2QJ9C

Crystal structure analysis of bmp-2 in complex with bmpr-ia variant b1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
TLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCRDTPIPHQRRSIECCRTNLCNQYLQPTLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/receptor
molecule keywords Bone morphogenetic protein 2
publication title Structure analysis of bone morphogenetic protein-2 type I receptor complexes reveals a mechanism of receptor inactivation in juvenile polyposis syndrome.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 86
sequence length 86
chains with identical sequence D
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2qj9C00
1UG4A 2I9BE 2JQPA 2MJ0A 3QB4B 2L5SA 2H64C 4FAOC 4OM4A 5DZ5A 1L4WA 3VTSA 1HAAA 3HH7A 2HLRA 1DRSA 1KFHA 1NTXA 1KS6A 1ES7B 2QJAC 2LCRA 3BT2U 3U73U 2FD6U 1IKCA 1QKEA 1W6BA 2LA1A 1G6MA 2CRSA 1TGXA 1XT3A 1MR6A 2MJ4A 2MHYA 1CXOA 1NORA 1M9ZA 4UY2C 4FAOE 1CVOA 1ONJA 3KFDI 1FFJA 1IK8A 1IDGA 1JE9A 1F94A 6EBXA 1JBDA 1CHVS 1FASA 2CRTA 4DO8A 1QM7A 1REWC 2CDXA 2UWRA 1KXIA 4P7UA 1S4YA 2MFAA 2J8BA 2H64B 1CDTA 4QTIU 1HAJA 1CDRA 4OM5A 1H0JA 2BTXA 1PLOA 2MUPA 1HOYA 1COEA 1CODA 1KC4A 1CRFA 1CTXA 2QC1A 1ERAA 1NYSA 2MJYA 2NBTA 4XJJA 3NEQA 1FSCA 1KTZB 1MAHF 4EY8B 1LXGA 1IDLA 1TXBA 2CCXA 1IDHA 2N99A 2H5FA 1IJCA 1ZADA 5IMTD 1VB0A 2MUOA 3LAQU 4IYEA 3NDSA 2QJ9C 2K3GA 4BDTB 2PJYC 5EBXA 3NH7A 5IMYC 1NXBA 2PJYB 2UX2A 5DO6A 1KBSA 1LSIA 1CB9A 3PLCA 1NYUA 1CREA 4BIKB 1CDQA 2ABXA 3EBXA 2H7ZA 4AEAA 1HC9A 1KL8A 1TFSA 4ZQYA 1KBAA 2ERAA 2HLQA 2JVEA 1KU6B 2GOOC 3BT1U 1CCQA 1B41B 2L03A 1CXNA 1KBTA 1FSSB 4RUDA 1NEAA 1F8UB 1RL5A 1I02A 2H7ZB 4HQPF 1TXAA 5DU1A 1HC9B 1JGKA 1RGJA 1V6PA 2H8UA 1CDSA 2H62C 1FF4A 3KFDE 1LX5B 2QJBC 1BXPA 1ABTA 3EVSC 3U74U 4LFTA 2OFSA 3ERAA 1LJZA 1QKDA 2BHIA 1YWHA 1NTNA 1LXHA 2X8BB 2GOOB 3FEVA 1IDIA 2CTXA 1FRAA 1IQ9A 2VLWA 2H62D 1BTEA 1ERGA
chains in the Genus database with same CATH superfamily
1UG4A 2I9BE 2JQPA 2MJ0A 3QB4B 2L5SA 2H64C 4FAOC 4OM4A 5DZ5A 1L4WA 3VTSA 1HAAA 3HH7A 2HLRA 1DRSA 1KFHA 1NTXA 1KS6A 1ES7B 2QJAC 2LCRA 3BT2U 3U73U 2FD6U 1IKCA 1QKEA 1W6BA 2LA1A 1G6MA 2CRSA 1TGXA 1XT3A 1MR6A 2MJ4A 2MHYA 1CXOA 1NORA 1M9ZA 4UY2C 4FAOE 1CVOA 1ONJA 3KFDI 1FFJA 1IK8A 1IDGA 1JE9A 1F94A 6EBXA 1JBDA 1CHVS 1FASA 2CRTA 4DO8A 1QM7A 1REWC 2CDXA 2UWRA 1KXIA 4P7UA 1S4YA 2MFAA 2J8BA 2H64B 1CDTA 4QTIU 1HAJA 1CDRA 4OM5A 1H0JA 2BTXA 1PLOA 2MUPA 1HOYA 1COEA 1CODA 1KC4A 1CRFA 1CTXA 2QC1A 1ERAA 1NYSA 2MJYA 2NBTA 4XJJA 3NEQA 1FSCA 1KTZB 1MAHF 4EY8B 1LXGA 1IDLA 1TXBA 2CCXA 1IDHA 2N99A 2H5FA 1IJCA 1ZADA 5IMTD 1VB0A 2MUOA 3LAQU 4IYEA 3NDSA 2QJ9C 2K3GA 4BDTB 2PJYC 5EBXA 3NH7A 5IMYC 1NXBA 2PJYB 2UX2A 5DO6A 1KBSA 1LSIA 4KSNA 1CB9A 3PLCA 1NYUA 1CREA 4BIKB 1CDQA 2ABXA 3EBXA 2H7ZA 4AEAA 1HC9A 1KL8A 1TFSA 4ZQYA 1KBAA 2ERAA 2HLQA 2JVEA 1KU6B 2GOOC 3BT1U 1CCQA 1B41B 2L03A 1CXNA 1KBTA 1FSSB 4RUDA 1NEAA 1F8UB 1RL5A 1I02A 2H7ZB 4HQPF 1TXAA 5DU1A 1HC9B 1JGKA 1RGJA 1V6PA 2H8UA 1CDSA 2H62C 1FF4A 3KFDE 1LX5B 2QJBC 1BXPA 1ABTA 3EVSC 3U74U 4LFTA 2OFSA 3ERAA 1LJZA 1QKDA 2BHIA 1YWHA 1NTNA 1LXHA 2X8BB 2GOOB 3FEVA 1IDIA 2CTXA 1FRAA 1IQ9A 2VLWA 2H62D 1BTEA 1ERGA
chains in the Genus database with same CATH topology
1UG4A 2I9BE 2JQPA 2MJ0A 3QB4B 2L5SA 2H64C 4FAOC 4OM4A 5DZ5A 1L4WA 3VTSA 1HAAA 3HH7A 2HLRA 1DRSA 1KFHA 1NTXA 1KS6A 1ES7B 2QJAC 2LCRA 3BT2U 3U73U 2FD6U 1IKCA 1QKEA 1W6BA 2LA1A 1G6MA 2CRSA 1TGXA 1XT3A 1MR6A 2MJ4A 2MHYA 1CXOA 1NORA 1M9ZA 4UY2C 4FAOE 1CVOA 1ONJA 3KFDI 1FFJA 1IK8A 1IDGA 1JE9A 1F94A 6EBXA 1JBDA 1CHVS 1FASA 2CRTA 4DO8A 1QM7A 1REWC 2CDXA 2UWRA 1KXIA 4P7UA 1S4YA 2MFAA 2J8BA 2H64B 1CDTA 4QTIU 1HAJA 1CDRA 4OM5A 1H0JA 2BTXA 1PLOA 2MUPA 1HOYA 1COEA 1CODA 1KC4A 1CRFA 1CTXA 2QC1A 1ERAA 1NYSA 2MJYA 2NBTA 4XJJA 3NEQA 1FSCA 1KTZB 1MAHF 4EY8B 1LXGA 1IDLA 1TXBA 2CCXA 1IDHA 2N99A 2H5FA 1IJCA 1ZADA 5IMTD 1VB0A 2MUOA 3LAQU 4IYEA 3NDSA 2QJ9C 2K3GA 4BDTB 2PJYC 5EBXA 3NH7A 5IMYC 1NXBA 2PJYB 2UX2A 5DO6A 1KBSA 1LSIA 4KSNA 1CB9A 3PLCA 1NYUA 1CREA 4BIKB 1CDQA 2ABXA 3EBXA 2H7ZA 4AEAA 1HC9A 1KL8A 1TFSA 4ZQYA 1KBAA 2ERAA 2HLQA 2JVEA 1KU6B 2GOOC 3BT1U 1CCQA 1B41B 2L03A 1CXNA 1KBTA 1FSSB 4RUDA 1NEAA 1F8UB 1RL5A 1I02A 2H7ZB 4HQPF 1TXAA 5DU1A 1HC9B 1JGKA 1RGJA 1V6PA 2H8UA 1CDSA 2H62C 1FF4A 3KFDE 1LX5B 2QJBC 1BXPA 1ABTA 3EVSC 3U74U 4LFTA 2OFSA 3ERAA 1LJZA 1QKDA 2BHIA 1YWHA 1NTNA 1LXHA 2X8BB 2GOOB 3FEVA 1IDIA 2CTXA 1FRAA 1IQ9A 2VLWA 2H62D 1BTEA 1ERGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG4 A;  2I9B E;  2JQP A;  2MJ0 A;  3QB4 B;  2L5S A;  2H64 C;  4FAO C;  4OM4 A;  5DZ5 A;  1L4W A;  3VTS A;  1HAA A;  3HH7 A;  2HLR A;  1DRS A;  1KFH A;  1NTX A;  1KS6 A;  1ES7 B;  2QJA C;  2LCR A;  3BT2 U;  3U73 U;  2FD6 U;  1IKC A;  1QKE A;  1W6B A;  2LA1 A;  1G6M A;  2CRS A;  1TGX A;  1XT3 A;  1MR6 A;  2MJ4 A;  2MHY A;  1CXO A;  1NOR A;  1M9Z A;  4UY2 C;  4FAO E;  1CVO A;  1ONJ A;  3KFD I;  1FFJ A;  1IK8 A;  1IDG A;  1JE9 A;  1F94 A;  6EBX A;  1JBD A;  1CHV S;  1FAS A;  2CRT A;  4DO8 A;  1QM7 A;  1REW C;  2CDX A;  2UWR A;  1KXI A;  4P7U A;  1S4Y A;  2MFA A;  2J8B A;  2H64 B;  1CDT A;  4QTI U;  1HAJ A;  1CDR A;  4OM5 A;  1H0J A;  2BTX A;  1PLO A;  2MUP A;  1HOY A;  1COE A;  1COD A;  1KC4 A;  1CRF A;  1CTX A;  2QC1 A;  1ERA A;  1NYS A;  2MJY A;  2NBT A;  4XJJ A;  3NEQ A;  1FSC A;  1KTZ B;  1MAH F;  4EY8 B;  1LXG A;  1IDL A;  1TXB A;  2CCX A;  1IDH A;  2N99 A;  2H5F A;  1IJC A;  1ZAD A;  5IMT D;  1VB0 A;  2MUO A;  3LAQ U;  4IYE A;  3NDS A;  2QJ9 C;  2K3G A;  4BDT B;  2PJY C;  5EBX A;  3NH7 A;  5IMY C;  1NXB A;  2PJY B;  2UX2 A;  5DO6 A;  1KBS A;  1LSI A;  1CB9 A;  3PLC A;  1NYU A;  1CRE A;  4BIK B;  1CDQ A;  2ABX A;  3EBX A;  2H7Z A;  4AEA A;  1HC9 A;  1KL8 A;  1TFS A;  4ZQY A;  1KBA A;  2ERA A;  2HLQ A;  2JVE A;  1KU6 B;  2GOO C;  3BT1 U;  1CCQ A;  1B41 B;  2L03 A;  1CXN A;  1KBT A;  1FSS B;  4RUD A;  1NEA A;  1F8U B;  1RL5 A;  1I02 A;  2H7Z B;  4HQP F;  1TXA A;  5DU1 A;  1HC9 B;  1JGK A;  1RGJ A;  1V6P A;  2H8U A;  1CDS A;  2H62 C;  1FF4 A;  3KFD E;  1LX5 B;  2QJB C;  1BXP A;  1ABT A;  3EVS C;  3U74 U;  4LFT A;  2OFS A;  3ERA A;  1LJZ A;  1QKD A;  2BHI A;  1YWH A;  1NTN A;  1LXH A;  2X8B B;  2GOO B;  3FEV A;  1IDI A;  2CTX A;  1FRA A;  1IQ9 A;  2VLW A;  2H62 D;  1BTE A;  1ERG A; 
#chains in the Genus database with same CATH topology
 1UG4 A;  2I9B E;  2JQP A;  2MJ0 A;  3QB4 B;  2L5S A;  2H64 C;  4FAO C;  4OM4 A;  5DZ5 A;  1L4W A;  3VTS A;  1HAA A;  3HH7 A;  2HLR A;  1DRS A;  1KFH A;  1NTX A;  1KS6 A;  1ES7 B;  2QJA C;  2LCR A;  3BT2 U;  3U73 U;  2FD6 U;  1IKC A;  1QKE A;  1W6B A;  2LA1 A;  1G6M A;  2CRS A;  1TGX A;  1XT3 A;  1MR6 A;  2MJ4 A;  2MHY A;  1CXO A;  1NOR A;  1M9Z A;  4UY2 C;  4FAO E;  1CVO A;  1ONJ A;  3KFD I;  1FFJ A;  1IK8 A;  1IDG A;  1JE9 A;  1F94 A;  6EBX A;  1JBD A;  1CHV S;  1FAS A;  2CRT A;  4DO8 A;  1QM7 A;  1REW C;  2CDX A;  2UWR A;  1KXI A;  4P7U A;  1S4Y A;  2MFA A;  2J8B A;  2H64 B;  1CDT A;  4QTI U;  1HAJ A;  1CDR A;  4OM5 A;  1H0J A;  2BTX A;  1PLO A;  2MUP A;  1HOY A;  1COE A;  1COD A;  1KC4 A;  1CRF A;  1CTX A;  2QC1 A;  1ERA A;  1NYS A;  2MJY A;  2NBT A;  4XJJ A;  3NEQ A;  1FSC A;  1KTZ B;  1MAH F;  4EY8 B;  1LXG A;  1IDL A;  1TXB A;  2CCX A;  1IDH A;  2N99 A;  2H5F A;  1IJC A;  1ZAD A;  5IMT D;  1VB0 A;  2MUO A;  3LAQ U;  4IYE A;  3NDS A;  2QJ9 C;  2K3G A;  4BDT B;  2PJY C;  5EBX A;  3NH7 A;  5IMY C;  1NXB A;  2PJY B;  2UX2 A;  5DO6 A;  1KBS A;  1LSI A;  4KSN A;  1CB9 A;  3PLC A;  1NYU A;  1CRE A;  4BIK B;  1CDQ A;  2ABX A;  3EBX A;  2H7Z A;  4AEA A;  1HC9 A;  1KL8 A;  1TFS A;  4ZQY A;  1KBA A;  2ERA A;  2HLQ A;  2JVE A;  1KU6 B;  2GOO C;  3BT1 U;  1CCQ A;  1B41 B;  2L03 A;  1CXN A;  1KBT A;  1FSS B;  4RUD A;  1NEA A;  1F8U B;  1RL5 A;  1I02 A;  2H7Z B;  4HQP F;  1TXA A;  5DU1 A;  1HC9 B;  1JGK A;  1RGJ A;  1V6P A;  2H8U A;  1CDS A;  2H62 C;  1FF4 A;  3KFD E;  1LX5 B;  2QJB C;  1BXP A;  1ABT A;  3EVS C;  3U74 U;  4LFT A;  2OFS A;  3ERA A;  1LJZ A;  1QKD A;  2BHI A;  1YWH A;  1NTN A;  1LXH A;  2X8B B;  2GOO B;  3FEV A;  1IDI A;  2CTX A;  1FRA A;  1IQ9 A;  2VLW A;  2H62 D;  1BTE A;  1ERG A; 
#chains in the Genus database with same CATH homology
 1UG4 A;  2I9B E;  2JQP A;  2MJ0 A;  3QB4 B;  2L5S A;  2H64 C;  4FAO C;  4OM4 A;  5DZ5 A;  1L4W A;  3VTS A;  1HAA A;  3HH7 A;  2HLR A;  1DRS A;  1KFH A;  1NTX A;  1KS6 A;  1ES7 B;  2QJA C;  2LCR A;  3BT2 U;  3U73 U;  2FD6 U;  1IKC A;  1QKE A;  1W6B A;  2LA1 A;  1G6M A;  2CRS A;  1TGX A;  1XT3 A;  1MR6 A;  2MJ4 A;  2MHY A;  1CXO A;  1NOR A;  1M9Z A;  4UY2 C;  4FAO E;  1CVO A;  1ONJ A;  3KFD I;  1FFJ A;  1IK8 A;  1IDG A;  1JE9 A;  1F94 A;  6EBX A;  1JBD A;  1CHV S;  1FAS A;  2CRT A;  4DO8 A;  1QM7 A;  1REW C;  2CDX A;  2UWR A;  1KXI A;  4P7U A;  1S4Y A;  2MFA A;  2J8B A;  2H64 B;  1CDT A;  4QTI U;  1HAJ A;  1CDR A;  4OM5 A;  1H0J A;  2BTX A;  1PLO A;  2MUP A;  1HOY A;  1COE A;  1COD A;  1KC4 A;  1CRF A;  1CTX A;  2QC1 A;  1ERA A;  1NYS A;  2MJY A;  2NBT A;  4XJJ A;  3NEQ A;  1FSC A;  1KTZ B;  1MAH F;  4EY8 B;  1LXG A;  1IDL A;  1TXB A;  2CCX A;  1IDH A;  2N99 A;  2H5F A;  1IJC A;  1ZAD A;  5IMT D;  1VB0 A;  2MUO A;  3LAQ U;  4IYE A;  3NDS A;  2QJ9 C;  2K3G A;  4BDT B;  2PJY C;  5EBX A;  3NH7 A;  5IMY C;  1NXB A;  2PJY B;  2UX2 A;  5DO6 A;  1KBS A;  1LSI A;  4KSN A;  1CB9 A;  3PLC A;  1NYU A;  1CRE A;  4BIK B;  1CDQ A;  2ABX A;  3EBX A;  2H7Z A;  4AEA A;  1HC9 A;  1KL8 A;  1TFS A;  4ZQY A;  1KBA A;  2ERA A;  2HLQ A;  2JVE A;  1KU6 B;  2GOO C;  3BT1 U;  1CCQ A;  1B41 B;  2L03 A;  1CXN A;  1KBT A;  1FSS B;  4RUD A;  1NEA A;  1F8U B;  1RL5 A;  1I02 A;  2H7Z B;  4HQP F;  1TXA A;  5DU1 A;  1HC9 B;  1JGK A;  1RGJ A;  1V6P A;  2H8U A;  1CDS A;  2H62 C;  1FF4 A;  3KFD E;  1LX5 B;  2QJB C;  1BXP A;  1ABT A;  3EVS C;  3U74 U;  4LFT A;  2OFS A;  3ERA A;  1LJZ A;  1QKD A;  2BHI A;  1YWH A;  1NTN A;  1LXH A;  2X8B B;  2GOO B;  3FEV A;  1IDI A;  2CTX A;  1FRA A;  1IQ9 A;  2VLW A;  2H62 D;  1BTE A;  1ERG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...