1RL5A

Nmr structure with tightly bound water molecule of cytotoxin i from naja oxiana in aqueous solution (major form)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPIAYKTCPEGKNLCYKMFMMSDLTIPVKRGCIDVCPKNSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Cytotoxin 1
publication title Interaction of three-finger toxins with phospholipid membranes: comparison of S- and P-type cytotoxins.
pubmed doi rcsb
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1rl5A00
3EVSC 2CRTA 1KXIA 1LJZA 2H5FA 1MAHF 1JGKA 1FF4A 1NTXA 5EBXA 4QTIU 1F94A 1COEA 1CXOA 1DRSA 1F8UB 2MFAA 4BDTB 2VLWA 3KFDE 1KFHA 1CXNA 3FEVA 1ERGA 1NYUA 1KL8A 2HLQA 1CRFA 1FSSB 4DO8A 4RUDA 1HAJA 2H62C 2H64B 1RL5A 2OFSA 3ERAA 3PLCA 5DO6A 4EY8B 1FSCA 2H62D 5IMTD 2CTXA 1CB9A 1ABTA 1M9ZA 2ERAA 1V6PA 4FAOE 2CDXA 1KS6A 1B41B 2H7ZA 2UWRA 2QJBC 4LFTA 2L5SA 1RGJA 1CODA 5DZ5A 2CRSA 1MR6A 2QC1A 1CDSA 3LAQU 2HLRA 2MHYA 4HQPF 1G6MA 1NTNA 2H64C 2L03A 1I02A 2JVEA 3NDSA 4OM5A 1REWC 2QJAC 1QKEA 2I9BE 1CVOA 3HH7A 1PLOA 1NYSA 1VB0A 4ZQYA 3KFDI 2FD6U 3NH7A 1BTEA 1QM7A 1FFJA 3NEQA 1LXGA 2MJ4A 1KC4A 2GOOC 1IJCA 1LSIA 1KTZB 1KBTA 4FAOC 1HOYA 1S4YA 3VTSA 2GOOB 1H0JA 1BXPA 4BIKB 1HC9A 2BTXA 1CCQA 1KBAA 3QB4B 1IDHA 6EBXA 1ONJA 2BHIA 1FASA 1NXBA 1KBSA 1UG4A 4XJJA 1CDRA 2H7ZB 1JE9A 5IMYC 2QJ9C 2MJYA 1LXHA 2LA1A 1TXBA 2NBTA 2JQPA 2MJ0A 4AEAA 1IKCA 2K3GA 3U74U 2X8BB 4P7UA 1ZADA 2PJYC 1NORA 2N99A 1IQ9A 2PJYB 4UY2C 1LX5B 2LCRA 2UX2A 2ABXA 1TFSA 1CDTA 2MUOA 1TXAA 2MUPA 3BT2U 1FRAA 1W6BA 5DU1A 1YWHA 1IDIA 1CDQA 1NEAA 1CREA 1TGXA 1ERAA 1JBDA 1KU6B 1XT3A 1IK8A 2CCXA 2H8UA 4OM4A 1CHVS 3U73U 1IDLA 1HC9B 1QKDA 1HAAA 1ES7B 1IDGA 4IYEA 3BT1U 3EBXA 2J8BA 1CTXA 1L4WA
chains in the Genus database with same CATH superfamily
3EVSC 2CRTA 1KXIA 1LJZA 2H5FA 1MAHF 1JGKA 1FF4A 1NTXA 5EBXA 4QTIU 1F94A 1COEA 1CXOA 1DRSA 1F8UB 2MFAA 4BDTB 2VLWA 3KFDE 1KFHA 1CXNA 3FEVA 1ERGA 1NYUA 1KL8A 2HLQA 1CRFA 1FSSB 4DO8A 4RUDA 1HAJA 2H62C 2H64B 1RL5A 2OFSA 3ERAA 3PLCA 5DO6A 4EY8B 1FSCA 2H62D 5IMTD 2CTXA 1CB9A 1ABTA 1M9ZA 2ERAA 1V6PA 4FAOE 2CDXA 1KS6A 1B41B 2H7ZA 2UWRA 2QJBC 4LFTA 2L5SA 1RGJA 1CODA 5DZ5A 2CRSA 1MR6A 2QC1A 1CDSA 3LAQU 2HLRA 2MHYA 4HQPF 1G6MA 1NTNA 2H64C 2L03A 1I02A 2JVEA 3NDSA 4OM5A 1REWC 2QJAC 1QKEA 2I9BE 1CVOA 3HH7A 1PLOA 1NYSA 1VB0A 4ZQYA 3KFDI 2FD6U 3NH7A 1BTEA 1QM7A 1FFJA 3NEQA 1LXGA 2MJ4A 1KC4A 2GOOC 1IJCA 1LSIA 1KTZB 1KBTA 4FAOC 1HOYA 1S4YA 3VTSA 2GOOB 1H0JA 1BXPA 4BIKB 1HC9A 2BTXA 1CCQA 1KBAA 3QB4B 1IDHA 6EBXA 1ONJA 2BHIA 1FASA 1NXBA 1KBSA 1UG4A 4XJJA 1CDRA 2H7ZB 1JE9A 5IMYC 2QJ9C 2MJYA 1LXHA 2LA1A 1TXBA 2NBTA 2JQPA 4KSNA 2MJ0A 4AEAA 1IKCA 2K3GA 3U74U 2X8BB 4P7UA 1ZADA 2PJYC 1NORA 2N99A 1IQ9A 2PJYB 4UY2C 1LX5B 2LCRA 2UX2A 2ABXA 1TFSA 1CDTA 2MUOA 1TXAA 2MUPA 3BT2U 1FRAA 1W6BA 5DU1A 1YWHA 1IDIA 1CDQA 1NEAA 1CREA 1TGXA 1ERAA 1JBDA 1KU6B 1XT3A 1IK8A 2CCXA 2H8UA 4OM4A 1CHVS 3U73U 1IDLA 1HC9B 1QKDA 1HAAA 1ES7B 1IDGA 4IYEA 3BT1U 3EBXA 2J8BA 1CTXA 1L4WA
chains in the Genus database with same CATH topology
3EVSC 2CRTA 1KXIA 1LJZA 2H5FA 1MAHF 1JGKA 1FF4A 1NTXA 5EBXA 4QTIU 1F94A 1COEA 1CXOA 1DRSA 1F8UB 2MFAA 4BDTB 2VLWA 3KFDE 1KFHA 1CXNA 3FEVA 1ERGA 1NYUA 1KL8A 2HLQA 1CRFA 1FSSB 4DO8A 4RUDA 1HAJA 2H62C 2H64B 1RL5A 2OFSA 3ERAA 3PLCA 5DO6A 4EY8B 1FSCA 2H62D 5IMTD 2CTXA 1CB9A 1ABTA 1M9ZA 2ERAA 1V6PA 4FAOE 2CDXA 1KS6A 1B41B 2H7ZA 2UWRA 2QJBC 4LFTA 2L5SA 1RGJA 1CODA 5DZ5A 2CRSA 1MR6A 2QC1A 1CDSA 3LAQU 2HLRA 2MHYA 4HQPF 1G6MA 1NTNA 2H64C 2L03A 1I02A 2JVEA 3NDSA 4OM5A 1REWC 2QJAC 1QKEA 2I9BE 1CVOA 3HH7A 1PLOA 1NYSA 1VB0A 4ZQYA 3KFDI 2FD6U 3NH7A 1BTEA 1QM7A 1FFJA 3NEQA 1LXGA 2MJ4A 1KC4A 2GOOC 1IJCA 1LSIA 1KTZB 1KBTA 4FAOC 1HOYA 1S4YA 3VTSA 2GOOB 1H0JA 1BXPA 4BIKB 1HC9A 2BTXA 1CCQA 1KBAA 3QB4B 1IDHA 6EBXA 1ONJA 2BHIA 1FASA 1NXBA 1KBSA 1UG4A 4XJJA 1CDRA 2H7ZB 1JE9A 5IMYC 2QJ9C 2MJYA 1LXHA 2LA1A 1TXBA 2NBTA 2JQPA 4KSNA 2MJ0A 4AEAA 1IKCA 2K3GA 3U74U 2X8BB 4P7UA 1ZADA 2PJYC 1NORA 2N99A 1IQ9A 2PJYB 4UY2C 1LX5B 2LCRA 2UX2A 2ABXA 1TFSA 1CDTA 2MUOA 1TXAA 2MUPA 3BT2U 1FRAA 1W6BA 5DU1A 1YWHA 1IDIA 1CDQA 1NEAA 1CREA 1TGXA 1ERAA 1JBDA 1KU6B 1XT3A 1IK8A 2CCXA 2H8UA 4OM4A 1CHVS 3U73U 1IDLA 1HC9B 1QKDA 1HAAA 1ES7B 1IDGA 4IYEA 3BT1U 3EBXA 2J8BA 1CTXA 1L4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVS C;  2CRT A;  1KXI A;  1LJZ A;  2H5F A;  1MAH F;  1JGK A;  1FF4 A;  1NTX A;  5EBX A;  4QTI U;  1F94 A;  1COE A;  1CXO A;  1DRS A;  1F8U B;  2MFA A;  4BDT B;  2VLW A;  3KFD E;  1KFH A;  1CXN A;  3FEV A;  1ERG A;  1NYU A;  1KL8 A;  2HLQ A;  1CRF A;  1FSS B;  4DO8 A;  4RUD A;  1HAJ A;  2H62 C;  2H64 B;  1RL5 A;  2OFS A;  3ERA A;  3PLC A;  5DO6 A;  4EY8 B;  1FSC A;  2H62 D;  5IMT D;  2CTX A;  1CB9 A;  1ABT A;  1M9Z A;  2ERA A;  1V6P A;  4FAO E;  2CDX A;  1KS6 A;  1B41 B;  2H7Z A;  2UWR A;  2QJB C;  4LFT A;  2L5S A;  1RGJ A;  1COD A;  5DZ5 A;  2CRS A;  1MR6 A;  2QC1 A;  1CDS A;  3LAQ U;  2HLR A;  2MHY A;  4HQP F;  1G6M A;  1NTN A;  2H64 C;  2L03 A;  1I02 A;  2JVE A;  3NDS A;  4OM5 A;  1REW C;  2QJA C;  1QKE A;  2I9B E;  1CVO A;  3HH7 A;  1PLO A;  1NYS A;  1VB0 A;  4ZQY A;  3KFD I;  2FD6 U;  3NH7 A;  1BTE A;  1QM7 A;  1FFJ A;  3NEQ A;  1LXG A;  2MJ4 A;  1KC4 A;  2GOO C;  1IJC A;  1LSI A;  1KTZ B;  1KBT A;  4FAO C;  1HOY A;  1S4Y A;  3VTS A;  2GOO B;  1H0J A;  1BXP A;  4BIK B;  1HC9 A;  2BTX A;  1CCQ A;  1KBA A;  3QB4 B;  1IDH A;  6EBX A;  1ONJ A;  2BHI A;  1FAS A;  1NXB A;  1KBS A;  1UG4 A;  4XJJ A;  1CDR A;  2H7Z B;  1JE9 A;  5IMY C;  2QJ9 C;  2MJY A;  1LXH A;  2LA1 A;  1TXB A;  2NBT A;  2JQP A;  2MJ0 A;  4AEA A;  1IKC A;  2K3G A;  3U74 U;  2X8B B;  4P7U A;  1ZAD A;  2PJY C;  1NOR A;  2N99 A;  1IQ9 A;  2PJY B;  4UY2 C;  1LX5 B;  2LCR A;  2UX2 A;  2ABX A;  1TFS A;  1CDT A;  2MUO A;  1TXA A;  2MUP A;  3BT2 U;  1FRA A;  1W6B A;  5DU1 A;  1YWH A;  1IDI A;  1CDQ A;  1NEA A;  1CRE A;  1TGX A;  1ERA A;  1JBD A;  1KU6 B;  1XT3 A;  1IK8 A;  2CCX A;  2H8U A;  4OM4 A;  1CHV S;  3U73 U;  1IDL A;  1HC9 B;  1QKD A;  1HAA A;  1ES7 B;  1IDG A;  4IYE A;  3BT1 U;  3EBX A;  2J8B A;  1CTX A;  1L4W A; 
#chains in the Genus database with same CATH topology
 3EVS C;  2CRT A;  1KXI A;  1LJZ A;  2H5F A;  1MAH F;  1JGK A;  1FF4 A;  1NTX A;  5EBX A;  4QTI U;  1F94 A;  1COE A;  1CXO A;  1DRS A;  1F8U B;  2MFA A;  4BDT B;  2VLW A;  3KFD E;  1KFH A;  1CXN A;  3FEV A;  1ERG A;  1NYU A;  1KL8 A;  2HLQ A;  1CRF A;  1FSS B;  4DO8 A;  4RUD A;  1HAJ A;  2H62 C;  2H64 B;  1RL5 A;  2OFS A;  3ERA A;  3PLC A;  5DO6 A;  4EY8 B;  1FSC A;  2H62 D;  5IMT D;  2CTX A;  1CB9 A;  1ABT A;  1M9Z A;  2ERA A;  1V6P A;  4FAO E;  2CDX A;  1KS6 A;  1B41 B;  2H7Z A;  2UWR A;  2QJB C;  4LFT A;  2L5S A;  1RGJ A;  1COD A;  5DZ5 A;  2CRS A;  1MR6 A;  2QC1 A;  1CDS A;  3LAQ U;  2HLR A;  2MHY A;  4HQP F;  1G6M A;  1NTN A;  2H64 C;  2L03 A;  1I02 A;  2JVE A;  3NDS A;  4OM5 A;  1REW C;  2QJA C;  1QKE A;  2I9B E;  1CVO A;  3HH7 A;  1PLO A;  1NYS A;  1VB0 A;  4ZQY A;  3KFD I;  2FD6 U;  3NH7 A;  1BTE A;  1QM7 A;  1FFJ A;  3NEQ A;  1LXG A;  2MJ4 A;  1KC4 A;  2GOO C;  1IJC A;  1LSI A;  1KTZ B;  1KBT A;  4FAO C;  1HOY A;  1S4Y A;  3VTS A;  2GOO B;  1H0J A;  1BXP A;  4BIK B;  1HC9 A;  2BTX A;  1CCQ A;  1KBA A;  3QB4 B;  1IDH A;  6EBX A;  1ONJ A;  2BHI A;  1FAS A;  1NXB A;  1KBS A;  1UG4 A;  4XJJ A;  1CDR A;  2H7Z B;  1JE9 A;  5IMY C;  2QJ9 C;  2MJY A;  1LXH A;  2LA1 A;  1TXB A;  2NBT A;  2JQP A;  4KSN A;  2MJ0 A;  4AEA A;  1IKC A;  2K3G A;  3U74 U;  2X8B B;  4P7U A;  1ZAD A;  2PJY C;  1NOR A;  2N99 A;  1IQ9 A;  2PJY B;  4UY2 C;  1LX5 B;  2LCR A;  2UX2 A;  2ABX A;  1TFS A;  1CDT A;  2MUO A;  1TXA A;  2MUP A;  3BT2 U;  1FRA A;  1W6B A;  5DU1 A;  1YWH A;  1IDI A;  1CDQ A;  1NEA A;  1CRE A;  1TGX A;  1ERA A;  1JBD A;  1KU6 B;  1XT3 A;  1IK8 A;  2CCX A;  2H8U A;  4OM4 A;  1CHV S;  3U73 U;  1IDL A;  1HC9 B;  1QKD A;  1HAA A;  1ES7 B;  1IDG A;  4IYE A;  3BT1 U;  3EBX A;  2J8B A;  1CTX A;  1L4W A; 
#chains in the Genus database with same CATH homology
 3EVS C;  2CRT A;  1KXI A;  1LJZ A;  2H5F A;  1MAH F;  1JGK A;  1FF4 A;  1NTX A;  5EBX A;  4QTI U;  1F94 A;  1COE A;  1CXO A;  1DRS A;  1F8U B;  2MFA A;  4BDT B;  2VLW A;  3KFD E;  1KFH A;  1CXN A;  3FEV A;  1ERG A;  1NYU A;  1KL8 A;  2HLQ A;  1CRF A;  1FSS B;  4DO8 A;  4RUD A;  1HAJ A;  2H62 C;  2H64 B;  1RL5 A;  2OFS A;  3ERA A;  3PLC A;  5DO6 A;  4EY8 B;  1FSC A;  2H62 D;  5IMT D;  2CTX A;  1CB9 A;  1ABT A;  1M9Z A;  2ERA A;  1V6P A;  4FAO E;  2CDX A;  1KS6 A;  1B41 B;  2H7Z A;  2UWR A;  2QJB C;  4LFT A;  2L5S A;  1RGJ A;  1COD A;  5DZ5 A;  2CRS A;  1MR6 A;  2QC1 A;  1CDS A;  3LAQ U;  2HLR A;  2MHY A;  4HQP F;  1G6M A;  1NTN A;  2H64 C;  2L03 A;  1I02 A;  2JVE A;  3NDS A;  4OM5 A;  1REW C;  2QJA C;  1QKE A;  2I9B E;  1CVO A;  3HH7 A;  1PLO A;  1NYS A;  1VB0 A;  4ZQY A;  3KFD I;  2FD6 U;  3NH7 A;  1BTE A;  1QM7 A;  1FFJ A;  3NEQ A;  1LXG A;  2MJ4 A;  1KC4 A;  2GOO C;  1IJC A;  1LSI A;  1KTZ B;  1KBT A;  4FAO C;  1HOY A;  1S4Y A;  3VTS A;  2GOO B;  1H0J A;  1BXP A;  4BIK B;  1HC9 A;  2BTX A;  1CCQ A;  1KBA A;  3QB4 B;  1IDH A;  6EBX A;  1ONJ A;  2BHI A;  1FAS A;  1NXB A;  1KBS A;  1UG4 A;  4XJJ A;  1CDR A;  2H7Z B;  1JE9 A;  5IMY C;  2QJ9 C;  2MJY A;  1LXH A;  2LA1 A;  1TXB A;  2NBT A;  2JQP A;  4KSN A;  2MJ0 A;  4AEA A;  1IKC A;  2K3G A;  3U74 U;  2X8B B;  4P7U A;  1ZAD A;  2PJY C;  1NOR A;  2N99 A;  1IQ9 A;  2PJY B;  4UY2 C;  1LX5 B;  2LCR A;  2UX2 A;  2ABX A;  1TFS A;  1CDT A;  2MUO A;  1TXA A;  2MUP A;  3BT2 U;  1FRA A;  1W6B A;  5DU1 A;  1YWH A;  1IDI A;  1CDQ A;  1NEA A;  1CRE A;  1TGX A;  1ERA A;  1JBD A;  1KU6 B;  1XT3 A;  1IK8 A;  2CCX A;  2H8U A;  4OM4 A;  1CHV S;  3U73 U;  1IDL A;  1HC9 B;  1QKD A;  1HAA A;  1ES7 B;  1IDG A;  4IYE A;  3BT1 U;  3EBX A;  2J8B A;  1CTX A;  1L4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...