1RL5A

Nmr structure with tightly bound water molecule of cytotoxin i from naja oxiana in aqueous solution (major form)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPIAYKTCPEGKNLCYKMFMMSDLTIPVKRGCIDVCPKNSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxin 1
publication title Interaction of three-finger toxins with phospholipid membranes: comparison of S- and P-type cytotoxins.
pubmed doi rcsb
molecule tags Toxin
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1rl5A00
1ERAA 1UG4A 2UWRA 5DO6A 1ZADA 1LXGA 5DU1A 1QKDA 2QJ9C 2L03A 4XJJA 4OM4A 2CRTA 1YWHA 1QKEA 1ERGA 1W6BA 2LA1A 2MJYA 1CHVS 3BT2U 1HAJA 1HC9A 2GOOC 2BTXA 4UY2C 2H7ZB 4EY8B 1KBAA 2JVEA 1LSIA 1FSSB 1DRSA 1H0JA 2MUOA 1L4WA 1VB0A 4DO8A 1ES7B 5IMTD 1G6MA 1FFJA 1I02A 1KC4A 2QJBC 2QJAC 1TXAA 2MFAA 3VTSA 5EBXA 2QC1A 1JGKA 1CRFA 2CDXA 1KFHA 1LJZA 1LXHA 1PLOA 2MJ0A 5DZ5A 1FF4A 2H62D 4FAOE 4HQPF 1JE9A 1RGJA 1ONJA 2LCRA 1CDRA 1FRAA 1IK8A 1CDTA 1TFSA 1HC9B 4FAOC 1IDLA 1KXIA 1KS6A 5IMYC 1RL5A 2JQPA 1BXPA 1COEA 1TXBA 4BDTB 1KU6B 1KBSA 2J8BA 1NYUA 2BHIA 3PLCA 2CCXA 1S4YA 6EBXA 2OFSA 3FEVA 3NH7A 1M9ZA 2ERAA 1KL8A 2H7ZA 2I9BE 4AEAA 3NDSA 1CTXA 1NTXA 1ABTA 1IDHA 1IDGA 1IQ9A 1CCQA 1F94A 1F8UB 3ERAA 1CXNA 2CTXA 1LX5B 1FASA 1BTEA 1NORA 1CXOA 1HAAA 1IJCA 1HOYA 2X8BB 1IKCA 2H62C 1REWC 3QB4B 1NTNA 2MUPA 3NEQA 4ZQYA 1NYSA 1CB9A 1XT3A 2H64B 4IYEA 2FD6U 1CDQA 4QTIU 4OM5A 1QM7A 3HH7A 2CRSA 1KBTA 2PJYB 3EBXA 1KTZB 1B41B 1MAHF 4RUDA 1NEAA 2H5FA 1TGXA 3U74U 2ABXA 2MHYA 1CREA 1V6PA 2L5SA 3LAQU 1CVOA 1MR6A 2HLRA 2H8UA 3U73U 3KFDE 1FSCA 1NXBA 1JBDA 1IDIA 2GOOB 2K3GA 3BT1U 1CDSA 1CODA 3KFDI 2H64C 4BIKB 2HLQA 2VLWA 4LFTA 3EVSC 2PJYC 4P7UA 2NBTA 2MJ4A 2UX2A 2N99A
chains in the Genus database with same CATH superfamily
1ERAA 1UG4A 2UWRA 5DO6A 1ZADA 1LXGA 5DU1A 1QKDA 2QJ9C 2L03A 4XJJA 4OM4A 2CRTA 1YWHA 1QKEA 1ERGA 1W6BA 2LA1A 2MJYA 1CHVS 3BT2U 1HAJA 1HC9A 2GOOC 2BTXA 4UY2C 2H7ZB 4EY8B 1KBAA 2JVEA 1LSIA 1FSSB 1DRSA 1H0JA 2MUOA 1L4WA 1VB0A 4DO8A 1ES7B 5IMTD 1G6MA 4KSNA 1FFJA 1I02A 1KC4A 2QJBC 2QJAC 1TXAA 2MFAA 3VTSA 5EBXA 2QC1A 1JGKA 1CRFA 2CDXA 1KFHA 1LJZA 1LXHA 1PLOA 2MJ0A 5DZ5A 1FF4A 2H62D 4FAOE 4HQPF 1JE9A 1RGJA 1ONJA 2LCRA 1CDRA 1FRAA 1IK8A 1CDTA 1TFSA 1HC9B 4FAOC 1IDLA 1KXIA 1KS6A 5IMYC 1RL5A 2JQPA 1BXPA 1COEA 1TXBA 4BDTB 1KU6B 1KBSA 2J8BA 1NYUA 2BHIA 3PLCA 2CCXA 1S4YA 6EBXA 2OFSA 3FEVA 3NH7A 1M9ZA 2ERAA 1KL8A 2H7ZA 2I9BE 4AEAA 3NDSA 1CTXA 1NTXA 1ABTA 1IDHA 1IDGA 1IQ9A 1CCQA 1F94A 1F8UB 3ERAA 1CXNA 2CTXA 1LX5B 1FASA 1BTEA 1NORA 1CXOA 1HAAA 1IJCA 1HOYA 2X8BB 1IKCA 2H62C 1REWC 3QB4B 1NTNA 2MUPA 3NEQA 4ZQYA 1NYSA 1CB9A 1XT3A 2H64B 4IYEA 2FD6U 1CDQA 4QTIU 4OM5A 1QM7A 3HH7A 2CRSA 1KBTA 2PJYB 3EBXA 1KTZB 1B41B 1MAHF 4RUDA 1NEAA 2H5FA 1TGXA 3U74U 2ABXA 2MHYA 1CREA 1V6PA 2L5SA 3LAQU 1CVOA 1MR6A 2HLRA 2H8UA 3U73U 3KFDE 1FSCA 1NXBA 1JBDA 1IDIA 2GOOB 2K3GA 3BT1U 1CDSA 1CODA 3KFDI 2H64C 4BIKB 2HLQA 2VLWA 4LFTA 3EVSC 2PJYC 4P7UA 2NBTA 2MJ4A 2UX2A 2N99A
chains in the Genus database with same CATH topology
1ERAA 1UG4A 2UWRA 5DO6A 1ZADA 1LXGA 5DU1A 1QKDA 2QJ9C 2L03A 4XJJA 4OM4A 2CRTA 1YWHA 1QKEA 1ERGA 1W6BA 2LA1A 2MJYA 1CHVS 3BT2U 1HAJA 1HC9A 2GOOC 2BTXA 4UY2C 2H7ZB 4EY8B 1KBAA 2JVEA 1LSIA 1FSSB 1DRSA 1H0JA 2MUOA 1L4WA 1VB0A 4DO8A 1ES7B 5IMTD 1G6MA 4KSNA 1FFJA 1I02A 1KC4A 2QJBC 2QJAC 1TXAA 2MFAA 3VTSA 5EBXA 2QC1A 1JGKA 1CRFA 2CDXA 1KFHA 1LJZA 1LXHA 1PLOA 2MJ0A 5DZ5A 1FF4A 2H62D 4FAOE 4HQPF 1JE9A 1RGJA 1ONJA 2LCRA 1CDRA 1FRAA 1IK8A 1CDTA 1TFSA 1HC9B 4FAOC 1IDLA 1KXIA 1KS6A 5IMYC 1RL5A 2JQPA 1BXPA 1COEA 1TXBA 4BDTB 1KU6B 1KBSA 2J8BA 1NYUA 2BHIA 3PLCA 2CCXA 1S4YA 6EBXA 2OFSA 3FEVA 3NH7A 1M9ZA 2ERAA 1KL8A 2H7ZA 2I9BE 4AEAA 3NDSA 1CTXA 1NTXA 1ABTA 1IDHA 1IDGA 1IQ9A 1CCQA 1F94A 1F8UB 3ERAA 1CXNA 2CTXA 1LX5B 1FASA 1BTEA 1NORA 1CXOA 1HAAA 1IJCA 1HOYA 2X8BB 1IKCA 2H62C 1REWC 3QB4B 1NTNA 2MUPA 3NEQA 4ZQYA 1NYSA 1CB9A 1XT3A 2H64B 4IYEA 2FD6U 1CDQA 4QTIU 4OM5A 1QM7A 3HH7A 2CRSA 1KBTA 2PJYB 3EBXA 1KTZB 1B41B 1MAHF 4RUDA 1NEAA 2H5FA 1TGXA 3U74U 2ABXA 2MHYA 1CREA 1V6PA 2L5SA 3LAQU 1CVOA 1MR6A 2HLRA 2H8UA 3U73U 3KFDE 1FSCA 1NXBA 1JBDA 1IDIA 2GOOB 2K3GA 3BT1U 1CDSA 1CODA 3KFDI 2H64C 4BIKB 2HLQA 2VLWA 4LFTA 3EVSC 2PJYC 4P7UA 2NBTA 2MJ4A 2UX2A 2N99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERA A;  1UG4 A;  2UWR A;  5DO6 A;  1ZAD A;  1LXG A;  5DU1 A;  1QKD A;  2QJ9 C;  2L03 A;  4XJJ A;  4OM4 A;  2CRT A;  1YWH A;  1QKE A;  1ERG A;  1W6B A;  2LA1 A;  2MJY A;  1CHV S;  3BT2 U;  1HAJ A;  1HC9 A;  2GOO C;  2BTX A;  4UY2 C;  2H7Z B;  4EY8 B;  1KBA A;  2JVE A;  1LSI A;  1FSS B;  1DRS A;  1H0J A;  2MUO A;  1L4W A;  1VB0 A;  4DO8 A;  1ES7 B;  5IMT D;  1G6M A;  1FFJ A;  1I02 A;  1KC4 A;  2QJB C;  2QJA C;  1TXA A;  2MFA A;  3VTS A;  5EBX A;  2QC1 A;  1JGK A;  1CRF A;  2CDX A;  1KFH A;  1LJZ A;  1LXH A;  1PLO A;  2MJ0 A;  5DZ5 A;  1FF4 A;  2H62 D;  4FAO E;  4HQP F;  1JE9 A;  1RGJ A;  1ONJ A;  2LCR A;  1CDR A;  1FRA A;  1IK8 A;  1CDT A;  1TFS A;  1HC9 B;  4FAO C;  1IDL A;  1KXI A;  1KS6 A;  5IMY C;  1RL5 A;  2JQP A;  1BXP A;  1COE A;  1TXB A;  4BDT B;  1KU6 B;  1KBS A;  2J8B A;  1NYU A;  2BHI A;  3PLC A;  2CCX A;  1S4Y A;  6EBX A;  2OFS A;  3FEV A;  3NH7 A;  1M9Z A;  2ERA A;  1KL8 A;  2H7Z A;  2I9B E;  4AEA A;  3NDS A;  1CTX A;  1NTX A;  1ABT A;  1IDH A;  1IDG A;  1IQ9 A;  1CCQ A;  1F94 A;  1F8U B;  3ERA A;  1CXN A;  2CTX A;  1LX5 B;  1FAS A;  1BTE A;  1NOR A;  1CXO A;  1HAA A;  1IJC A;  1HOY A;  2X8B B;  1IKC A;  2H62 C;  1REW C;  3QB4 B;  1NTN A;  2MUP A;  3NEQ A;  4ZQY A;  1NYS A;  1CB9 A;  1XT3 A;  2H64 B;  4IYE A;  2FD6 U;  1CDQ A;  4QTI U;  4OM5 A;  1QM7 A;  3HH7 A;  2CRS A;  1KBT A;  2PJY B;  3EBX A;  1KTZ B;  1B41 B;  1MAH F;  4RUD A;  1NEA A;  2H5F A;  1TGX A;  3U74 U;  2ABX A;  2MHY A;  1CRE A;  1V6P A;  2L5S A;  3LAQ U;  1CVO A;  1MR6 A;  2HLR A;  2H8U A;  3U73 U;  3KFD E;  1FSC A;  1NXB A;  1JBD A;  1IDI A;  2GOO B;  2K3G A;  3BT1 U;  1CDS A;  1COD A;  3KFD I;  2H64 C;  4BIK B;  2HLQ A;  2VLW A;  4LFT A;  3EVS C;  2PJY C;  4P7U A;  2NBT A;  2MJ4 A;  2UX2 A;  2N99 A; 
#chains in the Genus database with same CATH topology
 1ERA A;  1UG4 A;  2UWR A;  5DO6 A;  1ZAD A;  1LXG A;  5DU1 A;  1QKD A;  2QJ9 C;  2L03 A;  4XJJ A;  4OM4 A;  2CRT A;  1YWH A;  1QKE A;  1ERG A;  1W6B A;  2LA1 A;  2MJY A;  1CHV S;  3BT2 U;  1HAJ A;  1HC9 A;  2GOO C;  2BTX A;  4UY2 C;  2H7Z B;  4EY8 B;  1KBA A;  2JVE A;  1LSI A;  1FSS B;  1DRS A;  1H0J A;  2MUO A;  1L4W A;  1VB0 A;  4DO8 A;  1ES7 B;  5IMT D;  1G6M A;  4KSN A;  1FFJ A;  1I02 A;  1KC4 A;  2QJB C;  2QJA C;  1TXA A;  2MFA A;  3VTS A;  5EBX A;  2QC1 A;  1JGK A;  1CRF A;  2CDX A;  1KFH A;  1LJZ A;  1LXH A;  1PLO A;  2MJ0 A;  5DZ5 A;  1FF4 A;  2H62 D;  4FAO E;  4HQP F;  1JE9 A;  1RGJ A;  1ONJ A;  2LCR A;  1CDR A;  1FRA A;  1IK8 A;  1CDT A;  1TFS A;  1HC9 B;  4FAO C;  1IDL A;  1KXI A;  1KS6 A;  5IMY C;  1RL5 A;  2JQP A;  1BXP A;  1COE A;  1TXB A;  4BDT B;  1KU6 B;  1KBS A;  2J8B A;  1NYU A;  2BHI A;  3PLC A;  2CCX A;  1S4Y A;  6EBX A;  2OFS A;  3FEV A;  3NH7 A;  1M9Z A;  2ERA A;  1KL8 A;  2H7Z A;  2I9B E;  4AEA A;  3NDS A;  1CTX A;  1NTX A;  1ABT A;  1IDH A;  1IDG A;  1IQ9 A;  1CCQ A;  1F94 A;  1F8U B;  3ERA A;  1CXN A;  2CTX A;  1LX5 B;  1FAS A;  1BTE A;  1NOR A;  1CXO A;  1HAA A;  1IJC A;  1HOY A;  2X8B B;  1IKC A;  2H62 C;  1REW C;  3QB4 B;  1NTN A;  2MUP A;  3NEQ A;  4ZQY A;  1NYS A;  1CB9 A;  1XT3 A;  2H64 B;  4IYE A;  2FD6 U;  1CDQ A;  4QTI U;  4OM5 A;  1QM7 A;  3HH7 A;  2CRS A;  1KBT A;  2PJY B;  3EBX A;  1KTZ B;  1B41 B;  1MAH F;  4RUD A;  1NEA A;  2H5F A;  1TGX A;  3U74 U;  2ABX A;  2MHY A;  1CRE A;  1V6P A;  2L5S A;  3LAQ U;  1CVO A;  1MR6 A;  2HLR A;  2H8U A;  3U73 U;  3KFD E;  1FSC A;  1NXB A;  1JBD A;  1IDI A;  2GOO B;  2K3G A;  3BT1 U;  1CDS A;  1COD A;  3KFD I;  2H64 C;  4BIK B;  2HLQ A;  2VLW A;  4LFT A;  3EVS C;  2PJY C;  4P7U A;  2NBT A;  2MJ4 A;  2UX2 A;  2N99 A; 
#chains in the Genus database with same CATH homology
 1ERA A;  1UG4 A;  2UWR A;  5DO6 A;  1ZAD A;  1LXG A;  5DU1 A;  1QKD A;  2QJ9 C;  2L03 A;  4XJJ A;  4OM4 A;  2CRT A;  1YWH A;  1QKE A;  1ERG A;  1W6B A;  2LA1 A;  2MJY A;  1CHV S;  3BT2 U;  1HAJ A;  1HC9 A;  2GOO C;  2BTX A;  4UY2 C;  2H7Z B;  4EY8 B;  1KBA A;  2JVE A;  1LSI A;  1FSS B;  1DRS A;  1H0J A;  2MUO A;  1L4W A;  1VB0 A;  4DO8 A;  1ES7 B;  5IMT D;  1G6M A;  4KSN A;  1FFJ A;  1I02 A;  1KC4 A;  2QJB C;  2QJA C;  1TXA A;  2MFA A;  3VTS A;  5EBX A;  2QC1 A;  1JGK A;  1CRF A;  2CDX A;  1KFH A;  1LJZ A;  1LXH A;  1PLO A;  2MJ0 A;  5DZ5 A;  1FF4 A;  2H62 D;  4FAO E;  4HQP F;  1JE9 A;  1RGJ A;  1ONJ A;  2LCR A;  1CDR A;  1FRA A;  1IK8 A;  1CDT A;  1TFS A;  1HC9 B;  4FAO C;  1IDL A;  1KXI A;  1KS6 A;  5IMY C;  1RL5 A;  2JQP A;  1BXP A;  1COE A;  1TXB A;  4BDT B;  1KU6 B;  1KBS A;  2J8B A;  1NYU A;  2BHI A;  3PLC A;  2CCX A;  1S4Y A;  6EBX A;  2OFS A;  3FEV A;  3NH7 A;  1M9Z A;  2ERA A;  1KL8 A;  2H7Z A;  2I9B E;  4AEA A;  3NDS A;  1CTX A;  1NTX A;  1ABT A;  1IDH A;  1IDG A;  1IQ9 A;  1CCQ A;  1F94 A;  1F8U B;  3ERA A;  1CXN A;  2CTX A;  1LX5 B;  1FAS A;  1BTE A;  1NOR A;  1CXO A;  1HAA A;  1IJC A;  1HOY A;  2X8B B;  1IKC A;  2H62 C;  1REW C;  3QB4 B;  1NTN A;  2MUP A;  3NEQ A;  4ZQY A;  1NYS A;  1CB9 A;  1XT3 A;  2H64 B;  4IYE A;  2FD6 U;  1CDQ A;  4QTI U;  4OM5 A;  1QM7 A;  3HH7 A;  2CRS A;  1KBT A;  2PJY B;  3EBX A;  1KTZ B;  1B41 B;  1MAH F;  4RUD A;  1NEA A;  2H5F A;  1TGX A;  3U74 U;  2ABX A;  2MHY A;  1CRE A;  1V6P A;  2L5S A;  3LAQ U;  1CVO A;  1MR6 A;  2HLR A;  2H8U A;  3U73 U;  3KFD E;  1FSC A;  1NXB A;  1JBD A;  1IDI A;  2GOO B;  2K3G A;  3BT1 U;  1CDS A;  1COD A;  3KFD I;  2H64 C;  4BIK B;  2HLQ A;  2VLW A;  4LFT A;  3EVS C;  2PJY C;  4P7U A;  2NBT A;  2MJ4 A;  2UX2 A;  2N99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...