2H5FA

Denmotoxin: a the three-finger toxin from colubrid snake boiga dendrophila with bird-specific activity
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
75
structure length
75
Chain Sequence
VGLPHGFCIQCNRKTWSNCSIGHRCLPYHMTCYTLYKPDENGEMKWAVKGCARMCPTAKSGERVKCCTGASCNSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords denmotoxin
publication title Denmotoxin, a three-finger toxin from the colubrid snake Boiga dendrophila (Mangrove Catsnake) with bird-specific activity.
pubmed doi rcsb
total genus 13
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2h5fA00
1M9ZA 3HH7A 2H64B 1JGKA 2JQPA 1IQ9A 2CRSA 3ERAA 1HAAA 1CDQA 1MR6A 1KC4A 1NTXA 1ABTA 2CRTA 1LSIA 1NTNA 1KBAA 1ONJA 3U73U 1HAJA 2HLRA 5DZ5A 2GOOC 1S4YA 4XJJA 3BT2U 1JBDA 1CCQA 4AEAA 6EBXA 1PLOA 4IYEA 5EBXA 2H64C 2H62D 1KS6A 2UWRA 5DU1A 1NEAA 1NXBA 1ERAA 2OFSA 3PLCA 1QKEA 1BTEA 4RUDA 4DO8A 1FSSB 2H8UA 1CHVS 1NYUA 1LXHA 1CREA 3LAQU 1NORA 1FASA 1JE9A 2FD6U 1CXNA 5IMTD 1CODA 2UX2A 1DRSA 1LJZA 2CDXA 1H0JA 2PJYB 3EVSC 1TXAA 1TGXA 3NH7A 3VTSA 4BIKB 2HLQA 1YWHA 1CDTA 1COEA 1QKDA 4EY8B 2BTXA 1ERGA 3NEQA 5DO6A 1CVOA 1KBTA 1FSCA 1BXPA 1TXBA 3EBXA 2JVEA 4HQPF 1XT3A 3QB4B 1B41B 2LA1A 1IDLA 1TFSA 2N99A 1CXOA 2BHIA 4ZQYA 1L4WA 1NYSA 1FFJA 3U74U 1RGJA 2X8BB 1F8UB 2CCXA 1ES7B 4LFTA 2H5FA 1VB0A 1KL8A 2I9BE 1RL5A 2MHYA 1FRAA 1KU6B 2H62C 1QM7A 1UG4A 5IMYC 1IKCA 1KTZB 3KFDI 1IDGA 2MUOA 2CTXA 1HC9B 1CB9A 1CTXA 3KFDE 1W6BA 1ZADA 1V6PA 2GOOB 2L03A 1IK8A 4OM5A 2MJYA 4UY2C 1CDRA 2QC1A 2K3GA 1CDSA 2H7ZB 1KBSA 2NBTA 2LCRA 1LX5B 4QTIU 1I02A 1HC9A 2J8BA 1IDHA 1KFHA 2L5SA 4FAOE 4OM4A 2PJYC 1REWC 2QJAC 3NDSA 3BT1U 4FAOC 2QJ9C 2QJBC 2ERAA 2H7ZA 1IJCA 2VLWA 4P7UA 1G6MA 3FEVA 1F94A 1FF4A 2MJ4A 1CRFA 1LXGA 2MUPA 1HOYA 2MJ0A 2ABXA 2MFAA 1IDIA 1KXIA 1MAHF 4BDTB
chains in the Genus database with same CATH superfamily
1M9ZA 3HH7A 2H64B 1JGKA 2JQPA 1IQ9A 2CRSA 3ERAA 1HAAA 1CDQA 1MR6A 1KC4A 1NTXA 1ABTA 2CRTA 1LSIA 1NTNA 1KBAA 1ONJA 3U73U 1HAJA 2HLRA 5DZ5A 2GOOC 1S4YA 4XJJA 3BT2U 1JBDA 4KSNA 1CCQA 4AEAA 6EBXA 1PLOA 4IYEA 5EBXA 2H64C 2H62D 1KS6A 2UWRA 5DU1A 1NEAA 1NXBA 1ERAA 2OFSA 3PLCA 1QKEA 1BTEA 4RUDA 4DO8A 1FSSB 2H8UA 1CHVS 1NYUA 1LXHA 1CREA 3LAQU 1NORA 1FASA 1JE9A 2FD6U 1CXNA 5IMTD 1CODA 2UX2A 1DRSA 1LJZA 2CDXA 1H0JA 2PJYB 3EVSC 1TXAA 1TGXA 3NH7A 3VTSA 4BIKB 2HLQA 1YWHA 1CDTA 1COEA 1QKDA 4EY8B 2BTXA 1ERGA 3NEQA 5DO6A 1CVOA 1KBTA 1FSCA 1BXPA 1TXBA 3EBXA 2JVEA 4HQPF 1XT3A 3QB4B 1B41B 2LA1A 1IDLA 1TFSA 2N99A 1CXOA 2BHIA 4ZQYA 1L4WA 1NYSA 1FFJA 3U74U 1RGJA 2X8BB 1F8UB 2CCXA 1ES7B 4LFTA 2H5FA 1VB0A 1KL8A 2I9BE 1RL5A 2MHYA 1FRAA 1KU6B 2H62C 1QM7A 1UG4A 5IMYC 1IKCA 1KTZB 3KFDI 1IDGA 2MUOA 2CTXA 1HC9B 1CB9A 1CTXA 3KFDE 1W6BA 1ZADA 1V6PA 2GOOB 2L03A 1IK8A 4OM5A 2MJYA 4UY2C 1CDRA 2QC1A 2K3GA 1CDSA 2H7ZB 1KBSA 2NBTA 2LCRA 1LX5B 4QTIU 1I02A 1HC9A 2J8BA 1IDHA 1KFHA 2L5SA 4FAOE 4OM4A 2PJYC 1REWC 2QJAC 3NDSA 3BT1U 4FAOC 2QJ9C 2QJBC 2ERAA 2H7ZA 1IJCA 2VLWA 4P7UA 1G6MA 3FEVA 1F94A 1FF4A 2MJ4A 1CRFA 1LXGA 2MUPA 1HOYA 2MJ0A 2ABXA 2MFAA 1IDIA 1KXIA 1MAHF 4BDTB
chains in the Genus database with same CATH topology
1M9ZA 3HH7A 2H64B 1JGKA 2JQPA 1IQ9A 2CRSA 3ERAA 1HAAA 1CDQA 1MR6A 1KC4A 1NTXA 1ABTA 2CRTA 1LSIA 1NTNA 1KBAA 1ONJA 3U73U 1HAJA 2HLRA 5DZ5A 2GOOC 1S4YA 4XJJA 3BT2U 1JBDA 4KSNA 1CCQA 4AEAA 6EBXA 1PLOA 4IYEA 5EBXA 2H64C 2H62D 1KS6A 2UWRA 5DU1A 1NEAA 1NXBA 1ERAA 2OFSA 3PLCA 1QKEA 1BTEA 4RUDA 4DO8A 1FSSB 2H8UA 1CHVS 1NYUA 1LXHA 1CREA 3LAQU 1NORA 1FASA 1JE9A 2FD6U 1CXNA 5IMTD 1CODA 2UX2A 1DRSA 1LJZA 2CDXA 1H0JA 2PJYB 3EVSC 1TXAA 1TGXA 3NH7A 3VTSA 4BIKB 2HLQA 1YWHA 1CDTA 1COEA 1QKDA 4EY8B 2BTXA 1ERGA 3NEQA 5DO6A 1CVOA 1KBTA 1FSCA 1BXPA 1TXBA 3EBXA 2JVEA 4HQPF 1XT3A 3QB4B 1B41B 2LA1A 1IDLA 1TFSA 2N99A 1CXOA 2BHIA 4ZQYA 1L4WA 1NYSA 1FFJA 3U74U 1RGJA 2X8BB 1F8UB 2CCXA 1ES7B 4LFTA 2H5FA 1VB0A 1KL8A 2I9BE 1RL5A 2MHYA 1FRAA 1KU6B 2H62C 1QM7A 1UG4A 5IMYC 1IKCA 1KTZB 3KFDI 1IDGA 2MUOA 2CTXA 1HC9B 1CB9A 1CTXA 3KFDE 1W6BA 1ZADA 1V6PA 2GOOB 2L03A 1IK8A 4OM5A 2MJYA 4UY2C 1CDRA 2QC1A 2K3GA 1CDSA 2H7ZB 1KBSA 2NBTA 2LCRA 1LX5B 4QTIU 1I02A 1HC9A 2J8BA 1IDHA 1KFHA 2L5SA 4FAOE 4OM4A 2PJYC 1REWC 2QJAC 3NDSA 3BT1U 4FAOC 2QJ9C 2QJBC 2ERAA 2H7ZA 1IJCA 2VLWA 4P7UA 1G6MA 3FEVA 1F94A 1FF4A 2MJ4A 1CRFA 1LXGA 2MUPA 1HOYA 2MJ0A 2ABXA 2MFAA 1IDIA 1KXIA 1MAHF 4BDTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9Z A;  3HH7 A;  2H64 B;  1JGK A;  2JQP A;  1IQ9 A;  2CRS A;  3ERA A;  1HAA A;  1CDQ A;  1MR6 A;  1KC4 A;  1NTX A;  1ABT A;  2CRT A;  1LSI A;  1NTN A;  1KBA A;  1ONJ A;  3U73 U;  1HAJ A;  2HLR A;  5DZ5 A;  2GOO C;  1S4Y A;  4XJJ A;  3BT2 U;  1JBD A;  1CCQ A;  4AEA A;  6EBX A;  1PLO A;  4IYE A;  5EBX A;  2H64 C;  2H62 D;  1KS6 A;  2UWR A;  5DU1 A;  1NEA A;  1NXB A;  1ERA A;  2OFS A;  3PLC A;  1QKE A;  1BTE A;  4RUD A;  4DO8 A;  1FSS B;  2H8U A;  1CHV S;  1NYU A;  1LXH A;  1CRE A;  3LAQ U;  1NOR A;  1FAS A;  1JE9 A;  2FD6 U;  1CXN A;  5IMT D;  1COD A;  2UX2 A;  1DRS A;  1LJZ A;  2CDX A;  1H0J A;  2PJY B;  3EVS C;  1TXA A;  1TGX A;  3NH7 A;  3VTS A;  4BIK B;  2HLQ A;  1YWH A;  1CDT A;  1COE A;  1QKD A;  4EY8 B;  2BTX A;  1ERG A;  3NEQ A;  5DO6 A;  1CVO A;  1KBT A;  1FSC A;  1BXP A;  1TXB A;  3EBX A;  2JVE A;  4HQP F;  1XT3 A;  3QB4 B;  1B41 B;  2LA1 A;  1IDL A;  1TFS A;  2N99 A;  1CXO A;  2BHI A;  4ZQY A;  1L4W A;  1NYS A;  1FFJ A;  3U74 U;  1RGJ A;  2X8B B;  1F8U B;  2CCX A;  1ES7 B;  4LFT A;  2H5F A;  1VB0 A;  1KL8 A;  2I9B E;  1RL5 A;  2MHY A;  1FRA A;  1KU6 B;  2H62 C;  1QM7 A;  1UG4 A;  5IMY C;  1IKC A;  1KTZ B;  3KFD I;  1IDG A;  2MUO A;  2CTX A;  1HC9 B;  1CB9 A;  1CTX A;  3KFD E;  1W6B A;  1ZAD A;  1V6P A;  2GOO B;  2L03 A;  1IK8 A;  4OM5 A;  2MJY A;  4UY2 C;  1CDR A;  2QC1 A;  2K3G A;  1CDS A;  2H7Z B;  1KBS A;  2NBT A;  2LCR A;  1LX5 B;  4QTI U;  1I02 A;  1HC9 A;  2J8B A;  1IDH A;  1KFH A;  2L5S A;  4FAO E;  4OM4 A;  2PJY C;  1REW C;  2QJA C;  3NDS A;  3BT1 U;  4FAO C;  2QJ9 C;  2QJB C;  2ERA A;  2H7Z A;  1IJC A;  2VLW A;  4P7U A;  1G6M A;  3FEV A;  1F94 A;  1FF4 A;  2MJ4 A;  1CRF A;  1LXG A;  2MUP A;  1HOY A;  2MJ0 A;  2ABX A;  2MFA A;  1IDI A;  1KXI A;  1MAH F;  4BDT B; 
#chains in the Genus database with same CATH topology
 1M9Z A;  3HH7 A;  2H64 B;  1JGK A;  2JQP A;  1IQ9 A;  2CRS A;  3ERA A;  1HAA A;  1CDQ A;  1MR6 A;  1KC4 A;  1NTX A;  1ABT A;  2CRT A;  1LSI A;  1NTN A;  1KBA A;  1ONJ A;  3U73 U;  1HAJ A;  2HLR A;  5DZ5 A;  2GOO C;  1S4Y A;  4XJJ A;  3BT2 U;  1JBD A;  4KSN A;  1CCQ A;  4AEA A;  6EBX A;  1PLO A;  4IYE A;  5EBX A;  2H64 C;  2H62 D;  1KS6 A;  2UWR A;  5DU1 A;  1NEA A;  1NXB A;  1ERA A;  2OFS A;  3PLC A;  1QKE A;  1BTE A;  4RUD A;  4DO8 A;  1FSS B;  2H8U A;  1CHV S;  1NYU A;  1LXH A;  1CRE A;  3LAQ U;  1NOR A;  1FAS A;  1JE9 A;  2FD6 U;  1CXN A;  5IMT D;  1COD A;  2UX2 A;  1DRS A;  1LJZ A;  2CDX A;  1H0J A;  2PJY B;  3EVS C;  1TXA A;  1TGX A;  3NH7 A;  3VTS A;  4BIK B;  2HLQ A;  1YWH A;  1CDT A;  1COE A;  1QKD A;  4EY8 B;  2BTX A;  1ERG A;  3NEQ A;  5DO6 A;  1CVO A;  1KBT A;  1FSC A;  1BXP A;  1TXB A;  3EBX A;  2JVE A;  4HQP F;  1XT3 A;  3QB4 B;  1B41 B;  2LA1 A;  1IDL A;  1TFS A;  2N99 A;  1CXO A;  2BHI A;  4ZQY A;  1L4W A;  1NYS A;  1FFJ A;  3U74 U;  1RGJ A;  2X8B B;  1F8U B;  2CCX A;  1ES7 B;  4LFT A;  2H5F A;  1VB0 A;  1KL8 A;  2I9B E;  1RL5 A;  2MHY A;  1FRA A;  1KU6 B;  2H62 C;  1QM7 A;  1UG4 A;  5IMY C;  1IKC A;  1KTZ B;  3KFD I;  1IDG A;  2MUO A;  2CTX A;  1HC9 B;  1CB9 A;  1CTX A;  3KFD E;  1W6B A;  1ZAD A;  1V6P A;  2GOO B;  2L03 A;  1IK8 A;  4OM5 A;  2MJY A;  4UY2 C;  1CDR A;  2QC1 A;  2K3G A;  1CDS A;  2H7Z B;  1KBS A;  2NBT A;  2LCR A;  1LX5 B;  4QTI U;  1I02 A;  1HC9 A;  2J8B A;  1IDH A;  1KFH A;  2L5S A;  4FAO E;  4OM4 A;  2PJY C;  1REW C;  2QJA C;  3NDS A;  3BT1 U;  4FAO C;  2QJ9 C;  2QJB C;  2ERA A;  2H7Z A;  1IJC A;  2VLW A;  4P7U A;  1G6M A;  3FEV A;  1F94 A;  1FF4 A;  2MJ4 A;  1CRF A;  1LXG A;  2MUP A;  1HOY A;  2MJ0 A;  2ABX A;  2MFA A;  1IDI A;  1KXI A;  1MAH F;  4BDT B; 
#chains in the Genus database with same CATH homology
 1M9Z A;  3HH7 A;  2H64 B;  1JGK A;  2JQP A;  1IQ9 A;  2CRS A;  3ERA A;  1HAA A;  1CDQ A;  1MR6 A;  1KC4 A;  1NTX A;  1ABT A;  2CRT A;  1LSI A;  1NTN A;  1KBA A;  1ONJ A;  3U73 U;  1HAJ A;  2HLR A;  5DZ5 A;  2GOO C;  1S4Y A;  4XJJ A;  3BT2 U;  1JBD A;  4KSN A;  1CCQ A;  4AEA A;  6EBX A;  1PLO A;  4IYE A;  5EBX A;  2H64 C;  2H62 D;  1KS6 A;  2UWR A;  5DU1 A;  1NEA A;  1NXB A;  1ERA A;  2OFS A;  3PLC A;  1QKE A;  1BTE A;  4RUD A;  4DO8 A;  1FSS B;  2H8U A;  1CHV S;  1NYU A;  1LXH A;  1CRE A;  3LAQ U;  1NOR A;  1FAS A;  1JE9 A;  2FD6 U;  1CXN A;  5IMT D;  1COD A;  2UX2 A;  1DRS A;  1LJZ A;  2CDX A;  1H0J A;  2PJY B;  3EVS C;  1TXA A;  1TGX A;  3NH7 A;  3VTS A;  4BIK B;  2HLQ A;  1YWH A;  1CDT A;  1COE A;  1QKD A;  4EY8 B;  2BTX A;  1ERG A;  3NEQ A;  5DO6 A;  1CVO A;  1KBT A;  1FSC A;  1BXP A;  1TXB A;  3EBX A;  2JVE A;  4HQP F;  1XT3 A;  3QB4 B;  1B41 B;  2LA1 A;  1IDL A;  1TFS A;  2N99 A;  1CXO A;  2BHI A;  4ZQY A;  1L4W A;  1NYS A;  1FFJ A;  3U74 U;  1RGJ A;  2X8B B;  1F8U B;  2CCX A;  1ES7 B;  4LFT A;  2H5F A;  1VB0 A;  1KL8 A;  2I9B E;  1RL5 A;  2MHY A;  1FRA A;  1KU6 B;  2H62 C;  1QM7 A;  1UG4 A;  5IMY C;  1IKC A;  1KTZ B;  3KFD I;  1IDG A;  2MUO A;  2CTX A;  1HC9 B;  1CB9 A;  1CTX A;  3KFD E;  1W6B A;  1ZAD A;  1V6P A;  2GOO B;  2L03 A;  1IK8 A;  4OM5 A;  2MJY A;  4UY2 C;  1CDR A;  2QC1 A;  2K3G A;  1CDS A;  2H7Z B;  1KBS A;  2NBT A;  2LCR A;  1LX5 B;  4QTI U;  1I02 A;  1HC9 A;  2J8B A;  1IDH A;  1KFH A;  2L5S A;  4FAO E;  4OM4 A;  2PJY C;  1REW C;  2QJA C;  3NDS A;  3BT1 U;  4FAO C;  2QJ9 C;  2QJB C;  2ERA A;  2H7Z A;  1IJC A;  2VLW A;  4P7U A;  1G6M A;  3FEV A;  1F94 A;  1FF4 A;  2MJ4 A;  1CRF A;  1LXG A;  2MUP A;  1HOY A;  2MJ0 A;  2ABX A;  2MFA A;  1IDI A;  1KXI A;  1MAH F;  4BDT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...