2LA1A

Expression in pichia pastoris and backbone dynamics of dendroaspin, a three finger toxin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
RICYNHLGTKPPTTETCQEDSCYKNIWTFDNIIRRGCGCFTPRGDMPGPYCCESDKCNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Mambin
publication title Dynamics and functional differences between dendroaspin and rhodostomin: Insights into protein scaffolds in integrin recognition
pubmed doi rcsb
source organism Dendroaspis jamesoni kaimosae
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2011-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2la1A00
1IDGA 3PLCA 1CVOA 2MUOA 1HAAA 1FFJA 1H0JA 3U74U 1IDLA 1ABTA 1RGJA 3LAQU 1QM7A 1CXOA 1IJCA 1NTXA 2H7ZA 2N99A 2BHIA 2QJ9C 2QC1A 2L03A 4LFTA 1ZADA 1ERAA 3EBXA 1IDHA 2JQPA 1FRAA 1F94A 1HC9B 2H8UA 2K3GA 4BDTB 1M9ZA 1REWC 2H62D 2CTXA 5IMTD 1NYUA 4OM5A 4FAOC 1F8UB 1FF4A 4IYEA 2H5FA 1FSCA 1XT3A 1QKDA 3FEVA 2MUPA 4HQPF 5DZ5A 1TXAA 1CDRA 1V6PA 1UG4A 1CDTA 1YWHA 2UX2A 1KBSA 1FSSB 2HLQA 1I02A 1CDQA 2L5SA 1KXIA 4AEAA 2I9BE 2GOOC 2LCRA 2QJBC 2J8BA 6EBXA 1KBAA 2H64C 1BXPA 2CRSA 1IDIA 2QJAC 1QKEA 4OM4A 1CDSA 4EY8B 1KC4A 2CCXA 2H62C 1LSIA 1LXGA 1TFSA 3KFDI 1NORA 1COEA 1ERGA 1HC9A 1L4WA 1NEAA 3ERAA 1FASA 1JGKA 2PJYB 4QTIU 1KTZB 2CRTA 4BIKB 5DU1A 1CRFA 3QB4B 5EBXA 1LJZA 1S4YA 2ABXA 2JVEA 2LA1A 3U73U 1NTNA 1IK8A 1CREA 1DRSA 1CXNA 1NXBA 2BTXA 1MR6A 4FAOE 1KL8A 1CCQA 1CB9A 1KS6A 2UWRA 1HOYA 1LXHA 1NYSA 1VB0A 1KFHA 1TXBA 1ES7B 3HH7A 4XJJA 2VLWA 3VTSA 3EVSC 1LX5B 1KBTA 2H7ZB 1RL5A 2X8BB 4UY2C 2CDXA 3BT2U 3NDSA 1PLOA 4DO8A 1IQ9A 2MFAA 2FD6U 1W6BA 1CODA 1KU6B 2MJ4A 1G6MA 1CHVS 2ERAA 1ONJA 5DO6A 1HAJA 3NEQA 5IMYC 3BT1U 2HLRA 2MHYA 3NH7A 4P7UA 1CTXA 1IKCA 2MJYA 2NBTA 1BTEA 2GOOB 2H64B 1TGXA 4RUDA 1MAHF 2PJYC 2MJ0A 2OFSA 4ZQYA 1B41B 1JE9A 3KFDE 1JBDA
chains in the Genus database with same CATH superfamily
1IDGA 3PLCA 1CVOA 2MUOA 1HAAA 1FFJA 1H0JA 3U74U 1IDLA 1ABTA 1RGJA 3LAQU 1QM7A 1CXOA 1IJCA 1NTXA 2H7ZA 2N99A 2BHIA 2QJ9C 2QC1A 2L03A 4LFTA 1ZADA 1ERAA 3EBXA 1IDHA 2JQPA 1FRAA 1F94A 1HC9B 2H8UA 2K3GA 4BDTB 1M9ZA 1REWC 2H62D 2CTXA 5IMTD 1NYUA 4OM5A 4FAOC 1F8UB 1FF4A 4IYEA 2H5FA 1FSCA 1XT3A 1QKDA 3FEVA 2MUPA 4HQPF 5DZ5A 1TXAA 1CDRA 1V6PA 1UG4A 1CDTA 1YWHA 2UX2A 1KBSA 1FSSB 2HLQA 1I02A 1CDQA 2L5SA 1KXIA 4AEAA 2I9BE 2GOOC 2LCRA 2QJBC 2J8BA 6EBXA 1KBAA 2H64C 1BXPA 2CRSA 1IDIA 2QJAC 1QKEA 4OM4A 1CDSA 4EY8B 1KC4A 2CCXA 2H62C 1LSIA 1LXGA 1TFSA 3KFDI 1NORA 1COEA 1ERGA 1HC9A 1L4WA 1NEAA 3ERAA 1FASA 1JGKA 2PJYB 4QTIU 1KTZB 2CRTA 4BIKB 5DU1A 1CRFA 3QB4B 5EBXA 1LJZA 1S4YA 2ABXA 2JVEA 2LA1A 3U73U 1NTNA 1IK8A 1CREA 1DRSA 1CXNA 1NXBA 2BTXA 1MR6A 4FAOE 1KL8A 1CCQA 1CB9A 1KS6A 2UWRA 1HOYA 1LXHA 1NYSA 1VB0A 1KFHA 1TXBA 1ES7B 3HH7A 4XJJA 2VLWA 3VTSA 3EVSC 1LX5B 1KBTA 2H7ZB 1RL5A 2X8BB 4UY2C 4KSNA 2CDXA 3BT2U 3NDSA 1PLOA 4DO8A 1IQ9A 2MFAA 2FD6U 1W6BA 1CODA 1KU6B 2MJ4A 1G6MA 1CHVS 2ERAA 1ONJA 5DO6A 1HAJA 3NEQA 5IMYC 3BT1U 2HLRA 2MHYA 3NH7A 4P7UA 1CTXA 1IKCA 2MJYA 2NBTA 1BTEA 2GOOB 2H64B 1TGXA 4RUDA 1MAHF 2PJYC 2MJ0A 2OFSA 4ZQYA 1B41B 1JE9A 3KFDE 1JBDA
chains in the Genus database with same CATH topology
1IDGA 3PLCA 1CVOA 2MUOA 1HAAA 1FFJA 1H0JA 3U74U 1IDLA 1ABTA 1RGJA 3LAQU 1QM7A 1CXOA 1IJCA 1NTXA 2H7ZA 2N99A 2BHIA 2QJ9C 2QC1A 2L03A 4LFTA 1ZADA 1ERAA 3EBXA 1IDHA 2JQPA 1FRAA 1F94A 1HC9B 2H8UA 2K3GA 4BDTB 1M9ZA 1REWC 2H62D 2CTXA 5IMTD 1NYUA 4OM5A 4FAOC 1F8UB 1FF4A 4IYEA 2H5FA 1FSCA 1XT3A 1QKDA 3FEVA 2MUPA 4HQPF 5DZ5A 1TXAA 1CDRA 1V6PA 1UG4A 1CDTA 1YWHA 2UX2A 1KBSA 1FSSB 2HLQA 1I02A 1CDQA 2L5SA 1KXIA 4AEAA 2I9BE 2GOOC 2LCRA 2QJBC 2J8BA 6EBXA 1KBAA 2H64C 1BXPA 2CRSA 1IDIA 2QJAC 1QKEA 4OM4A 1CDSA 4EY8B 1KC4A 2CCXA 2H62C 1LSIA 1LXGA 1TFSA 3KFDI 1NORA 1COEA 1ERGA 1HC9A 1L4WA 1NEAA 3ERAA 1FASA 1JGKA 2PJYB 4QTIU 1KTZB 2CRTA 4BIKB 5DU1A 1CRFA 3QB4B 5EBXA 1LJZA 1S4YA 2ABXA 2JVEA 2LA1A 3U73U 1NTNA 1IK8A 1CREA 1DRSA 1CXNA 1NXBA 2BTXA 1MR6A 4FAOE 1KL8A 1CCQA 1CB9A 1KS6A 2UWRA 1HOYA 1LXHA 1NYSA 1VB0A 1KFHA 1TXBA 1ES7B 3HH7A 4XJJA 2VLWA 3VTSA 3EVSC 1LX5B 1KBTA 2H7ZB 1RL5A 2X8BB 4UY2C 4KSNA 2CDXA 3BT2U 3NDSA 1PLOA 4DO8A 1IQ9A 2MFAA 2FD6U 1W6BA 1CODA 1KU6B 2MJ4A 1G6MA 1CHVS 2ERAA 1ONJA 5DO6A 1HAJA 3NEQA 5IMYC 3BT1U 2HLRA 2MHYA 3NH7A 4P7UA 1CTXA 1IKCA 2MJYA 2NBTA 1BTEA 2GOOB 2H64B 1TGXA 4RUDA 1MAHF 2PJYC 2MJ0A 2OFSA 4ZQYA 1B41B 1JE9A 3KFDE 1JBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDG A;  3PLC A;  1CVO A;  2MUO A;  1HAA A;  1FFJ A;  1H0J A;  3U74 U;  1IDL A;  1ABT A;  1RGJ A;  3LAQ U;  1QM7 A;  1CXO A;  1IJC A;  1NTX A;  2H7Z A;  2N99 A;  2BHI A;  2QJ9 C;  2QC1 A;  2L03 A;  4LFT A;  1ZAD A;  1ERA A;  3EBX A;  1IDH A;  2JQP A;  1FRA A;  1F94 A;  1HC9 B;  2H8U A;  2K3G A;  4BDT B;  1M9Z A;  1REW C;  2H62 D;  2CTX A;  5IMT D;  1NYU A;  4OM5 A;  4FAO C;  1F8U B;  1FF4 A;  4IYE A;  2H5F A;  1FSC A;  1XT3 A;  1QKD A;  3FEV A;  2MUP A;  4HQP F;  5DZ5 A;  1TXA A;  1CDR A;  1V6P A;  1UG4 A;  1CDT A;  1YWH A;  2UX2 A;  1KBS A;  1FSS B;  2HLQ A;  1I02 A;  1CDQ A;  2L5S A;  1KXI A;  4AEA A;  2I9B E;  2GOO C;  2LCR A;  2QJB C;  2J8B A;  6EBX A;  1KBA A;  2H64 C;  1BXP A;  2CRS A;  1IDI A;  2QJA C;  1QKE A;  4OM4 A;  1CDS A;  4EY8 B;  1KC4 A;  2CCX A;  2H62 C;  1LSI A;  1LXG A;  1TFS A;  3KFD I;  1NOR A;  1COE A;  1ERG A;  1HC9 A;  1L4W A;  1NEA A;  3ERA A;  1FAS A;  1JGK A;  2PJY B;  4QTI U;  1KTZ B;  2CRT A;  4BIK B;  5DU1 A;  1CRF A;  3QB4 B;  5EBX A;  1LJZ A;  1S4Y A;  2ABX A;  2JVE A;  2LA1 A;  3U73 U;  1NTN A;  1IK8 A;  1CRE A;  1DRS A;  1CXN A;  1NXB A;  2BTX A;  1MR6 A;  4FAO E;  1KL8 A;  1CCQ A;  1CB9 A;  1KS6 A;  2UWR A;  1HOY A;  1LXH A;  1NYS A;  1VB0 A;  1KFH A;  1TXB A;  1ES7 B;  3HH7 A;  4XJJ A;  2VLW A;  3VTS A;  3EVS C;  1LX5 B;  1KBT A;  2H7Z B;  1RL5 A;  2X8B B;  4UY2 C;  2CDX A;  3BT2 U;  3NDS A;  1PLO A;  4DO8 A;  1IQ9 A;  2MFA A;  2FD6 U;  1W6B A;  1COD A;  1KU6 B;  2MJ4 A;  1G6M A;  1CHV S;  2ERA A;  1ONJ A;  5DO6 A;  1HAJ A;  3NEQ A;  5IMY C;  3BT1 U;  2HLR A;  2MHY A;  3NH7 A;  4P7U A;  1CTX A;  1IKC A;  2MJY A;  2NBT A;  1BTE A;  2GOO B;  2H64 B;  1TGX A;  4RUD A;  1MAH F;  2PJY C;  2MJ0 A;  2OFS A;  4ZQY A;  1B41 B;  1JE9 A;  3KFD E;  1JBD A; 
#chains in the Genus database with same CATH topology
 1IDG A;  3PLC A;  1CVO A;  2MUO A;  1HAA A;  1FFJ A;  1H0J A;  3U74 U;  1IDL A;  1ABT A;  1RGJ A;  3LAQ U;  1QM7 A;  1CXO A;  1IJC A;  1NTX A;  2H7Z A;  2N99 A;  2BHI A;  2QJ9 C;  2QC1 A;  2L03 A;  4LFT A;  1ZAD A;  1ERA A;  3EBX A;  1IDH A;  2JQP A;  1FRA A;  1F94 A;  1HC9 B;  2H8U A;  2K3G A;  4BDT B;  1M9Z A;  1REW C;  2H62 D;  2CTX A;  5IMT D;  1NYU A;  4OM5 A;  4FAO C;  1F8U B;  1FF4 A;  4IYE A;  2H5F A;  1FSC A;  1XT3 A;  1QKD A;  3FEV A;  2MUP A;  4HQP F;  5DZ5 A;  1TXA A;  1CDR A;  1V6P A;  1UG4 A;  1CDT A;  1YWH A;  2UX2 A;  1KBS A;  1FSS B;  2HLQ A;  1I02 A;  1CDQ A;  2L5S A;  1KXI A;  4AEA A;  2I9B E;  2GOO C;  2LCR A;  2QJB C;  2J8B A;  6EBX A;  1KBA A;  2H64 C;  1BXP A;  2CRS A;  1IDI A;  2QJA C;  1QKE A;  4OM4 A;  1CDS A;  4EY8 B;  1KC4 A;  2CCX A;  2H62 C;  1LSI A;  1LXG A;  1TFS A;  3KFD I;  1NOR A;  1COE A;  1ERG A;  1HC9 A;  1L4W A;  1NEA A;  3ERA A;  1FAS A;  1JGK A;  2PJY B;  4QTI U;  1KTZ B;  2CRT A;  4BIK B;  5DU1 A;  1CRF A;  3QB4 B;  5EBX A;  1LJZ A;  1S4Y A;  2ABX A;  2JVE A;  2LA1 A;  3U73 U;  1NTN A;  1IK8 A;  1CRE A;  1DRS A;  1CXN A;  1NXB A;  2BTX A;  1MR6 A;  4FAO E;  1KL8 A;  1CCQ A;  1CB9 A;  1KS6 A;  2UWR A;  1HOY A;  1LXH A;  1NYS A;  1VB0 A;  1KFH A;  1TXB A;  1ES7 B;  3HH7 A;  4XJJ A;  2VLW A;  3VTS A;  3EVS C;  1LX5 B;  1KBT A;  2H7Z B;  1RL5 A;  2X8B B;  4UY2 C;  4KSN A;  2CDX A;  3BT2 U;  3NDS A;  1PLO A;  4DO8 A;  1IQ9 A;  2MFA A;  2FD6 U;  1W6B A;  1COD A;  1KU6 B;  2MJ4 A;  1G6M A;  1CHV S;  2ERA A;  1ONJ A;  5DO6 A;  1HAJ A;  3NEQ A;  5IMY C;  3BT1 U;  2HLR A;  2MHY A;  3NH7 A;  4P7U A;  1CTX A;  1IKC A;  2MJY A;  2NBT A;  1BTE A;  2GOO B;  2H64 B;  1TGX A;  4RUD A;  1MAH F;  2PJY C;  2MJ0 A;  2OFS A;  4ZQY A;  1B41 B;  1JE9 A;  3KFD E;  1JBD A; 
#chains in the Genus database with same CATH homology
 1IDG A;  3PLC A;  1CVO A;  2MUO A;  1HAA A;  1FFJ A;  1H0J A;  3U74 U;  1IDL A;  1ABT A;  1RGJ A;  3LAQ U;  1QM7 A;  1CXO A;  1IJC A;  1NTX A;  2H7Z A;  2N99 A;  2BHI A;  2QJ9 C;  2QC1 A;  2L03 A;  4LFT A;  1ZAD A;  1ERA A;  3EBX A;  1IDH A;  2JQP A;  1FRA A;  1F94 A;  1HC9 B;  2H8U A;  2K3G A;  4BDT B;  1M9Z A;  1REW C;  2H62 D;  2CTX A;  5IMT D;  1NYU A;  4OM5 A;  4FAO C;  1F8U B;  1FF4 A;  4IYE A;  2H5F A;  1FSC A;  1XT3 A;  1QKD A;  3FEV A;  2MUP A;  4HQP F;  5DZ5 A;  1TXA A;  1CDR A;  1V6P A;  1UG4 A;  1CDT A;  1YWH A;  2UX2 A;  1KBS A;  1FSS B;  2HLQ A;  1I02 A;  1CDQ A;  2L5S A;  1KXI A;  4AEA A;  2I9B E;  2GOO C;  2LCR A;  2QJB C;  2J8B A;  6EBX A;  1KBA A;  2H64 C;  1BXP A;  2CRS A;  1IDI A;  2QJA C;  1QKE A;  4OM4 A;  1CDS A;  4EY8 B;  1KC4 A;  2CCX A;  2H62 C;  1LSI A;  1LXG A;  1TFS A;  3KFD I;  1NOR A;  1COE A;  1ERG A;  1HC9 A;  1L4W A;  1NEA A;  3ERA A;  1FAS A;  1JGK A;  2PJY B;  4QTI U;  1KTZ B;  2CRT A;  4BIK B;  5DU1 A;  1CRF A;  3QB4 B;  5EBX A;  1LJZ A;  1S4Y A;  2ABX A;  2JVE A;  2LA1 A;  3U73 U;  1NTN A;  1IK8 A;  1CRE A;  1DRS A;  1CXN A;  1NXB A;  2BTX A;  1MR6 A;  4FAO E;  1KL8 A;  1CCQ A;  1CB9 A;  1KS6 A;  2UWR A;  1HOY A;  1LXH A;  1NYS A;  1VB0 A;  1KFH A;  1TXB A;  1ES7 B;  3HH7 A;  4XJJ A;  2VLW A;  3VTS A;  3EVS C;  1LX5 B;  1KBT A;  2H7Z B;  1RL5 A;  2X8B B;  4UY2 C;  4KSN A;  2CDX A;  3BT2 U;  3NDS A;  1PLO A;  4DO8 A;  1IQ9 A;  2MFA A;  2FD6 U;  1W6B A;  1COD A;  1KU6 B;  2MJ4 A;  1G6M A;  1CHV S;  2ERA A;  1ONJ A;  5DO6 A;  1HAJ A;  3NEQ A;  5IMY C;  3BT1 U;  2HLR A;  2MHY A;  3NH7 A;  4P7U A;  1CTX A;  1IKC A;  2MJY A;  2NBT A;  1BTE A;  2GOO B;  2H64 B;  1TGX A;  4RUD A;  1MAH F;  2PJY C;  2MJ0 A;  2OFS A;  4ZQY A;  1B41 B;  1JE9 A;  3KFD E;  1JBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...