5DZ5A

Crystal structure of dendroaspis polylepis mambalgin-1 wild-type in p41212 space group
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Mambalgin-1
publication title Mambalgin-1 Pain-relieving Peptide, Stepwise Solid-phase Synthesis, Crystal Structure, and Functional Domain for Acid-sensing Ion Channel 1a Inhibition.
pubmed doi rcsb
total genus 11
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 5dz5A00
1I02A 4BDTB 2J8BA 1LXGA 1QM7A 1RGJA 4XJJA 2I9BE 2QJAC 1CODA 2H7ZA 1ABTA 4AEAA 1CXOA 5IMYC 2LCRA 2CDXA 1IQ9A 2MJ0A 1DRSA 1TGXA 1KC4A 1ERGA 1FSSB 2NBTA 1IJCA 1NXBA 1H0JA 2GOOC 3BT1U 2UWRA 2CRTA 1FFJA 1TXBA 1KBTA 2PJYC 1LXHA 1CCQA 1JBDA 2BTXA 1NTNA 2H8UA 3EVSC 2MFAA 1CDSA 1NYUA 1CVOA 4RUDA 1CTXA 1NYSA 2LA1A 2MJYA 3KFDE 1KU6B 3EBXA 2ABXA 1MAHF 2CRSA 2K3GA 1QKDA 1NTXA 1MR6A 1QKEA 2L03A 1KFHA 4QTIU 1L4WA 4P7UA 4ZQYA 2MJ4A 1COEA 1TFSA 1CXNA 1FF4A 1CB9A 1CRFA 1NEAA 5EBXA 1BXPA 3NDSA 4BIKB 1FSCA 1IDGA 1B41B 1KTZB 3VTSA 1IK8A 1CDTA 4EY8B 2L5SA 3HH7A 5DU1A 3U74U 2X8BB 1ONJA 1CREA 1M9ZA 4OM4A 2H7ZB 2JVEA 2MUPA 1CHVS 1F94A 1REWC 1FASA 4UY2C 4IYEA 4HQPF 1ES7B 1S4YA 1HC9B 1IDHA 1KS6A 3PLCA 3LAQU 2OFSA 2MHYA 2HLQA 1HAAA 2QJBC 1PLOA 1IDLA 3FEVA 4DO8A 2H64B 2H62C 3NH7A 1F8UB 1BTEA 3ERAA 1G6MA 1W6BA 4FAOC 1CDRA 2JQPA 2N99A 1VB0A 1KXIA 1FRAA 1YWHA 6EBXA 1TXAA 1UG4A 4LFTA 1V6PA 1KL8A 2GOOB 1XT3A 1HOYA 2BHIA 2PJYB 1ZADA 1JGKA 2FD6U 1RL5A 2H62D 3BT2U 2CTXA 1IKCA 1LSIA 1JE9A 1HC9A 2QJ9C 1HAJA 1LX5B 5DO6A 1LJZA 4OM5A 2CCXA 4FAOE 5IMTD 1NORA 2H5FA 3KFDI 3U73U 1CDQA 3NEQA 1KBAA 2UX2A 2HLRA 1ERAA 2ERAA 2H64C 2QC1A 2VLWA 1IDIA 3QB4B 1KBSA 5DZ5A 2MUOA
chains in the Genus database with same CATH superfamily
1I02A 4BDTB 2J8BA 1LXGA 1QM7A 1RGJA 4XJJA 2I9BE 2QJAC 1CODA 2H7ZA 1ABTA 4AEAA 1CXOA 5IMYC 2LCRA 2CDXA 1IQ9A 2MJ0A 1DRSA 1TGXA 1KC4A 1ERGA 1FSSB 2NBTA 1IJCA 1NXBA 1H0JA 2GOOC 3BT1U 2UWRA 2CRTA 1FFJA 1TXBA 1KBTA 2PJYC 1LXHA 1CCQA 1JBDA 2BTXA 1NTNA 2H8UA 3EVSC 2MFAA 1CDSA 1NYUA 1CVOA 4RUDA 1CTXA 1NYSA 2LA1A 2MJYA 3KFDE 1KU6B 3EBXA 2ABXA 1MAHF 2CRSA 2K3GA 1QKDA 1NTXA 1MR6A 1QKEA 2L03A 1KFHA 4QTIU 1L4WA 4P7UA 4ZQYA 2MJ4A 1COEA 1TFSA 1CXNA 1FF4A 1CB9A 1CRFA 1NEAA 5EBXA 1BXPA 3NDSA 4BIKB 1FSCA 1IDGA 1B41B 1KTZB 3VTSA 1IK8A 1CDTA 4EY8B 2L5SA 3HH7A 4KSNA 5DU1A 3U74U 2X8BB 1ONJA 1CREA 1M9ZA 4OM4A 2H7ZB 2JVEA 2MUPA 1CHVS 1F94A 1REWC 1FASA 4UY2C 4IYEA 4HQPF 1ES7B 1S4YA 1HC9B 1IDHA 1KS6A 3PLCA 3LAQU 2OFSA 2MHYA 2HLQA 1HAAA 2QJBC 1PLOA 1IDLA 3FEVA 4DO8A 2H64B 2H62C 3NH7A 1F8UB 1BTEA 3ERAA 1G6MA 1W6BA 4FAOC 1CDRA 2JQPA 2N99A 1VB0A 1KXIA 1FRAA 1YWHA 6EBXA 1TXAA 1UG4A 4LFTA 1V6PA 1KL8A 2GOOB 1XT3A 1HOYA 2BHIA 2PJYB 1ZADA 1JGKA 2FD6U 1RL5A 2H62D 3BT2U 2CTXA 1IKCA 1LSIA 1JE9A 1HC9A 2QJ9C 1HAJA 1LX5B 5DO6A 1LJZA 4OM5A 2CCXA 4FAOE 5IMTD 1NORA 2H5FA 3KFDI 3U73U 1CDQA 3NEQA 1KBAA 2UX2A 2HLRA 1ERAA 2ERAA 2H64C 2QC1A 2VLWA 1IDIA 3QB4B 1KBSA 5DZ5A 2MUOA
chains in the Genus database with same CATH topology
1I02A 4BDTB 2J8BA 1LXGA 1QM7A 1RGJA 4XJJA 2I9BE 2QJAC 1CODA 2H7ZA 1ABTA 4AEAA 1CXOA 5IMYC 2LCRA 2CDXA 1IQ9A 2MJ0A 1DRSA 1TGXA 1KC4A 1ERGA 1FSSB 2NBTA 1IJCA 1NXBA 1H0JA 2GOOC 3BT1U 2UWRA 2CRTA 1FFJA 1TXBA 1KBTA 2PJYC 1LXHA 1CCQA 1JBDA 2BTXA 1NTNA 2H8UA 3EVSC 2MFAA 1CDSA 1NYUA 1CVOA 4RUDA 1CTXA 1NYSA 2LA1A 2MJYA 3KFDE 1KU6B 3EBXA 2ABXA 1MAHF 2CRSA 2K3GA 1QKDA 1NTXA 1MR6A 1QKEA 2L03A 1KFHA 4QTIU 1L4WA 4P7UA 4ZQYA 2MJ4A 1COEA 1TFSA 1CXNA 1FF4A 1CB9A 1CRFA 1NEAA 5EBXA 1BXPA 3NDSA 4BIKB 1FSCA 1IDGA 1B41B 1KTZB 3VTSA 1IK8A 1CDTA 4EY8B 2L5SA 3HH7A 4KSNA 5DU1A 3U74U 2X8BB 1ONJA 1CREA 1M9ZA 4OM4A 2H7ZB 2JVEA 2MUPA 1CHVS 1F94A 1REWC 1FASA 4UY2C 4IYEA 4HQPF 1ES7B 1S4YA 1HC9B 1IDHA 1KS6A 3PLCA 3LAQU 2OFSA 2MHYA 2HLQA 1HAAA 2QJBC 1PLOA 1IDLA 3FEVA 4DO8A 2H64B 2H62C 3NH7A 1F8UB 1BTEA 3ERAA 1G6MA 1W6BA 4FAOC 1CDRA 2JQPA 2N99A 1VB0A 1KXIA 1FRAA 1YWHA 6EBXA 1TXAA 1UG4A 4LFTA 1V6PA 1KL8A 2GOOB 1XT3A 1HOYA 2BHIA 2PJYB 1ZADA 1JGKA 2FD6U 1RL5A 2H62D 3BT2U 2CTXA 1IKCA 1LSIA 1JE9A 1HC9A 2QJ9C 1HAJA 1LX5B 5DO6A 1LJZA 4OM5A 2CCXA 4FAOE 5IMTD 1NORA 2H5FA 3KFDI 3U73U 1CDQA 3NEQA 1KBAA 2UX2A 2HLRA 1ERAA 2ERAA 2H64C 2QC1A 2VLWA 1IDIA 3QB4B 1KBSA 5DZ5A 2MUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I02 A;  4BDT B;  2J8B A;  1LXG A;  1QM7 A;  1RGJ A;  4XJJ A;  2I9B E;  2QJA C;  1COD A;  2H7Z A;  1ABT A;  4AEA A;  1CXO A;  5IMY C;  2LCR A;  2CDX A;  1IQ9 A;  2MJ0 A;  1DRS A;  1TGX A;  1KC4 A;  1ERG A;  1FSS B;  2NBT A;  1IJC A;  1NXB A;  1H0J A;  2GOO C;  3BT1 U;  2UWR A;  2CRT A;  1FFJ A;  1TXB A;  1KBT A;  2PJY C;  1LXH A;  1CCQ A;  1JBD A;  2BTX A;  1NTN A;  2H8U A;  3EVS C;  2MFA A;  1CDS A;  1NYU A;  1CVO A;  4RUD A;  1CTX A;  1NYS A;  2LA1 A;  2MJY A;  3KFD E;  1KU6 B;  3EBX A;  2ABX A;  1MAH F;  2CRS A;  2K3G A;  1QKD A;  1NTX A;  1MR6 A;  1QKE A;  2L03 A;  1KFH A;  4QTI U;  1L4W A;  4P7U A;  4ZQY A;  2MJ4 A;  1COE A;  1TFS A;  1CXN A;  1FF4 A;  1CB9 A;  1CRF A;  1NEA A;  5EBX A;  1BXP A;  3NDS A;  4BIK B;  1FSC A;  1IDG A;  1B41 B;  1KTZ B;  3VTS A;  1IK8 A;  1CDT A;  4EY8 B;  2L5S A;  3HH7 A;  5DU1 A;  3U74 U;  2X8B B;  1ONJ A;  1CRE A;  1M9Z A;  4OM4 A;  2H7Z B;  2JVE A;  2MUP A;  1CHV S;  1F94 A;  1REW C;  1FAS A;  4UY2 C;  4IYE A;  4HQP F;  1ES7 B;  1S4Y A;  1HC9 B;  1IDH A;  1KS6 A;  3PLC A;  3LAQ U;  2OFS A;  2MHY A;  2HLQ A;  1HAA A;  2QJB C;  1PLO A;  1IDL A;  3FEV A;  4DO8 A;  2H64 B;  2H62 C;  3NH7 A;  1F8U B;  1BTE A;  3ERA A;  1G6M A;  1W6B A;  4FAO C;  1CDR A;  2JQP A;  2N99 A;  1VB0 A;  1KXI A;  1FRA A;  1YWH A;  6EBX A;  1TXA A;  1UG4 A;  4LFT A;  1V6P A;  1KL8 A;  2GOO B;  1XT3 A;  1HOY A;  2BHI A;  2PJY B;  1ZAD A;  1JGK A;  2FD6 U;  1RL5 A;  2H62 D;  3BT2 U;  2CTX A;  1IKC A;  1LSI A;  1JE9 A;  1HC9 A;  2QJ9 C;  1HAJ A;  1LX5 B;  5DO6 A;  1LJZ A;  4OM5 A;  2CCX A;  4FAO E;  5IMT D;  1NOR A;  2H5F A;  3KFD I;  3U73 U;  1CDQ A;  3NEQ A;  1KBA A;  2UX2 A;  2HLR A;  1ERA A;  2ERA A;  2H64 C;  2QC1 A;  2VLW A;  1IDI A;  3QB4 B;  1KBS A;  5DZ5 A;  2MUO A; 
#chains in the Genus database with same CATH topology
 1I02 A;  4BDT B;  2J8B A;  1LXG A;  1QM7 A;  1RGJ A;  4XJJ A;  2I9B E;  2QJA C;  1COD A;  2H7Z A;  1ABT A;  4AEA A;  1CXO A;  5IMY C;  2LCR A;  2CDX A;  1IQ9 A;  2MJ0 A;  1DRS A;  1TGX A;  1KC4 A;  1ERG A;  1FSS B;  2NBT A;  1IJC A;  1NXB A;  1H0J A;  2GOO C;  3BT1 U;  2UWR A;  2CRT A;  1FFJ A;  1TXB A;  1KBT A;  2PJY C;  1LXH A;  1CCQ A;  1JBD A;  2BTX A;  1NTN A;  2H8U A;  3EVS C;  2MFA A;  1CDS A;  1NYU A;  1CVO A;  4RUD A;  1CTX A;  1NYS A;  2LA1 A;  2MJY A;  3KFD E;  1KU6 B;  3EBX A;  2ABX A;  1MAH F;  2CRS A;  2K3G A;  1QKD A;  1NTX A;  1MR6 A;  1QKE A;  2L03 A;  1KFH A;  4QTI U;  1L4W A;  4P7U A;  4ZQY A;  2MJ4 A;  1COE A;  1TFS A;  1CXN A;  1FF4 A;  1CB9 A;  1CRF A;  1NEA A;  5EBX A;  1BXP A;  3NDS A;  4BIK B;  1FSC A;  1IDG A;  1B41 B;  1KTZ B;  3VTS A;  1IK8 A;  1CDT A;  4EY8 B;  2L5S A;  3HH7 A;  4KSN A;  5DU1 A;  3U74 U;  2X8B B;  1ONJ A;  1CRE A;  1M9Z A;  4OM4 A;  2H7Z B;  2JVE A;  2MUP A;  1CHV S;  1F94 A;  1REW C;  1FAS A;  4UY2 C;  4IYE A;  4HQP F;  1ES7 B;  1S4Y A;  1HC9 B;  1IDH A;  1KS6 A;  3PLC A;  3LAQ U;  2OFS A;  2MHY A;  2HLQ A;  1HAA A;  2QJB C;  1PLO A;  1IDL A;  3FEV A;  4DO8 A;  2H64 B;  2H62 C;  3NH7 A;  1F8U B;  1BTE A;  3ERA A;  1G6M A;  1W6B A;  4FAO C;  1CDR A;  2JQP A;  2N99 A;  1VB0 A;  1KXI A;  1FRA A;  1YWH A;  6EBX A;  1TXA A;  1UG4 A;  4LFT A;  1V6P A;  1KL8 A;  2GOO B;  1XT3 A;  1HOY A;  2BHI A;  2PJY B;  1ZAD A;  1JGK A;  2FD6 U;  1RL5 A;  2H62 D;  3BT2 U;  2CTX A;  1IKC A;  1LSI A;  1JE9 A;  1HC9 A;  2QJ9 C;  1HAJ A;  1LX5 B;  5DO6 A;  1LJZ A;  4OM5 A;  2CCX A;  4FAO E;  5IMT D;  1NOR A;  2H5F A;  3KFD I;  3U73 U;  1CDQ A;  3NEQ A;  1KBA A;  2UX2 A;  2HLR A;  1ERA A;  2ERA A;  2H64 C;  2QC1 A;  2VLW A;  1IDI A;  3QB4 B;  1KBS A;  5DZ5 A;  2MUO A; 
#chains in the Genus database with same CATH homology
 1I02 A;  4BDT B;  2J8B A;  1LXG A;  1QM7 A;  1RGJ A;  4XJJ A;  2I9B E;  2QJA C;  1COD A;  2H7Z A;  1ABT A;  4AEA A;  1CXO A;  5IMY C;  2LCR A;  2CDX A;  1IQ9 A;  2MJ0 A;  1DRS A;  1TGX A;  1KC4 A;  1ERG A;  1FSS B;  2NBT A;  1IJC A;  1NXB A;  1H0J A;  2GOO C;  3BT1 U;  2UWR A;  2CRT A;  1FFJ A;  1TXB A;  1KBT A;  2PJY C;  1LXH A;  1CCQ A;  1JBD A;  2BTX A;  1NTN A;  2H8U A;  3EVS C;  2MFA A;  1CDS A;  1NYU A;  1CVO A;  4RUD A;  1CTX A;  1NYS A;  2LA1 A;  2MJY A;  3KFD E;  1KU6 B;  3EBX A;  2ABX A;  1MAH F;  2CRS A;  2K3G A;  1QKD A;  1NTX A;  1MR6 A;  1QKE A;  2L03 A;  1KFH A;  4QTI U;  1L4W A;  4P7U A;  4ZQY A;  2MJ4 A;  1COE A;  1TFS A;  1CXN A;  1FF4 A;  1CB9 A;  1CRF A;  1NEA A;  5EBX A;  1BXP A;  3NDS A;  4BIK B;  1FSC A;  1IDG A;  1B41 B;  1KTZ B;  3VTS A;  1IK8 A;  1CDT A;  4EY8 B;  2L5S A;  3HH7 A;  4KSN A;  5DU1 A;  3U74 U;  2X8B B;  1ONJ A;  1CRE A;  1M9Z A;  4OM4 A;  2H7Z B;  2JVE A;  2MUP A;  1CHV S;  1F94 A;  1REW C;  1FAS A;  4UY2 C;  4IYE A;  4HQP F;  1ES7 B;  1S4Y A;  1HC9 B;  1IDH A;  1KS6 A;  3PLC A;  3LAQ U;  2OFS A;  2MHY A;  2HLQ A;  1HAA A;  2QJB C;  1PLO A;  1IDL A;  3FEV A;  4DO8 A;  2H64 B;  2H62 C;  3NH7 A;  1F8U B;  1BTE A;  3ERA A;  1G6M A;  1W6B A;  4FAO C;  1CDR A;  2JQP A;  2N99 A;  1VB0 A;  1KXI A;  1FRA A;  1YWH A;  6EBX A;  1TXA A;  1UG4 A;  4LFT A;  1V6P A;  1KL8 A;  2GOO B;  1XT3 A;  1HOY A;  2BHI A;  2PJY B;  1ZAD A;  1JGK A;  2FD6 U;  1RL5 A;  2H62 D;  3BT2 U;  2CTX A;  1IKC A;  1LSI A;  1JE9 A;  1HC9 A;  2QJ9 C;  1HAJ A;  1LX5 B;  5DO6 A;  1LJZ A;  4OM5 A;  2CCX A;  4FAO E;  5IMT D;  1NOR A;  2H5F A;  3KFD I;  3U73 U;  1CDQ A;  3NEQ A;  1KBA A;  2UX2 A;  2HLR A;  1ERA A;  2ERA A;  2H64 C;  2QC1 A;  2VLW A;  1IDI A;  3QB4 B;  1KBS A;  5DZ5 A;  2MUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...