA 1LJZA 1JGKA 4FAOE 4OM5A 1LXGA 1NYUA 2QJ9C 4HQPF 2JQPA 2QJAC 2UWRA 1HAAA 1NEAA 3NDSA 1UG4A 1COEA 1HC9B 2MJ4A 1LSIA 1KL8A 2GOOB 1IKCA 1DRSA 2UX2A 5DZ5A 4ZQYA 1IDGA 2K3GA 2X8BB 1CTXA 2NBTA 4LFTA 1VB0A 1HAJA 5EBXA 1KXIA 1RL5A 2CCXA
chains in the Genus database with same CATH topology
1ERGA 2PJYC 2CRTA 3HH7A 1ES7B 1FFJA 2LA1A 3PLCA 2GOOC 1NTXA 1KFHA 2H7ZA 4FAOC 1FRAA 2BTXA 2MUPA 3KFDE 1IDLA 3KFDI 1S4YA 2H62C 1FASA 1NYSA 1V6PA 2QC1A 1CVOA 1KTZB 2PJYB 1IDHA 1IK8A 1I02A 2MJ0A 1IJCA 2JVEA 1B41B 3FEVA 1KU6B 3EBXA 1LXHA 1KC4A 1IQ9A 4XJJA 1CDRA 1ERAA 1KBSA 3QB4B 4IYEA 1QKDA 3U73U 1HOYA 3ERAA 2H8UA 2HLQA 1KS6A 2MUOA 3U74U 2L5SA 1JBDA 1FSSB 1L4WA 1TFSA 4BIKB 1H0JA 4OM4A 1REWC 4DO8A 1JE9A 4P7UA 1CRFA 1PLOA 1CDTA 2I9BE 5IMYC 1KBAA 1CDQA 1CHVS 1CXNA 3VTSA 1CXOA 5IMTD 2CRSA 1TXBA 4AEAA 6EBXA 1FSCA 2H64B 2LCRA 3NH7A 2OFSA 1RGJA 3EVSC 1QM7A 1CCQA 1YWHA 2J8BA 1G6MA 1NTNA 4BDTB 2CTXA 1BXPA 1XT3A 1CB9A 1IDIA 1MAHF 5DU1A 1CDSA 2H64C 4QTIU 1ABTA 2H7ZB 2MHYA 2FD6U 1TXAA 2MFAA 3BT1U 1FF4A 2ERAA 2BHIA 1W6BA 2QJBC 1ONJA 2HLRA 1NORA 4UY2C 5DO6A 4RUDA 3BT2U 1KBTA 3LAQU 2H62D 1HC9A 1LX5B 1CREA 1F94A 2ABXA 1MR6A 4KSNA 2N99A 2H5FA 2L03A 4EY8B 3NEQA 2CDXA 1BTEA 1F8UB 2MJYA 1TGXA 1CODA 1NXBA 1QKEA 1ZADA 1M9ZA 2VLWA 1LJZA 1JGKA 4FAOE 4OM5A 1LXGA 1NYUA 2QJ9C 4HQPF 2JQPA 2QJAC 2UWRA 1HAAA 1NEAA 3NDSA 1UG4A 1COEA 1HC9B 2MJ4A 1LSIA 1KL8A 2GOOB 1IKCA 1DRSA 2UX2A 5DZ5A 4ZQYA 1IDGA 2K3GA 2X8BB 1CTXA 2NBTA 4LFTA 1VB0A 1HAJA 5EBXA 1KXIA 1RL5A 2CCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERG A;  2PJY C;  2CRT A;  3HH7 A;  1ES7 B;  1FFJ A;  2LA1 A;  3PLC A;  2GOO C;  1NTX A;  1KFH A;  2H7Z A;  4FAO C;  1FRA A;  2BTX A;  2MUP A;  3KFD E;  1IDL A;  3KFD I;  1S4Y A;  2H62 C;  1FAS A;  1NYS A;  1V6P A;  2QC1 A;  1CVO A;  1KTZ B;  2PJY B;  1IDH A;  1IK8 A;  1I02 A;  2MJ0 A;  1IJC A;  2JVE A;  1B41 B;  3FEV A;  1KU6 B;  3EBX A;  1LXH A;  1KC4 A;  1IQ9 A;  4XJJ A;  1CDR A;  1ERA A;  1KBS A;  3QB4 B;  4IYE A;  1QKD A;  3U73 U;  1HOY A;  3ERA A;  2H8U A;  2HLQ A;  1KS6 A;  2MUO A;  3U74 U;  2L5S A;  1JBD A;  1FSS B;  1L4W A;  1TFS A;  4BIK B;  1H0J A;  4OM4 A;  1REW C;  4DO8 A;  1JE9 A;  4P7U A;  1CRF A;  1PLO A;  1CDT A;  2I9B E;  5IMY C;  1KBA A;  1CDQ A;  1CHV S;  1CXN A;  3VTS A;  1CXO A;  5IMT D;  2CRS A;  1TXB A;  4AEA A;  6EBX A;  1FSC A;  2H64 B;  2LCR A;  3NH7 A;  2OFS A;  1RGJ A;  3EVS C;  1QM7 A;  1CCQ A;  1YWH A;  2J8B A;  1G6M A;  1NTN A;  4BDT B;  2CTX A;  1BXP A;  1XT3 A;  1CB9 A;  1IDI A;  1MAH F;  5DU1 A;  1CDS A;  2H64 C;  4QTI U;  1ABT A;  2H7Z B;  2MHY A;  2FD6 U;  1TXA A;  2MFA A;  3BT1 U;  1FF4 A;  2ERA A;  2BHI A;  1W6B A;  2QJB C;  1ONJ A;  2HLR A;  1NOR A;  4UY2 C;  5DO6 A;  4RUD A;  3BT2 U;  1KBT A;  3LAQ U;  2H62 D;  1HC9 A;  1LX5 B;  1CRE A;  1F94 A;  2ABX A;  1MR6 A;  2N99 A;  2H5F A;  2L03 A;  4EY8 B;  3NEQ A;  2CDX A;  1BTE A;  1F8U B;  2MJY A;  1TGX A;  1COD A;  1NXB A;  1QKE A;  1ZAD A;  1M9Z A;  2VLW A;  1LJZ A;  1JGK A;  4FAO E;  4OM5 A;  1LXG A;  1NYU A;  2QJ9 C;  4HQP F;  2JQP A;  2QJA C;  2UWR A;  1HAA A;  1NEA A;  3NDS A;  1UG4 A;  1COE A;  1HC9 B;  2MJ4 A;  1LSI A;  1KL8 A;  2GOO B;  1IKC A;  1DRS A;  2UX2 A;  5DZ5 A;  4ZQY A;  1IDG A;  2K3G A;  2X8B B;  1CTX A;  2NBT A;  4LFT A;  1VB0 A;  1HAJ A;  5EBX A;  1KXI A;  1RL5 A;  2CCX A; 
#chains in the Genus database with same CATH topology
 1ERG A;  2PJY C;  2CRT A;  3HH7 A;  1ES7 B;  1FFJ A;  2LA1 A;  3PLC A;  2GOO C;  1NTX A;  1KFH A;  2H7Z A;  4FAO C;  1FRA A;  2BTX A;  2MUP A;  3KFD E;  1IDL A;  3KFD I;  1S4Y A;  2H62 C;  1FAS A;  1NYS A;  1V6P A;  2QC1 A;  1CVO A;  1KTZ B;  2PJY B;  1IDH A;  1IK8 A;  1I02 A;  2MJ0 A;  1IJC A;  2JVE A;  1B41 B;  3FEV A;  1KU6 B;  3EBX A;  1LXH A;  1KC4 A;  1IQ9 A;  4XJJ A;  1CDR A;  1ERA A;  1KBS A;  3QB4 B;  4IYE A;  1QKD A;  3U73 U;  1HOY A;  3ERA A;  2H8U A;  2HLQ A;  1KS6 A;  2MUO A;  3U74 U;  2L5S A;  1JBD A;  1FSS B;  1L4W A;  1TFS A;  4BIK B;  1H0J A;  4OM4 A;  1REW C;  4DO8 A;  1JE9 A;  4P7U A;  1CRF A;  1PLO A;  1CDT A;  2I9B E;  5IMY C;  1KBA A;  1CDQ A;  1CHV S;  1CXN A;  3VTS A;  1CXO A;  5IMT D;  2CRS A;  1TXB A;  4AEA A;  6EBX A;  1FSC A;  2H64 B;  2LCR A;  3NH7 A;  2OFS A;  1RGJ A;  3EVS C;  1QM7 A;  1CCQ A;  1YWH A;  2J8B A;  1G6M A;  1NTN A;  4BDT B;  2CTX A;  1BXP A;  1XT3 A;  1CB9 A;  1IDI A;  1MAH F;  5DU1 A;  1CDS A;  2H64 C;  4QTI U;  1ABT A;  2H7Z B;  2MHY A;  2FD6 U;  1TXA A;  2MFA A;  3BT1 U;  1FF4 A;  2ERA A;  2BHI A;  1W6B A;  2QJB C;  1ONJ A;  2HLR A;  1NOR A;  4UY2 C;  5DO6 A;  4RUD A;  3BT2 U;  1KBT A;  3LAQ U;  2H62 D;  1HC9 A;  1LX5 B;  1CRE A;  1F94 A;  2ABX A;  1MR6 A;  4KSN A;  2N99 A;  2H5F A;  2L03 A;  4EY8 B;  3NEQ A;  2CDX A;  1BTE A;  1F8U B;  2MJY A;  1TGX A;  1COD A;  1NXB A;  1QKE A;  1ZAD A;  1M9Z A;  2VLW A;  1LJZ A;  1JGK A;  4FAO E;  4OM5 A;  1LXG A;  1NYU A;  2QJ9 C;  4HQP F;  2JQP A;  2QJA C;  2UWR A;  1HAA A;  1NEA A;  3NDS A;  1UG4 A;  1COE A;  1HC9 B;  2MJ4 A;  1LSI A;  1KL8 A;  2GOO B;  1IKC A;  1DRS A;  2UX2 A;  5DZ5 A;  4ZQY A;  1IDG A;  2K3G A;  2X8B B;  1CTX A;  2NBT A;  4LFT A;  1VB0 A;  1HAJ A;  5EBX A;  1KXI A;  1RL5 A;  2CCX A; 
#chains in the Genus database with same CATH homology
 1ERG A;  2PJY C;  2CRT A;  3HH7 A;  1ES7 B;  1FFJ A;  2LA1 A;  3PLC A;  2GOO C;  1NTX A;  1KFH A;  2H7Z A;  4FAO C;  1FRA A;  2BTX A;  2MUP A;  3KFD E;  1IDL A;  3KFD I;  1S4Y A;  2H62 C;  1FAS A;  1NYS A;  1V6P A;  2QC1 A;  1CVO A;  1KTZ B;  2PJY B;  1IDH A;  1IK8 A;  1I02 A;  2MJ0 A;  1IJC A;  2JVE A;  1B41 B;  3FEV A;  1KU6 B;  3EBX A;  1LXH A;  1KC4 A;  1IQ9 A;  4XJJ A;  1CDR A;  1ERA A;  1KBS A;  3QB4 B;  4IYE A;  1QKD A;  3U73 U;  1HOY A;  3ERA A;  2H8U A;  2HLQ A;  1KS6 A;  2MUO A;  3U74 U;  2L5S A;  1JBD A;  1FSS B;  1L4W A;  1TFS A;  4BIK B;  1H0J A;  4OM4 A;  1REW C;  4DO8 A;  1JE9 A;  4P7U A;  1CRF A;  1PLO A;  1CDT A;  2I9B E;  5IMY C;  1KBA A;  1CDQ A;  1CHV S;  1CXN A;  3VTS A;  1CXO A;  5IMT D;  2CRS A;  1TXB A;  4AEA A;  6EBX A;  1FSC A;  2H64 B;  2LCR A;  3NH7 A;  2OFS A;  1RGJ A;  3EVS C;  1QM7 A;  1CCQ A;  1YWH A;  2J8B A;  1G6M A;  1NTN A;  4BDT B;  2CTX A;  1BXP A;  1XT3 A;  1CB9 A;  1IDI A;  1MAH F;  5DU1 A;  1CDS A;  2H64 C;  4QTI U;  1ABT A;  2H7Z B;  2MHY A;  2FD6 U;  1TXA A;  2MFA A;  3BT1 U;  1FF4 A;  2ERA A;  2BHI A;  1W6B A;  2QJB C;  1ONJ A;  2HLR A;  1NOR A;  4UY2 C;  5DO6 A;  4RUD A;  3BT2 U;  1KBT A;  3LAQ U;  2H62 D;  1HC9 A;  1LX5 B;  1CRE A;  1F94 A;  2ABX A;  1MR6 A;  4KSN A;  2N99 A;  2H5F A;  2L03 A;  4EY8 B;  3NEQ A;  2CDX A;  1BTE A;  1F8U B;  2MJY A;  1TGX A;  1COD A;  1NXB A;  1QKE A;  1ZAD A;  1M9Z A;  2VLW A;  1LJZ A;  1JGK A;  4FAO E;  4OM5 A;  1LXG A;  1NYU A;  2QJ9 C;  4HQP F;  2JQP A;  2QJA C;  2UWR A;  1HAA A;  1NEA A;  3NDS A;  1UG4 A;  1COE A;  1HC9 B;  2MJ4 A;  1LSI A;  1KL8 A;  2GOO B;  1IKC A;  1DRS A;  2UX2 A;  5DZ5 A;  4ZQY A;  1IDG A;  2K3G A;  2X8B B;  1CTX A;  2NBT A;  4LFT A;  1VB0 A;  1HAJ A;  5EBX A;  1KXI A;  1RL5 A;  2CCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...