2LA1A

Expression in pichia pastoris and backbone dynamics of dendroaspin, a three finger toxin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
RICYNHLGTKPPTTETCQEDSCYKNIWTFDNIIRRGCGCFTPRGDMPGPYCCESDKCNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mambin
publication title Dynamics and functional differences between dendroaspin and rhodostomin: Insights into protein scaffolds in integrin recognition
pubmed doi rcsb
source organism Dendroaspis jamesoni kaimosae
molecule tags Toxin
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2011-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2la1A00
1ERGA 3KFDI 1CODA 2MFAA 2GOOB 4FAOE 3LAQU 1LX5B 2VLWA 1XT3A 3ERAA 3PLCA 1ONJA 1NTXA 1IK8A 3KFDE 1TXBA 1CDRA 1BXPA 1FFJA 4ZQYA 1CCQA 1FF4A 1ZADA 1L4WA 2NBTA 4OM5A 2CRTA 1CREA 5DU1A 4DO8A 6EBXA 1COEA 1LJZA 1LXHA 1CXOA 4QTIU 1RGJA 5EBXA 1HAJA 2BHIA 2H64C 2MHYA 4EY8B 3U73U 1H0JA 1TXAA 2FD6U 3NEQA 5DO6A 1ABTA 2JVEA 2H64B 1IDHA 1LSIA 1FRAA 2H62D 1F8UB 1KBAA 1KS6A 2UWRA 1B41B 4HQPF 2LCRA 1KXIA 2X8BB 2UX2A 4UY2C 1V6PA 1HC9B 1IQ9A 1F94A 2ABXA 2H62C 1VB0A 1CB9A 1KFHA 1QKEA 4P7UA 1IDLA 3VTSA 1KBSA 3NDSA 2PJYB 1CRFA 2QJAC 1IDGA 2L03A 2HLQA 1G6MA 1DRSA 1NTNA 2H7ZA 4IYEA 1RL5A 1CTXA 1KC4A 1MR6A 1NORA 2H5FA 1MAHF 1KTZB 1CXNA 2QJ9C 1BTEA 1CDQA 1S4YA 3HH7A 1IJCA 3EVSC 1PLOA 2QJBC 2N99A 1TGXA 1IKCA 2K3GA 1KL8A 3NH7A 1CHVS 1ERAA 1FASA 4BIKB 1NYSA 5IMTD 4BDTB 1I02A 3BT1U 1REWC 3FEVA 4XJJA 1YWHA 2PJYC 1JGKA 2MJ4A 2MJ0A 4RUDA 3U74U 1HAAA 2CCXA 1KBTA 1HC9A 2JQPA 4OM4A 1CVOA 1TFSA 1NXBA 2MJYA 1QKDA 2I9BE 1QM7A 2CRSA 2QC1A 1LXGA 4LFTA 1ES7B 1CDSA 2BTXA 1FSCA 2CDXA 2H8UA 1NEAA 1KU6B 1IDIA 2MUPA 3QB4B 1W6BA 2LA1A 2MUOA 5DZ5A 1JE9A 1NYUA 2J8BA 2H7ZB 5IMYC 2L5SA 1HOYA 2ERAA 4AEAA 2HLRA 2OFSA 1JBDA 1UG4A 2CTXA 1CDTA 1FSSB 2GOOC 4FAOC 1M9ZA 3EBXA 3BT2U
chains in the Genus database with same CATH superfamily
1ERGA 3KFDI 1CODA 2MFAA 2GOOB 4FAOE 3LAQU 1LX5B 2VLWA 1XT3A 3ERAA 3PLCA 1ONJA 1NTXA 1IK8A 3KFDE 4KSNA 1TXBA 1CDRA 1BXPA 1FFJA 4ZQYA 1CCQA 1FF4A 1ZADA 1L4WA 2NBTA 4OM5A 2CRTA 1CREA 5DU1A 4DO8A 6EBXA 1COEA 1LJZA 1LXHA 1CXOA 4QTIU 1RGJA 5EBXA 1HAJA 2BHIA 2H64C 2MHYA 4EY8B 3U73U 1H0JA 1TXAA 2FD6U 3NEQA 5DO6A 1ABTA 2JVEA 2H64B 1IDHA 1LSIA 1FRAA 2H62D 1F8UB 1KBAA 1KS6A 2UWRA 1B41B 4HQPF 2LCRA 1KXIA 2X8BB 2UX2A 4UY2C 1V6PA 1HC9B 1IQ9A 1F94A 2ABXA 2H62C 1VB0A 1CB9A 1KFHA 1QKEA 4P7UA 1IDLA 3VTSA 1KBSA 3NDSA 2PJYB 1CRFA 2QJAC 1IDGA 2L03A 2HLQA 1G6MA 1DRSA 1NTNA 2H7ZA 4IYEA 1RL5A 1CTXA 1KC4A 1MR6A 1NORA 2H5FA 1MAHF 1KTZB 1CXNA 2QJ9C 1BTEA 1CDQA 1S4YA 3HH7A 1IJCA 3EVSC 1PLOA 2QJBC 2N99A 1TGXA 1IKCA 2K3GA 1KL8A 3NH7A 1CHVS 1ERAA 1FASA 4BIKB 1NYSA 5IMTD 4BDTB 1I02A 3BT1U 1REWC 3FEVA 4XJJA 1YWHA 2PJYC 1JGKA 2MJ4A 2MJ0A 4RUDA 3U74U 1HAAA 2CCXA 1KBTA 1HC9A 2JQPA 4OM4A 1CVOA 1TFSA 1NXBA 2MJYA 1QKDA 2I9BE 1QM7A 2CRSA 2QC1A 1LXGA 4LFTA 1ES7B 1CDSA 2BTXA 1FSCA 2CDXA 2H8UA 1NEAA 1KU6B 1IDIA 2MUPA 3QB4B 1W6BA 2LA1A 2MUOA 5DZ5A 1JE9A 1NYUA 2J8BA 2H7ZB 5IMYC 2L5SA 1HOYA 2ERAA 4AEAA 2HLRA 2OFSA 1JBDA 1UG4A 2CTXA 1CDTA 1FSSB 2GOOC 4FAOC 1M9ZA 3EBXA 3BT2U
chains in the Genus database with same CATH topology
1ERGA 3KFDI 1CODA 2MFAA 2GOOB 4FAOE 3LAQU 1LX5B 2VLWA 1XT3A 3ERAA 3PLCA 1ONJA 1NTXA 1IK8A 3KFDE 4KSNA 1TXBA 1CDRA 1BXPA 1FFJA 4ZQYA 1CCQA 1FF4A 1ZADA 1L4WA 2NBTA 4OM5A 2CRTA 1CREA 5DU1A 4DO8A 6EBXA 1COEA 1LJZA 1LXHA 1CXOA 4QTIU 1RGJA 5EBXA 1HAJA 2BHIA 2H64C 2MHYA 4EY8B 3U73U 1H0JA 1TXAA 2FD6U 3NEQA 5DO6A 1ABTA 2JVEA 2H64B 1IDHA 1LSIA 1FRAA 2H62D 1F8UB 1KBAA 1KS6A 2UWRA 1B41B 4HQPF 2LCRA 1KXIA 2X8BB 2UX2A 4UY2C 1V6PA 1HC9B 1IQ9A 1F94A 2ABXA 2H62C 1VB0A 1CB9A 1KFHA 1QKEA 4P7UA 1IDLA 3VTSA 1KBSA 3NDSA 2PJYB 1CRFA 2QJAC 1IDGA 2L03A 2HLQA 1G6MA 1DRSA 1NTNA 2H7ZA 4IYEA 1RL5A 1CTXA 1KC4A 1MR6A 1NORA 2H5FA 1MAHF 1KTZB 1CXNA 2QJ9C 1BTEA 1CDQA 1S4YA 3HH7A 1IJCA 3EVSC 1PLOA 2QJBC 2N99A 1TGXA 1IKCA 2K3GA 1KL8A 3NH7A 1CHVS 1ERAA 1FASA 4BIKB 1NYSA 5IMTD 4BDTB 1I02A 3BT1U 1REWC 3FEVA 4XJJA 1YWHA 2PJYC 1JGKA 2MJ4A 2MJ0A 4RUDA 3U74U 1HAAA 2CCXA 1KBTA 1HC9A 2JQPA 4OM4A 1CVOA 1TFSA 1NXBA 2MJYA 1QKDA 2I9BE 1QM7A 2CRSA 2QC1A 1LXGA 4LFTA 1ES7B 1CDSA 2BTXA 1FSCA 2CDXA 2H8UA 1NEAA 1KU6B 1IDIA 2MUPA 3QB4B 1W6BA 2LA1A 2MUOA 5DZ5A 1JE9A 1NYUA 2J8BA 2H7ZB 5IMYC 2L5SA 1HOYA 2ERAA 4AEAA 2HLRA 2OFSA 1JBDA 1UG4A 2CTXA 1CDTA 1FSSB 2GOOC 4FAOC 1M9ZA 3EBXA 3BT2U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERG A;  3KFD I;  1COD A;  2MFA A;  2GOO B;  4FAO E;  3LAQ U;  1LX5 B;  2VLW A;  1XT3 A;  3ERA A;  3PLC A;  1ONJ A;  1NTX A;  1IK8 A;  3KFD E;  1TXB A;  1CDR A;  1BXP A;  1FFJ A;  4ZQY A;  1CCQ A;  1FF4 A;  1ZAD A;  1L4W A;  2NBT A;  4OM5 A;  2CRT A;  1CRE A;  5DU1 A;  4DO8 A;  6EBX A;  1COE A;  1LJZ A;  1LXH A;  1CXO A;  4QTI U;  1RGJ A;  5EBX A;  1HAJ A;  2BHI A;  2H64 C;  2MHY A;  4EY8 B;  3U73 U;  1H0J A;  1TXA A;  2FD6 U;  3NEQ A;  5DO6 A;  1ABT A;  2JVE A;  2H64 B;  1IDH A;  1LSI A;  1FRA A;  2H62 D;  1F8U B;  1KBA A;  1KS6 A;  2UWR A;  1B41 B;  4HQP F;  2LCR A;  1KXI A;  2X8B B;  2UX2 A;  4UY2 C;  1V6P A;  1HC9 B;  1IQ9 A;  1F94 A;  2ABX A;  2H62 C;  1VB0 A;  1CB9 A;  1KFH A;  1QKE A;  4P7U A;  1IDL A;  3VTS A;  1KBS A;  3NDS A;  2PJY B;  1CRF A;  2QJA C;  1IDG A;  2L03 A;  2HLQ A;  1G6M A;  1DRS A;  1NTN A;  2H7Z A;  4IYE A;  1RL5 A;  1CTX A;  1KC4 A;  1MR6 A;  1NOR A;  2H5F A;  1MAH F;  1KTZ B;  1CXN A;  2QJ9 C;  1BTE A;  1CDQ A;  1S4Y A;  3HH7 A;  1IJC A;  3EVS C;  1PLO A;  2QJB C;  2N99 A;  1TGX A;  1IKC A;  2K3G A;  1KL8 A;  3NH7 A;  1CHV S;  1ERA A;  1FAS A;  4BIK B;  1NYS A;  5IMT D;  4BDT B;  1I02 A;  3BT1 U;  1REW C;  3FEV A;  4XJJ A;  1YWH A;  2PJY C;  1JGK A;  2MJ4 A;  2MJ0 A;  4RUD A;  3U74 U;  1HAA A;  2CCX A;  1KBT A;  1HC9 A;  2JQP A;  4OM4 A;  1CVO A;  1TFS A;  1NXB A;  2MJY A;  1QKD A;  2I9B E;  1QM7 A;  2CRS A;  2QC1 A;  1LXG A;  4LFT A;  1ES7 B;  1CDS A;  2BTX A;  1FSC A;  2CDX A;  2H8U A;  1NEA A;  1KU6 B;  1IDI A;  2MUP A;  3QB4 B;  1W6B A;  2LA1 A;  2MUO A;  5DZ5 A;  1JE9 A;  1NYU A;  2J8B A;  2H7Z B;  5IMY C;  2L5S A;  1HOY A;  2ERA A;  4AEA A;  2HLR A;  2OFS A;  1JBD A;  1UG4 A;  2CTX A;  1CDT A;  1FSS B;  2GOO C;  4FAO C;  1M9Z A;  3EBX A;  3BT2 U; 
#chains in the Genus database with same CATH topology
 1ERG A;  3KFD I;  1COD A;  2MFA A;  2GOO B;  4FAO E;  3LAQ U;  1LX5 B;  2VLW A;  1XT3 A;  3ERA A;  3PLC A;  1ONJ A;  1NTX A;  1IK8 A;  3KFD E;  4KSN A;  1TXB A;  1CDR A;  1BXP A;  1FFJ A;  4ZQY A;  1CCQ A;  1FF4 A;  1ZAD A;  1L4W A;  2NBT A;  4OM5 A;  2CRT A;  1CRE A;  5DU1 A;  4DO8 A;  6EBX A;  1COE A;  1LJZ A;  1LXH A;  1CXO A;  4QTI U;  1RGJ A;  5EBX A;  1HAJ A;  2BHI A;  2H64 C;  2MHY A;  4EY8 B;  3U73 U;  1H0J A;  1TXA A;  2FD6 U;  3NEQ A;  5DO6 A;  1ABT A;  2JVE A;  2H64 B;  1IDH A;  1LSI A;  1FRA A;  2H62 D;  1F8U B;  1KBA A;  1KS6 A;  2UWR A;  1B41 B;  4HQP F;  2LCR A;  1KXI A;  2X8B B;  2UX2 A;  4UY2 C;  1V6P A;  1HC9 B;  1IQ9 A;  1F94 A;  2ABX A;  2H62 C;  1VB0 A;  1CB9 A;  1KFH A;  1QKE A;  4P7U A;  1IDL A;  3VTS A;  1KBS A;  3NDS A;  2PJY B;  1CRF A;  2QJA C;  1IDG A;  2L03 A;  2HLQ A;  1G6M A;  1DRS A;  1NTN A;  2H7Z A;  4IYE A;  1RL5 A;  1CTX A;  1KC4 A;  1MR6 A;  1NOR A;  2H5F A;  1MAH F;  1KTZ B;  1CXN A;  2QJ9 C;  1BTE A;  1CDQ A;  1S4Y A;  3HH7 A;  1IJC A;  3EVS C;  1PLO A;  2QJB C;  2N99 A;  1TGX A;  1IKC A;  2K3G A;  1KL8 A;  3NH7 A;  1CHV S;  1ERA A;  1FAS A;  4BIK B;  1NYS A;  5IMT D;  4BDT B;  1I02 A;  3BT1 U;  1REW C;  3FEV A;  4XJJ A;  1YWH A;  2PJY C;  1JGK A;  2MJ4 A;  2MJ0 A;  4RUD A;  3U74 U;  1HAA A;  2CCX A;  1KBT A;  1HC9 A;  2JQP A;  4OM4 A;  1CVO A;  1TFS A;  1NXB A;  2MJY A;  1QKD A;  2I9B E;  1QM7 A;  2CRS A;  2QC1 A;  1LXG A;  4LFT A;  1ES7 B;  1CDS A;  2BTX A;  1FSC A;  2CDX A;  2H8U A;  1NEA A;  1KU6 B;  1IDI A;  2MUP A;  3QB4 B;  1W6B A;  2LA1 A;  2MUO A;  5DZ5 A;  1JE9 A;  1NYU A;  2J8B A;  2H7Z B;  5IMY C;  2L5S A;  1HOY A;  2ERA A;  4AEA A;  2HLR A;  2OFS A;  1JBD A;  1UG4 A;  2CTX A;  1CDT A;  1FSS B;  2GOO C;  4FAO C;  1M9Z A;  3EBX A;  3BT2 U; 
#chains in the Genus database with same CATH homology
 1ERG A;  3KFD I;  1COD A;  2MFA A;  2GOO B;  4FAO E;  3LAQ U;  1LX5 B;  2VLW A;  1XT3 A;  3ERA A;  3PLC A;  1ONJ A;  1NTX A;  1IK8 A;  3KFD E;  4KSN A;  1TXB A;  1CDR A;  1BXP A;  1FFJ A;  4ZQY A;  1CCQ A;  1FF4 A;  1ZAD A;  1L4W A;  2NBT A;  4OM5 A;  2CRT A;  1CRE A;  5DU1 A;  4DO8 A;  6EBX A;  1COE A;  1LJZ A;  1LXH A;  1CXO A;  4QTI U;  1RGJ A;  5EBX A;  1HAJ A;  2BHI A;  2H64 C;  2MHY A;  4EY8 B;  3U73 U;  1H0J A;  1TXA A;  2FD6 U;  3NEQ A;  5DO6 A;  1ABT A;  2JVE A;  2H64 B;  1IDH A;  1LSI A;  1FRA A;  2H62 D;  1F8U B;  1KBA A;  1KS6 A;  2UWR A;  1B41 B;  4HQP F;  2LCR A;  1KXI A;  2X8B B;  2UX2 A;  4UY2 C;  1V6P A;  1HC9 B;  1IQ9 A;  1F94 A;  2ABX A;  2H62 C;  1VB0 A;  1CB9 A;  1KFH A;  1QKE A;  4P7U A;  1IDL A;  3VTS A;  1KBS A;  3NDS A;  2PJY B;  1CRF A;  2QJA C;  1IDG A;  2L03 A;  2HLQ A;  1G6M A;  1DRS A;  1NTN A;  2H7Z A;  4IYE A;  1RL5 A;  1CTX A;  1KC4 A;  1MR6 A;  1NOR A;  2H5F A;  1MAH F;  1KTZ B;  1CXN A;  2QJ9 C;  1BTE A;  1CDQ A;  1S4Y A;  3HH7 A;  1IJC A;  3EVS C;  1PLO A;  2QJB C;  2N99 A;  1TGX A;  1IKC A;  2K3G A;  1KL8 A;  3NH7 A;  1CHV S;  1ERA A;  1FAS A;  4BIK B;  1NYS A;  5IMT D;  4BDT B;  1I02 A;  3BT1 U;  1REW C;  3FEV A;  4XJJ A;  1YWH A;  2PJY C;  1JGK A;  2MJ4 A;  2MJ0 A;  4RUD A;  3U74 U;  1HAA A;  2CCX A;  1KBT A;  1HC9 A;  2JQP A;  4OM4 A;  1CVO A;  1TFS A;  1NXB A;  2MJY A;  1QKD A;  2I9B E;  1QM7 A;  2CRS A;  2QC1 A;  1LXG A;  4LFT A;  1ES7 B;  1CDS A;  2BTX A;  1FSC A;  2CDX A;  2H8U A;  1NEA A;  1KU6 B;  1IDI A;  2MUP A;  3QB4 B;  1W6B A;  2LA1 A;  2MUO A;  5DZ5 A;  1JE9 A;  1NYU A;  2J8B A;  2H7Z B;  5IMY C;  2L5S A;  1HOY A;  2ERA A;  4AEA A;  2HLR A;  2OFS A;  1JBD A;  1UG4 A;  2CTX A;  1CDT A;  1FSS B;  2GOO C;  4FAO C;  1M9Z A;  3EBX A;  3BT2 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...