5DZ5A

Crystal structure of dendroaspis polylepis mambalgin-1 wild-type in p41212 space group
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
b'LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mambalgin-1
publication title Mambalgin-1 Pain-relieving Peptide, Stepwise Solid-phase Synthesis, Crystal Structure, and Functional Domain for Acid-sensing Ion Channel 1a Inhibition.
pubmed doi rcsb
molecule tags Toxin
total genus 11
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 5dz5A00
1B41B 1IDGA 2PJYB 2GOOB 2L5SA 4BDTB 1KS6A 1CDRA 2GOOC 1VB0A 1KL8A 1CTXA 1CXNA 4EY8B 3QB4B 4OM4A 2JVEA 1CRFA 1IK8A 1ONJA 4QTIU 1NYUA 2H62C 1CB9A 3ERAA 3U74U 2MUPA 1HAJA 4LFTA 2CRSA 3KFDE 1F94A 1JGKA 4RUDA 2H7ZA 1FASA 1BTEA 1KU6B 1LXGA 2H7ZB 2N99A 2H8UA 4IYEA 2I9BE 3BT1U 4P7UA 3BT2U 1HOYA 1ES7B 1KBSA 1KXIA 2QC1A 1KFHA 2H64B 2H64C 2UWRA 2CDXA 1KTZB 5DO6A 1QKDA 3U73U 1LJZA 1YWHA 1W6BA 1LXHA 1FSCA 1G6MA 1ERGA 5IMTD 1LSIA 1IQ9A 1HC9A 1UG4A 2OFSA 1HC9B 1ZADA 5IMYC 3HH7A 3LAQU 1JBDA 4ZQYA 4DO8A 1TFSA 1BXPA 5DZ5A 2QJBC 2H5FA 2QJ9C 2ERAA 1JE9A 1TGXA 1NEAA 1KBAA 2MHYA 1QKEA 1ABTA 1PLOA 1L4WA 2MJ0A 5DU1A 4FAOC 1TXAA 2FD6U 4FAOE 1IDLA 2CRTA 2BHIA 1ERAA 1NORA 2L03A 1IKCA 2CTXA 1FF4A 2H62D 1HAAA 1MAHF 2BTXA 2HLQA 1KBTA 1LX5B 2HLRA 2ABXA 2MJ4A 1TXBA 1NTXA 1CXOA 3EBXA 6EBXA 1CDQA 1M9ZA 1REWC 1NTNA 2MUOA 1CODA 1MR6A 1CVOA 2UX2A 2LA1A 1RL5A 1S4YA 2X8BB 3EVSC 2PJYC 2K3GA 2MJYA 2J8BA 2LCRA 1FRAA 1NXBA 1IDIA 3PLCA 3VTSA 1F8UB 1CDSA 1IJCA 2QJAC 2VLWA 1V6PA 1FSSB 1I02A 1RGJA 1CHVS 4BIKB 5EBXA 1KC4A 1DRSA 2NBTA 1XT3A 4UY2C 2JQPA 1FFJA 1CREA 4XJJA 1IDHA 2MFAA 3KFDI 3NEQA 1CCQA 3FEVA 4OM5A 1QM7A 2CCXA 4AEAA 1H0JA 4HQPF 3NH7A 1COEA 3NDSA 1NYSA 1CDTA
chains in the Genus database with same CATH superfamily
1B41B 1IDGA 2PJYB 2GOOB 2L5SA 4BDTB 1KS6A 1CDRA 2GOOC 1VB0A 1KL8A 1CTXA 1CXNA 4EY8B 3QB4B 4OM4A 2JVEA 1CRFA 1IK8A 1ONJA 4QTIU 1NYUA 2H62C 1CB9A 3ERAA 3U74U 2MUPA 1HAJA 4LFTA 2CRSA 3KFDE 1F94A 1JGKA 4RUDA 2H7ZA 1FASA 1BTEA 1KU6B 1LXGA 2H7ZB 2N99A 2H8UA 4IYEA 2I9BE 3BT1U 4P7UA 3BT2U 1HOYA 1ES7B 1KBSA 1KXIA 2QC1A 1KFHA 2H64B 2H64C 2UWRA 2CDXA 1KTZB 5DO6A 1QKDA 3U73U 1LJZA 1YWHA 1W6BA 1LXHA 1FSCA 1G6MA 1ERGA 5IMTD 1LSIA 1IQ9A 1HC9A 1UG4A 2OFSA 1HC9B 1ZADA 5IMYC 3HH7A 3LAQU 4KSNA 1JBDA 4ZQYA 4DO8A 1TFSA 1BXPA 5DZ5A 2QJBC 2H5FA 2QJ9C 2ERAA 1JE9A 1TGXA 1NEAA 1KBAA 2MHYA 1QKEA 1ABTA 1PLOA 1L4WA 2MJ0A 5DU1A 4FAOC 1TXAA 2FD6U 4FAOE 1IDLA 2CRTA 2BHIA 1ERAA 1NORA 2L03A 1IKCA 2CTXA 1FF4A 2H62D 1HAAA 1MAHF 2BTXA 2HLQA 1KBTA 1LX5B 2HLRA 2ABXA 2MJ4A 1TXBA 1NTXA 1CXOA 3EBXA 6EBXA 1CDQA 1M9ZA 1REWC 1NTNA 2MUOA 1CODA 1MR6A 1CVOA 2UX2A 2LA1A 1RL5A 1S4YA 2X8BB 3EVSC 2PJYC 2K3GA 2MJYA 2J8BA 2LCRA 1FRAA 1NXBA 1IDIA 3PLCA 3VTSA 1F8UB 1CDSA 1IJCA 2QJAC 2VLWA 1V6PA 1FSSB 1I02A 1RGJA 1CHVS 4BIKB 5EBXA 1KC4A 1DRSA 2NBTA 1XT3A 4UY2C 2JQPA 1FFJA 1CREA 4XJJA 1IDHA 2MFAA 3KFDI 3NEQA 1CCQA 3FEVA 4OM5A 1QM7A 2CCXA 4AEAA 1H0JA 4HQPF 3NH7A 1COEA 3NDSA 1NYSA 1CDTA
chains in the Genus database with same CATH topology
1B41B 1IDGA 2PJYB 2GOOB 2L5SA 4BDTB 1KS6A 1CDRA 2GOOC 1VB0A 1KL8A 1CTXA 1CXNA 4EY8B 3QB4B 4OM4A 2JVEA 1CRFA 1IK8A 1ONJA 4QTIU 1NYUA 2H62C 1CB9A 3ERAA 3U74U 2MUPA 1HAJA 4LFTA 2CRSA 3KFDE 1F94A 1JGKA 4RUDA 2H7ZA 1FASA 1BTEA 1KU6B 1LXGA 2H7ZB 2N99A 2H8UA 4IYEA 2I9BE 3BT1U 4P7UA 3BT2U 1HOYA 1ES7B 1KBSA 1KXIA 2QC1A 1KFHA 2H64B 2H64C 2UWRA 2CDXA 1KTZB 5DO6A 1QKDA 3U73U 1LJZA 1YWHA 1W6BA 1LXHA 1FSCA 1G6MA 1ERGA 5IMTD 1LSIA 1IQ9A 1HC9A 1UG4A 2OFSA 1HC9B 1ZADA 5IMYC 3HH7A 3LAQU 4KSNA 1JBDA 4ZQYA 4DO8A 1TFSA 1BXPA 5DZ5A 2QJBC 2H5FA 2QJ9C 2ERAA 1JE9A 1TGXA 1NEAA 1KBAA 2MHYA 1QKEA 1ABTA 1PLOA 1L4WA 2MJ0A 5DU1A 4FAOC 1TXAA 2FD6U 4FAOE 1IDLA 2CRTA 2BHIA 1ERAA 1NORA 2L03A 1IKCA 2CTXA 1FF4A 2H62D 1HAAA 1MAHF 2BTXA 2HLQA 1KBTA 1LX5B 2HLRA 2ABXA 2MJ4A 1TXBA 1NTXA 1CXOA 3EBXA 6EBXA 1CDQA 1M9ZA 1REWC 1NTNA 2MUOA 1CODA 1MR6A 1CVOA 2UX2A 2LA1A 1RL5A 1S4YA 2X8BB 3EVSC 2PJYC 2K3GA 2MJYA 2J8BA 2LCRA 1FRAA 1NXBA 1IDIA 3PLCA 3VTSA 1F8UB 1CDSA 1IJCA 2QJAC 2VLWA 1V6PA 1FSSB 1I02A 1RGJA 1CHVS 4BIKB 5EBXA 1KC4A 1DRSA 2NBTA 1XT3A 4UY2C 2JQPA 1FFJA 1CREA 4XJJA 1IDHA 2MFAA 3KFDI 3NEQA 1CCQA 3FEVA 4OM5A 1QM7A 2CCXA 4AEAA 1H0JA 4HQPF 3NH7A 1COEA 3NDSA 1NYSA 1CDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B41 B;  1IDG A;  2PJY B;  2GOO B;  2L5S A;  4BDT B;  1KS6 A;  1CDR A;  2GOO C;  1VB0 A;  1KL8 A;  1CTX A;  1CXN A;  4EY8 B;  3QB4 B;  4OM4 A;  2JVE A;  1CRF A;  1IK8 A;  1ONJ A;  4QTI U;  1NYU A;  2H62 C;  1CB9 A;  3ERA A;  3U74 U;  2MUP A;  1HAJ A;  4LFT A;  2CRS A;  3KFD E;  1F94 A;  1JGK A;  4RUD A;  2H7Z A;  1FAS A;  1BTE A;  1KU6 B;  1LXG A;  2H7Z B;  2N99 A;  2H8U A;  4IYE A;  2I9B E;  3BT1 U;  4P7U A;  3BT2 U;  1HOY A;  1ES7 B;  1KBS A;  1KXI A;  2QC1 A;  1KFH A;  2H64 B;  2H64 C;  2UWR A;  2CDX A;  1KTZ B;  5DO6 A;  1QKD A;  3U73 U;  1LJZ A;  1YWH A;  1W6B A;  1LXH A;  1FSC A;  1G6M A;  1ERG A;  5IMT D;  1LSI A;  1IQ9 A;  1HC9 A;  1UG4 A;  2OFS A;  1HC9 B;  1ZAD A;  5IMY C;  3HH7 A;  3LAQ U;  1JBD A;  4ZQY A;  4DO8 A;  1TFS A;  1BXP A;  5DZ5 A;  2QJB C;  2H5F A;  2QJ9 C;  2ERA A;  1JE9 A;  1TGX A;  1NEA A;  1KBA A;  2MHY A;  1QKE A;  1ABT A;  1PLO A;  1L4W A;  2MJ0 A;  5DU1 A;  4FAO C;  1TXA A;  2FD6 U;  4FAO E;  1IDL A;  2CRT A;  2BHI A;  1ERA A;  1NOR A;  2L03 A;  1IKC A;  2CTX A;  1FF4 A;  2H62 D;  1HAA A;  1MAH F;  2BTX A;  2HLQ A;  1KBT A;  1LX5 B;  2HLR A;  2ABX A;  2MJ4 A;  1TXB A;  1NTX A;  1CXO A;  3EBX A;  6EBX A;  1CDQ A;  1M9Z A;  1REW C;  1NTN A;  2MUO A;  1COD A;  1MR6 A;  1CVO A;  2UX2 A;  2LA1 A;  1RL5 A;  1S4Y A;  2X8B B;  3EVS C;  2PJY C;  2K3G A;  2MJY A;  2J8B A;  2LCR A;  1FRA A;  1NXB A;  1IDI A;  3PLC A;  3VTS A;  1F8U B;  1CDS A;  1IJC A;  2QJA C;  2VLW A;  1V6P A;  1FSS B;  1I02 A;  1RGJ A;  1CHV S;  4BIK B;  5EBX A;  1KC4 A;  1DRS A;  2NBT A;  1XT3 A;  4UY2 C;  2JQP A;  1FFJ A;  1CRE A;  4XJJ A;  1IDH A;  2MFA A;  3KFD I;  3NEQ A;  1CCQ A;  3FEV A;  4OM5 A;  1QM7 A;  2CCX A;  4AEA A;  1H0J A;  4HQP F;  3NH7 A;  1COE A;  3NDS A;  1NYS A;  1CDT A; 
#chains in the Genus database with same CATH topology
 1B41 B;  1IDG A;  2PJY B;  2GOO B;  2L5S A;  4BDT B;  1KS6 A;  1CDR A;  2GOO C;  1VB0 A;  1KL8 A;  1CTX A;  1CXN A;  4EY8 B;  3QB4 B;  4OM4 A;  2JVE A;  1CRF A;  1IK8 A;  1ONJ A;  4QTI U;  1NYU A;  2H62 C;  1CB9 A;  3ERA A;  3U74 U;  2MUP A;  1HAJ A;  4LFT A;  2CRS A;  3KFD E;  1F94 A;  1JGK A;  4RUD A;  2H7Z A;  1FAS A;  1BTE A;  1KU6 B;  1LXG A;  2H7Z B;  2N99 A;  2H8U A;  4IYE A;  2I9B E;  3BT1 U;  4P7U A;  3BT2 U;  1HOY A;  1ES7 B;  1KBS A;  1KXI A;  2QC1 A;  1KFH A;  2H64 B;  2H64 C;  2UWR A;  2CDX A;  1KTZ B;  5DO6 A;  1QKD A;  3U73 U;  1LJZ A;  1YWH A;  1W6B A;  1LXH A;  1FSC A;  1G6M A;  1ERG A;  5IMT D;  1LSI A;  1IQ9 A;  1HC9 A;  1UG4 A;  2OFS A;  1HC9 B;  1ZAD A;  5IMY C;  3HH7 A;  3LAQ U;  4KSN A;  1JBD A;  4ZQY A;  4DO8 A;  1TFS A;  1BXP A;  5DZ5 A;  2QJB C;  2H5F A;  2QJ9 C;  2ERA A;  1JE9 A;  1TGX A;  1NEA A;  1KBA A;  2MHY A;  1QKE A;  1ABT A;  1PLO A;  1L4W A;  2MJ0 A;  5DU1 A;  4FAO C;  1TXA A;  2FD6 U;  4FAO E;  1IDL A;  2CRT A;  2BHI A;  1ERA A;  1NOR A;  2L03 A;  1IKC A;  2CTX A;  1FF4 A;  2H62 D;  1HAA A;  1MAH F;  2BTX A;  2HLQ A;  1KBT A;  1LX5 B;  2HLR A;  2ABX A;  2MJ4 A;  1TXB A;  1NTX A;  1CXO A;  3EBX A;  6EBX A;  1CDQ A;  1M9Z A;  1REW C;  1NTN A;  2MUO A;  1COD A;  1MR6 A;  1CVO A;  2UX2 A;  2LA1 A;  1RL5 A;  1S4Y A;  2X8B B;  3EVS C;  2PJY C;  2K3G A;  2MJY A;  2J8B A;  2LCR A;  1FRA A;  1NXB A;  1IDI A;  3PLC A;  3VTS A;  1F8U B;  1CDS A;  1IJC A;  2QJA C;  2VLW A;  1V6P A;  1FSS B;  1I02 A;  1RGJ A;  1CHV S;  4BIK B;  5EBX A;  1KC4 A;  1DRS A;  2NBT A;  1XT3 A;  4UY2 C;  2JQP A;  1FFJ A;  1CRE A;  4XJJ A;  1IDH A;  2MFA A;  3KFD I;  3NEQ A;  1CCQ A;  3FEV A;  4OM5 A;  1QM7 A;  2CCX A;  4AEA A;  1H0J A;  4HQP F;  3NH7 A;  1COE A;  3NDS A;  1NYS A;  1CDT A; 
#chains in the Genus database with same CATH homology
 1B41 B;  1IDG A;  2PJY B;  2GOO B;  2L5S A;  4BDT B;  1KS6 A;  1CDR A;  2GOO C;  1VB0 A;  1KL8 A;  1CTX A;  1CXN A;  4EY8 B;  3QB4 B;  4OM4 A;  2JVE A;  1CRF A;  1IK8 A;  1ONJ A;  4QTI U;  1NYU A;  2H62 C;  1CB9 A;  3ERA A;  3U74 U;  2MUP A;  1HAJ A;  4LFT A;  2CRS A;  3KFD E;  1F94 A;  1JGK A;  4RUD A;  2H7Z A;  1FAS A;  1BTE A;  1KU6 B;  1LXG A;  2H7Z B;  2N99 A;  2H8U A;  4IYE A;  2I9B E;  3BT1 U;  4P7U A;  3BT2 U;  1HOY A;  1ES7 B;  1KBS A;  1KXI A;  2QC1 A;  1KFH A;  2H64 B;  2H64 C;  2UWR A;  2CDX A;  1KTZ B;  5DO6 A;  1QKD A;  3U73 U;  1LJZ A;  1YWH A;  1W6B A;  1LXH A;  1FSC A;  1G6M A;  1ERG A;  5IMT D;  1LSI A;  1IQ9 A;  1HC9 A;  1UG4 A;  2OFS A;  1HC9 B;  1ZAD A;  5IMY C;  3HH7 A;  3LAQ U;  4KSN A;  1JBD A;  4ZQY A;  4DO8 A;  1TFS A;  1BXP A;  5DZ5 A;  2QJB C;  2H5F A;  2QJ9 C;  2ERA A;  1JE9 A;  1TGX A;  1NEA A;  1KBA A;  2MHY A;  1QKE A;  1ABT A;  1PLO A;  1L4W A;  2MJ0 A;  5DU1 A;  4FAO C;  1TXA A;  2FD6 U;  4FAO E;  1IDL A;  2CRT A;  2BHI A;  1ERA A;  1NOR A;  2L03 A;  1IKC A;  2CTX A;  1FF4 A;  2H62 D;  1HAA A;  1MAH F;  2BTX A;  2HLQ A;  1KBT A;  1LX5 B;  2HLR A;  2ABX A;  2MJ4 A;  1TXB A;  1NTX A;  1CXO A;  3EBX A;  6EBX A;  1CDQ A;  1M9Z A;  1REW C;  1NTN A;  2MUO A;  1COD A;  1MR6 A;  1CVO A;  2UX2 A;  2LA1 A;  1RL5 A;  1S4Y A;  2X8B B;  3EVS C;  2PJY C;  2K3G A;  2MJY A;  2J8B A;  2LCR A;  1FRA A;  1NXB A;  1IDI A;  3PLC A;  3VTS A;  1F8U B;  1CDS A;  1IJC A;  2QJA C;  2VLW A;  1V6P A;  1FSS B;  1I02 A;  1RGJ A;  1CHV S;  4BIK B;  5EBX A;  1KC4 A;  1DRS A;  2NBT A;  1XT3 A;  4UY2 C;  2JQP A;  1FFJ A;  1CRE A;  4XJJ A;  1IDH A;  2MFA A;  3KFD I;  3NEQ A;  1CCQ A;  3FEV A;  4OM5 A;  1QM7 A;  2CCX A;  4AEA A;  1H0J A;  4HQP F;  3NH7 A;  1COE A;  3NDS A;  1NYS A;  1CDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...