1RL5A

Nmr structure with tightly bound water molecule of cytotoxin i from naja oxiana in aqueous solution (major form)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
b'LKCNKLVPIAYKTCPEGKNLCYKMFMMSDLTIPVKRGCIDVCPKNSLLVKYVCCNTDRCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxin 1
publication title Interaction of three-finger toxins with phospholipid membranes: comparison of S- and P-type cytotoxins.
pubmed doi rcsb
molecule tags Toxin
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1rl5A00
1RL5A 1KL8A 1V6PA 3ERAA 4QTIU 1IJCA 1IK8A 6EBXA 1ERAA 1CCQA 2QJBC 2MJ0A 1ES7B 1KXIA 1COEA 4FAOE 1HC9A 1VB0A 1ZADA 1LSIA 1L4WA 1CTXA 2VLWA 1CXOA 1JE9A 2MJYA 2PJYB 1NXBA 2K3GA 3BT2U 1G6MA 1HOYA 3EVSC 1DRSA 1S4YA 2H62D 3LAQU 2H7ZA 5IMYC 4OM5A 2CTXA 2H5FA 5EBXA 1KBTA 1TGXA 1FSCA 2BTXA 1FF4A 1NYUA 2CRSA 1FRAA 2QC1A 2GOOC 1IKCA 2N99A 4OM4A 1CB9A 1IDHA 1CODA 4AEAA 4UY2C 1BXPA 2BHIA 3U73U 1ONJA 1NORA 1W6BA 5IMTD 5DZ5A 3U74U 2X8BB 1IQ9A 3BT1U 1NEAA 2ABXA 3NH7A 2HLRA 4HQPF 4IYEA 1CDTA 1RGJA 1KU6B 2GOOB 2FD6U 2H7ZB 3KFDE 2LA1A 4LFTA 1HAJA 1XT3A 2L03A 2UWRA 1YWHA 2JQPA 2OFSA 1CHVS 1LJZA 1CDSA 2H62C 1TFSA 2JVEA 1LX5B 1H0JA 1CRFA 1IDGA 2LCRA 4DO8A 1ABTA 1IDIA 2H8UA 1REWC 2MFAA 4RUDA 1HC9B 2CRTA 1B41B 2CCXA 1KC4A 2CDXA 2MJ4A 1NTNA 1CREA 1QM7A 1FSSB 1UG4A 2QJ9C 1NYSA 2UX2A 2H64B 1FASA 2MUOA 3VTSA 1I02A 1KBAA 4FAOC 1CDRA 3FEVA 2MUPA 1LXHA 2ERAA 1F8UB 5DO6A 1F94A 5DU1A 1NTXA 2H64C 4P7UA 2NBTA 3EBXA 1PLOA 3NDSA 1KTZB 1LXGA 3NEQA 1ERGA 3QB4B 4BIKB 2MHYA 1QKEA 2L5SA 1TXBA 1KFHA 1JGKA 4EY8B 3HH7A 2I9BE 2HLQA 1CVOA 1CDQA 1CXNA 1IDLA 2QJAC 3PLCA 1MR6A 1M9ZA 2J8BA 1FFJA 1KS6A 1TXAA 1JBDA 1HAAA 2PJYC 4XJJA 3KFDI 1MAHF 1BTEA 4ZQYA 1KBSA 1QKDA 4BDTB
chains in the Genus database with same CATH superfamily
1RL5A 1KL8A 1V6PA 3ERAA 4KSNA 4QTIU 1IJCA 1IK8A 6EBXA 1ERAA 1CCQA 2QJBC 2MJ0A 1ES7B 1KXIA 1COEA 4FAOE 1HC9A 1VB0A 1ZADA 1LSIA 1L4WA 1CTXA 2VLWA 1CXOA 1JE9A 2MJYA 2PJYB 1NXBA 2K3GA 3BT2U 1G6MA 1HOYA 3EVSC 1DRSA 1S4YA 2H62D 3LAQU 2H7ZA 5IMYC 4OM5A 2CTXA 2H5FA 5EBXA 1KBTA 1TGXA 1FSCA 2BTXA 1FF4A 1NYUA 2CRSA 1FRAA 2QC1A 2GOOC 1IKCA 2N99A 4OM4A 1CB9A 1IDHA 1CODA 4AEAA 4UY2C 1BXPA 2BHIA 3U73U 1ONJA 1NORA 1W6BA 5IMTD 5DZ5A 3U74U 2X8BB 1IQ9A 3BT1U 1NEAA 2ABXA 3NH7A 2HLRA 4HQPF 4IYEA 1CDTA 1RGJA 1KU6B 2GOOB 2FD6U 2H7ZB 3KFDE 2LA1A 4LFTA 1HAJA 1XT3A 2L03A 2UWRA 1YWHA 2JQPA 2OFSA 1CHVS 1LJZA 1CDSA 2H62C 1TFSA 2JVEA 1LX5B 1H0JA 1CRFA 1IDGA 2LCRA 4DO8A 1ABTA 1IDIA 2H8UA 1REWC 2MFAA 4RUDA 1HC9B 2CRTA 1B41B 2CCXA 1KC4A 2CDXA 2MJ4A 1NTNA 1CREA 1QM7A 1FSSB 1UG4A 2QJ9C 1NYSA 2UX2A 2H64B 1FASA 2MUOA 3VTSA 1I02A 1KBAA 4FAOC 1CDRA 3FEVA 2MUPA 1LXHA 2ERAA 1F8UB 5DO6A 1F94A 5DU1A 1NTXA 2H64C 4P7UA 2NBTA 3EBXA 1PLOA 3NDSA 1KTZB 1LXGA 3NEQA 1ERGA 3QB4B 4BIKB 2MHYA 1QKEA 2L5SA 1TXBA 1KFHA 1JGKA 4EY8B 3HH7A 2I9BE 2HLQA 1CVOA 1CDQA 1CXNA 1IDLA 2QJAC 3PLCA 1MR6A 1M9ZA 2J8BA 1FFJA 1KS6A 1TXAA 1JBDA 1HAAA 2PJYC 4XJJA 3KFDI 1MAHF 1BTEA 4ZQYA 1KBSA 1QKDA 4BDTB
chains in the Genus database with same CATH topology
1RL5A 1KL8A 1V6PA 3ERAA 4KSNA 4QTIU 1IJCA 1IK8A 6EBXA 1ERAA 1CCQA 2QJBC 2MJ0A 1ES7B 1KXIA 1COEA 4FAOE 1HC9A 1VB0A 1ZADA 1LSIA 1L4WA 1CTXA 2VLWA 1CXOA 1JE9A 2MJYA 2PJYB 1NXBA 2K3GA 3BT2U 1G6MA 1HOYA 3EVSC 1DRSA 1S4YA 2H62D 3LAQU 2H7ZA 5IMYC 4OM5A 2CTXA 2H5FA 5EBXA 1KBTA 1TGXA 1FSCA 2BTXA 1FF4A 1NYUA 2CRSA 1FRAA 2QC1A 2GOOC 1IKCA 2N99A 4OM4A 1CB9A 1IDHA 1CODA 4AEAA 4UY2C 1BXPA 2BHIA 3U73U 1ONJA 1NORA 1W6BA 5IMTD 5DZ5A 3U74U 2X8BB 1IQ9A 3BT1U 1NEAA 2ABXA 3NH7A 2HLRA 4HQPF 4IYEA 1CDTA 1RGJA 1KU6B 2GOOB 2FD6U 2H7ZB 3KFDE 2LA1A 4LFTA 1HAJA 1XT3A 2L03A 2UWRA 1YWHA 2JQPA 2OFSA 1CHVS 1LJZA 1CDSA 2H62C 1TFSA 2JVEA 1LX5B 1H0JA 1CRFA 1IDGA 2LCRA 4DO8A 1ABTA 1IDIA 2H8UA 1REWC 2MFAA 4RUDA 1HC9B 2CRTA 1B41B 2CCXA 1KC4A 2CDXA 2MJ4A 1NTNA 1CREA 1QM7A 1FSSB 1UG4A 2QJ9C 1NYSA 2UX2A 2H64B 1FASA 2MUOA 3VTSA 1I02A 1KBAA 4FAOC 1CDRA 3FEVA 2MUPA 1LXHA 2ERAA 1F8UB 5DO6A 1F94A 5DU1A 1NTXA 2H64C 4P7UA 2NBTA 3EBXA 1PLOA 3NDSA 1KTZB 1LXGA 3NEQA 1ERGA 3QB4B 4BIKB 2MHYA 1QKEA 2L5SA 1TXBA 1KFHA 1JGKA 4EY8B 3HH7A 2I9BE 2HLQA 1CVOA 1CDQA 1CXNA 1IDLA 2QJAC 3PLCA 1MR6A 1M9ZA 2J8BA 1FFJA 1KS6A 1TXAA 1JBDA 1HAAA 2PJYC 4XJJA 3KFDI 1MAHF 1BTEA 4ZQYA 1KBSA 1QKDA 4BDTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RL5 A;  1KL8 A;  1V6P A;  3ERA A;  4QTI U;  1IJC A;  1IK8 A;  6EBX A;  1ERA A;  1CCQ A;  2QJB C;  2MJ0 A;  1ES7 B;  1KXI A;  1COE A;  4FAO E;  1HC9 A;  1VB0 A;  1ZAD A;  1LSI A;  1L4W A;  1CTX A;  2VLW A;  1CXO A;  1JE9 A;  2MJY A;  2PJY B;  1NXB A;  2K3G A;  3BT2 U;  1G6M A;  1HOY A;  3EVS C;  1DRS A;  1S4Y A;  2H62 D;  3LAQ U;  2H7Z A;  5IMY C;  4OM5 A;  2CTX A;  2H5F A;  5EBX A;  1KBT A;  1TGX A;  1FSC A;  2BTX A;  1FF4 A;  1NYU A;  2CRS A;  1FRA A;  2QC1 A;  2GOO C;  1IKC A;  2N99 A;  4OM4 A;  1CB9 A;  1IDH A;  1COD A;  4AEA A;  4UY2 C;  1BXP A;  2BHI A;  3U73 U;  1ONJ A;  1NOR A;  1W6B A;  5IMT D;  5DZ5 A;  3U74 U;  2X8B B;  1IQ9 A;  3BT1 U;  1NEA A;  2ABX A;  3NH7 A;  2HLR A;  4HQP F;  4IYE A;  1CDT A;  1RGJ A;  1KU6 B;  2GOO B;  2FD6 U;  2H7Z B;  3KFD E;  2LA1 A;  4LFT A;  1HAJ A;  1XT3 A;  2L03 A;  2UWR A;  1YWH A;  2JQP A;  2OFS A;  1CHV S;  1LJZ A;  1CDS A;  2H62 C;  1TFS A;  2JVE A;  1LX5 B;  1H0J A;  1CRF A;  1IDG A;  2LCR A;  4DO8 A;  1ABT A;  1IDI A;  2H8U A;  1REW C;  2MFA A;  4RUD A;  1HC9 B;  2CRT A;  1B41 B;  2CCX A;  1KC4 A;  2CDX A;  2MJ4 A;  1NTN A;  1CRE A;  1QM7 A;  1FSS B;  1UG4 A;  2QJ9 C;  1NYS A;  2UX2 A;  2H64 B;  1FAS A;  2MUO A;  3VTS A;  1I02 A;  1KBA A;  4FAO C;  1CDR A;  3FEV A;  2MUP A;  1LXH A;  2ERA A;  1F8U B;  5DO6 A;  1F94 A;  5DU1 A;  1NTX A;  2H64 C;  4P7U A;  2NBT A;  3EBX A;  1PLO A;  3NDS A;  1KTZ B;  1LXG A;  3NEQ A;  1ERG A;  3QB4 B;  4BIK B;  2MHY A;  1QKE A;  2L5S A;  1TXB A;  1KFH A;  1JGK A;  4EY8 B;  3HH7 A;  2I9B E;  2HLQ A;  1CVO A;  1CDQ A;  1CXN A;  1IDL A;  2QJA C;  3PLC A;  1MR6 A;  1M9Z A;  2J8B A;  1FFJ A;  1KS6 A;  1TXA A;  1JBD A;  1HAA A;  2PJY C;  4XJJ A;  3KFD I;  1MAH F;  1BTE A;  4ZQY A;  1KBS A;  1QKD A;  4BDT B; 
#chains in the Genus database with same CATH topology
 1RL5 A;  1KL8 A;  1V6P A;  3ERA A;  4KSN A;  4QTI U;  1IJC A;  1IK8 A;  6EBX A;  1ERA A;  1CCQ A;  2QJB C;  2MJ0 A;  1ES7 B;  1KXI A;  1COE A;  4FAO E;  1HC9 A;  1VB0 A;  1ZAD A;  1LSI A;  1L4W A;  1CTX A;  2VLW A;  1CXO A;  1JE9 A;  2MJY A;  2PJY B;  1NXB A;  2K3G A;  3BT2 U;  1G6M A;  1HOY A;  3EVS C;  1DRS A;  1S4Y A;  2H62 D;  3LAQ U;  2H7Z A;  5IMY C;  4OM5 A;  2CTX A;  2H5F A;  5EBX A;  1KBT A;  1TGX A;  1FSC A;  2BTX A;  1FF4 A;  1NYU A;  2CRS A;  1FRA A;  2QC1 A;  2GOO C;  1IKC A;  2N99 A;  4OM4 A;  1CB9 A;  1IDH A;  1COD A;  4AEA A;  4UY2 C;  1BXP A;  2BHI A;  3U73 U;  1ONJ A;  1NOR A;  1W6B A;  5IMT D;  5DZ5 A;  3U74 U;  2X8B B;  1IQ9 A;  3BT1 U;  1NEA A;  2ABX A;  3NH7 A;  2HLR A;  4HQP F;  4IYE A;  1CDT A;  1RGJ A;  1KU6 B;  2GOO B;  2FD6 U;  2H7Z B;  3KFD E;  2LA1 A;  4LFT A;  1HAJ A;  1XT3 A;  2L03 A;  2UWR A;  1YWH A;  2JQP A;  2OFS A;  1CHV S;  1LJZ A;  1CDS A;  2H62 C;  1TFS A;  2JVE A;  1LX5 B;  1H0J A;  1CRF A;  1IDG A;  2LCR A;  4DO8 A;  1ABT A;  1IDI A;  2H8U A;  1REW C;  2MFA A;  4RUD A;  1HC9 B;  2CRT A;  1B41 B;  2CCX A;  1KC4 A;  2CDX A;  2MJ4 A;  1NTN A;  1CRE A;  1QM7 A;  1FSS B;  1UG4 A;  2QJ9 C;  1NYS A;  2UX2 A;  2H64 B;  1FAS A;  2MUO A;  3VTS A;  1I02 A;  1KBA A;  4FAO C;  1CDR A;  3FEV A;  2MUP A;  1LXH A;  2ERA A;  1F8U B;  5DO6 A;  1F94 A;  5DU1 A;  1NTX A;  2H64 C;  4P7U A;  2NBT A;  3EBX A;  1PLO A;  3NDS A;  1KTZ B;  1LXG A;  3NEQ A;  1ERG A;  3QB4 B;  4BIK B;  2MHY A;  1QKE A;  2L5S A;  1TXB A;  1KFH A;  1JGK A;  4EY8 B;  3HH7 A;  2I9B E;  2HLQ A;  1CVO A;  1CDQ A;  1CXN A;  1IDL A;  2QJA C;  3PLC A;  1MR6 A;  1M9Z A;  2J8B A;  1FFJ A;  1KS6 A;  1TXA A;  1JBD A;  1HAA A;  2PJY C;  4XJJ A;  3KFD I;  1MAH F;  1BTE A;  4ZQY A;  1KBS A;  1QKD A;  4BDT B; 
#chains in the Genus database with same CATH homology
 1RL5 A;  1KL8 A;  1V6P A;  3ERA A;  4KSN A;  4QTI U;  1IJC A;  1IK8 A;  6EBX A;  1ERA A;  1CCQ A;  2QJB C;  2MJ0 A;  1ES7 B;  1KXI A;  1COE A;  4FAO E;  1HC9 A;  1VB0 A;  1ZAD A;  1LSI A;  1L4W A;  1CTX A;  2VLW A;  1CXO A;  1JE9 A;  2MJY A;  2PJY B;  1NXB A;  2K3G A;  3BT2 U;  1G6M A;  1HOY A;  3EVS C;  1DRS A;  1S4Y A;  2H62 D;  3LAQ U;  2H7Z A;  5IMY C;  4OM5 A;  2CTX A;  2H5F A;  5EBX A;  1KBT A;  1TGX A;  1FSC A;  2BTX A;  1FF4 A;  1NYU A;  2CRS A;  1FRA A;  2QC1 A;  2GOO C;  1IKC A;  2N99 A;  4OM4 A;  1CB9 A;  1IDH A;  1COD A;  4AEA A;  4UY2 C;  1BXP A;  2BHI A;  3U73 U;  1ONJ A;  1NOR A;  1W6B A;  5IMT D;  5DZ5 A;  3U74 U;  2X8B B;  1IQ9 A;  3BT1 U;  1NEA A;  2ABX A;  3NH7 A;  2HLR A;  4HQP F;  4IYE A;  1CDT A;  1RGJ A;  1KU6 B;  2GOO B;  2FD6 U;  2H7Z B;  3KFD E;  2LA1 A;  4LFT A;  1HAJ A;  1XT3 A;  2L03 A;  2UWR A;  1YWH A;  2JQP A;  2OFS A;  1CHV S;  1LJZ A;  1CDS A;  2H62 C;  1TFS A;  2JVE A;  1LX5 B;  1H0J A;  1CRF A;  1IDG A;  2LCR A;  4DO8 A;  1ABT A;  1IDI A;  2H8U A;  1REW C;  2MFA A;  4RUD A;  1HC9 B;  2CRT A;  1B41 B;  2CCX A;  1KC4 A;  2CDX A;  2MJ4 A;  1NTN A;  1CRE A;  1QM7 A;  1FSS B;  1UG4 A;  2QJ9 C;  1NYS A;  2UX2 A;  2H64 B;  1FAS A;  2MUO A;  3VTS A;  1I02 A;  1KBA A;  4FAO C;  1CDR A;  3FEV A;  2MUP A;  1LXH A;  2ERA A;  1F8U B;  5DO6 A;  1F94 A;  5DU1 A;  1NTX A;  2H64 C;  4P7U A;  2NBT A;  3EBX A;  1PLO A;  3NDS A;  1KTZ B;  1LXG A;  3NEQ A;  1ERG A;  3QB4 B;  4BIK B;  2MHY A;  1QKE A;  2L5S A;  1TXB A;  1KFH A;  1JGK A;  4EY8 B;  3HH7 A;  2I9B E;  2HLQ A;  1CVO A;  1CDQ A;  1CXN A;  1IDL A;  2QJA C;  3PLC A;  1MR6 A;  1M9Z A;  2J8B A;  1FFJ A;  1KS6 A;  1TXA A;  1JBD A;  1HAA A;  2PJY C;  4XJJ A;  3KFD I;  1MAH F;  1BTE A;  4ZQY A;  1KBS A;  1QKD A;  4BDT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...