1FRAA

Tertiary structure of erabutoxin b in aqueous solution elucidated by two-dimensional nuclear magnetic resonance
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ERABUTOXIN B
publication title Tertiary structure of erabutoxin b in aqueous solution as elucidated by two-dimensional nuclear magnetic resonance.
pubmed doi rcsb
source organism Laticauda semifasciata
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1994-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1fraA00
1FSCA 1ONJA 2CCXA 2LCRA 3EBXA 1LXGA 4XJJA 2GOOB 1FSSB 1LSIA 3EVSC 4OM4A 4RUDA 1LJZA 5EBXA 2UWRA 2H7ZA 1CB9A 1CDSA 1W6BA 2QC1A 2JVEA 1COEA 4EY8B 2QJAC 1F8UB 2MJYA 3HH7A 2ABXA 1CCQA 2BTXA 4BDTB 2UX2A 1NYSA 1CHVS 2NBTA 1KFHA 2OFSA 1XT3A 1L4WA 1ERGA 1LX5B 2H62C 1KBAA 1M9ZA 4IYEA 1HAJA 2H64C 1B41B 1TXBA 1IKCA 1KBSA 2BHIA 1TXAA 3LAQU 1CDTA 1CREA 3U73U 2CRSA 4ZQYA 3BT2U 1MR6A 2H64B 1FRAA 2K3GA 2H7ZB 1MAHF 2PJYC 1TGXA 1I02A 1IDIA 1IDLA 2L5SA 1HOYA 1BTEA 1CXOA 4OM5A 1FASA 2ERAA 2MUOA 2N99A 2FD6U 2H5FA 3NDSA 2PJYB 1IQ9A 4FAOC 3KFDI 3NEQA 1NTNA 2LA1A 1S4YA 1IK8A 2JQPA 3VTSA 2MHYA 1ERAA 1H0JA 2QJBC 2H8UA 3NH7A 1QKDA 1ABTA 1HC9A 1PLOA 4BIKB 1TFSA 1KXIA 1KU6B 2MJ0A 1CTXA 1LXHA 1CVOA 1RGJA 3ERAA 2HLQA 1V6PA 1JBDA 6EBXA 1VB0A 4QTIU 1CDQA 1CODA 1DRSA 1KTZB 2X8BB 4FAOE 1FF4A 3QB4B 1NORA 2HLRA 4UY2C 1IDHA 1JGKA 2CDXA 1KC4A 5IMTD 1CDRA 1KL8A 1NXBA 2VLWA 3U74U 2GOOC 2CRTA 2QJ9C 4P7UA 2L03A 1NEAA 1HC9B 5DU1A 1KS6A 1QKEA 2CTXA 1ZADA 1FFJA 3KFDE 4AEAA 1ES7B 1F94A 3PLCA 3BT1U 1UG4A 1IJCA 1REWC 2I9BE 1IDGA 1KBTA 4DO8A 1HAAA 1QM7A 5IMYC 1G6MA 4LFTA 1JE9A 1YWHA 1NTXA 5DO6A 5DZ5A 2MFAA 2MJ4A 2J8BA 2H62D 1CRFA 4HQPF 3FEVA 1BXPA 1NYUA 2MUPA 1RL5A 1CXNA
chains in the Genus database with same CATH superfamily
1FSCA 1ONJA 2CCXA 2LCRA 3EBXA 1LXGA 4XJJA 2GOOB 1FSSB 1LSIA 3EVSC 4OM4A 4RUDA 1LJZA 5EBXA 2UWRA 2H7ZA 1CB9A 1CDSA 1W6BA 2QC1A 2JVEA 1COEA 4EY8B 2QJAC 1F8UB 2MJYA 3HH7A 2ABXA 1CCQA 2BTXA 4BDTB 2UX2A 1NYSA 4KSNA 1CHVS 2NBTA 1KFHA 2OFSA 1XT3A 1L4WA 1ERGA 1LX5B 2H62C 1KBAA 1M9ZA 4IYEA 1HAJA 2H64C 1B41B 1TXBA 1IKCA 1KBSA 2BHIA 1TXAA 3LAQU 1CDTA 1CREA 3U73U 2CRSA 4ZQYA 3BT2U 1MR6A 2H64B 1FRAA 2K3GA 2H7ZB 1MAHF 2PJYC 1TGXA 1I02A 1IDIA 1IDLA 2L5SA 1HOYA 1BTEA 1CXOA 4OM5A 1FASA 2ERAA 2MUOA 2N99A 2FD6U 2H5FA 3NDSA 2PJYB 1IQ9A 4FAOC 3KFDI 3NEQA 1NTNA 2LA1A 1S4YA 1IK8A 2JQPA 3VTSA 2MHYA 1ERAA 1H0JA 2QJBC 2H8UA 3NH7A 1QKDA 1ABTA 1HC9A 1PLOA 4BIKB 1TFSA 1KXIA 1KU6B 2MJ0A 1CTXA 1LXHA 1CVOA 1RGJA 3ERAA 2HLQA 1V6PA 1JBDA 6EBXA 1VB0A 4QTIU 1CDQA 1CODA 1DRSA 1KTZB 2X8BB 4FAOE 1FF4A 3QB4B 1NORA 2HLRA 4UY2C 1IDHA 1JGKA 2CDXA 1KC4A 5IMTD 1CDRA 1KL8A 1NXBA 2VLWA 3U74U 2GOOC 2CRTA 2QJ9C 4P7UA 2L03A 1NEAA 1HC9B 5DU1A 1KS6A 1QKEA 2CTXA 1ZADA 1FFJA 3KFDE 4AEAA 1ES7B 1F94A 3PLCA 3BT1U 1UG4A 1IJCA 1REWC 2I9BE 1IDGA 1KBTA 4DO8A 1HAAA 1QM7A 5IMYC 1G6MA 4LFTA 1JE9A 1YWHA 1NTXA 5DO6A 5DZ5A 2MFAA 2MJ4A 2J8BA 2H62D 1CRFA 4HQPF 3FEVA 1BXPA 1NYUA 2MUPA 1RL5A 1CXNA
chains in the Genus database with same CATH topology
1FSCA 1ONJA 2CCXA 2LCRA 3EBXA 1LXGA 4XJJA 2GOOB 1FSSB 1LSIA 3EVSC 4OM4A 4RUDA 1LJZA 5EBXA 2UWRA 2H7ZA 1CB9A 1CDSA 1W6BA 2QC1A 2JVEA 1COEA 4EY8B 2QJAC 1F8UB 2MJYA 3HH7A 2ABXA 1CCQA 2BTXA 4BDTB 2UX2A 1NYSA 4KSNA 1CHVS 2NBTA 1KFHA 2OFSA 1XT3A 1L4WA 1ERGA 1LX5B 2H62C 1KBAA 1M9ZA 4IYEA 1HAJA 2H64C 1B41B 1TXBA 1IKCA 1KBSA 2BHIA 1TXAA 3LAQU 1CDTA 1CREA 3U73U 2CRSA 4ZQYA 3BT2U 1MR6A 2H64B 1FRAA 2K3GA 2H7ZB 1MAHF 2PJYC 1TGXA 1I02A 1IDIA 1IDLA 2L5SA 1HOYA 1BTEA 1CXOA 4OM5A 1FASA 2ERAA 2MUOA 2N99A 2FD6U 2H5FA 3NDSA 2PJYB 1IQ9A 4FAOC 3KFDI 3NEQA 1NTNA 2LA1A 1S4YA 1IK8A 2JQPA 3VTSA 2MHYA 1ERAA 1H0JA 2QJBC 2H8UA 3NH7A 1QKDA 1ABTA 1HC9A 1PLOA 4BIKB 1TFSA 1KXIA 1KU6B 2MJ0A 1CTXA 1LXHA 1CVOA 1RGJA 3ERAA 2HLQA 1V6PA 1JBDA 6EBXA 1VB0A 4QTIU 1CDQA 1CODA 1DRSA 1KTZB 2X8BB 4FAOE 1FF4A 3QB4B 1NORA 2HLRA 4UY2C 1IDHA 1JGKA 2CDXA 1KC4A 5IMTD 1CDRA 1KL8A 1NXBA 2VLWA 3U74U 2GOOC 2CRTA 2QJ9C 4P7UA 2L03A 1NEAA 1HC9B 5DU1A 1KS6A 1QKEA 2CTXA 1ZADA 1FFJA 3KFDE 4AEAA 1ES7B 1F94A 3PLCA 3BT1U 1UG4A 1IJCA 1REWC 2I9BE 1IDGA 1KBTA 4DO8A 1HAAA 1QM7A 5IMYC 1G6MA 4LFTA 1JE9A 1YWHA 1NTXA 5DO6A 5DZ5A 2MFAA 2MJ4A 2J8BA 2H62D 1CRFA 4HQPF 3FEVA 1BXPA 1NYUA 2MUPA 1RL5A 1CXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSC A;  1ONJ A;  2CCX A;  2LCR A;  3EBX A;  1LXG A;  4XJJ A;  2GOO B;  1FSS B;  1LSI A;  3EVS C;  4OM4 A;  4RUD A;  1LJZ A;  5EBX A;  2UWR A;  2H7Z A;  1CB9 A;  1CDS A;  1W6B A;  2QC1 A;  2JVE A;  1COE A;  4EY8 B;  2QJA C;  1F8U B;  2MJY A;  3HH7 A;  2ABX A;  1CCQ A;  2BTX A;  4BDT B;  2UX2 A;  1NYS A;  1CHV S;  2NBT A;  1KFH A;  2OFS A;  1XT3 A;  1L4W A;  1ERG A;  1LX5 B;  2H62 C;  1KBA A;  1M9Z A;  4IYE A;  1HAJ A;  2H64 C;  1B41 B;  1TXB A;  1IKC A;  1KBS A;  2BHI A;  1TXA A;  3LAQ U;  1CDT A;  1CRE A;  3U73 U;  2CRS A;  4ZQY A;  3BT2 U;  1MR6 A;  2H64 B;  1FRA A;  2K3G A;  2H7Z B;  1MAH F;  2PJY C;  1TGX A;  1I02 A;  1IDI A;  1IDL A;  2L5S A;  1HOY A;  1BTE A;  1CXO A;  4OM5 A;  1FAS A;  2ERA A;  2MUO A;  2N99 A;  2FD6 U;  2H5F A;  3NDS A;  2PJY B;  1IQ9 A;  4FAO C;  3KFD I;  3NEQ A;  1NTN A;  2LA1 A;  1S4Y A;  1IK8 A;  2JQP A;  3VTS A;  2MHY A;  1ERA A;  1H0J A;  2QJB C;  2H8U A;  3NH7 A;  1QKD A;  1ABT A;  1HC9 A;  1PLO A;  4BIK B;  1TFS A;  1KXI A;  1KU6 B;  2MJ0 A;  1CTX A;  1LXH A;  1CVO A;  1RGJ A;  3ERA A;  2HLQ A;  1V6P A;  1JBD A;  6EBX A;  1VB0 A;  4QTI U;  1CDQ A;  1COD A;  1DRS A;  1KTZ B;  2X8B B;  4FAO E;  1FF4 A;  3QB4 B;  1NOR A;  2HLR A;  4UY2 C;  1IDH A;  1JGK A;  2CDX A;  1KC4 A;  5IMT D;  1CDR A;  1KL8 A;  1NXB A;  2VLW A;  3U74 U;  2GOO C;  2CRT A;  2QJ9 C;  4P7U A;  2L03 A;  1NEA A;  1HC9 B;  5DU1 A;  1KS6 A;  1QKE A;  2CTX A;  1ZAD A;  1FFJ A;  3KFD E;  4AEA A;  1ES7 B;  1F94 A;  3PLC A;  3BT1 U;  1UG4 A;  1IJC A;  1REW C;  2I9B E;  1IDG A;  1KBT A;  4DO8 A;  1HAA A;  1QM7 A;  5IMY C;  1G6M A;  4LFT A;  1JE9 A;  1YWH A;  1NTX A;  5DO6 A;  5DZ5 A;  2MFA A;  2MJ4 A;  2J8B A;  2H62 D;  1CRF A;  4HQP F;  3FEV A;  1BXP A;  1NYU A;  2MUP A;  1RL5 A;  1CXN A; 
#chains in the Genus database with same CATH topology
 1FSC A;  1ONJ A;  2CCX A;  2LCR A;  3EBX A;  1LXG A;  4XJJ A;  2GOO B;  1FSS B;  1LSI A;  3EVS C;  4OM4 A;  4RUD A;  1LJZ A;  5EBX A;  2UWR A;  2H7Z A;  1CB9 A;  1CDS A;  1W6B A;  2QC1 A;  2JVE A;  1COE A;  4EY8 B;  2QJA C;  1F8U B;  2MJY A;  3HH7 A;  2ABX A;  1CCQ A;  2BTX A;  4BDT B;  2UX2 A;  1NYS A;  4KSN A;  1CHV S;  2NBT A;  1KFH A;  2OFS A;  1XT3 A;  1L4W A;  1ERG A;  1LX5 B;  2H62 C;  1KBA A;  1M9Z A;  4IYE A;  1HAJ A;  2H64 C;  1B41 B;  1TXB A;  1IKC A;  1KBS A;  2BHI A;  1TXA A;  3LAQ U;  1CDT A;  1CRE A;  3U73 U;  2CRS A;  4ZQY A;  3BT2 U;  1MR6 A;  2H64 B;  1FRA A;  2K3G A;  2H7Z B;  1MAH F;  2PJY C;  1TGX A;  1I02 A;  1IDI A;  1IDL A;  2L5S A;  1HOY A;  1BTE A;  1CXO A;  4OM5 A;  1FAS A;  2ERA A;  2MUO A;  2N99 A;  2FD6 U;  2H5F A;  3NDS A;  2PJY B;  1IQ9 A;  4FAO C;  3KFD I;  3NEQ A;  1NTN A;  2LA1 A;  1S4Y A;  1IK8 A;  2JQP A;  3VTS A;  2MHY A;  1ERA A;  1H0J A;  2QJB C;  2H8U A;  3NH7 A;  1QKD A;  1ABT A;  1HC9 A;  1PLO A;  4BIK B;  1TFS A;  1KXI A;  1KU6 B;  2MJ0 A;  1CTX A;  1LXH A;  1CVO A;  1RGJ A;  3ERA A;  2HLQ A;  1V6P A;  1JBD A;  6EBX A;  1VB0 A;  4QTI U;  1CDQ A;  1COD A;  1DRS A;  1KTZ B;  2X8B B;  4FAO E;  1FF4 A;  3QB4 B;  1NOR A;  2HLR A;  4UY2 C;  1IDH A;  1JGK A;  2CDX A;  1KC4 A;  5IMT D;  1CDR A;  1KL8 A;  1NXB A;  2VLW A;  3U74 U;  2GOO C;  2CRT A;  2QJ9 C;  4P7U A;  2L03 A;  1NEA A;  1HC9 B;  5DU1 A;  1KS6 A;  1QKE A;  2CTX A;  1ZAD A;  1FFJ A;  3KFD E;  4AEA A;  1ES7 B;  1F94 A;  3PLC A;  3BT1 U;  1UG4 A;  1IJC A;  1REW C;  2I9B E;  1IDG A;  1KBT A;  4DO8 A;  1HAA A;  1QM7 A;  5IMY C;  1G6M A;  4LFT A;  1JE9 A;  1YWH A;  1NTX A;  5DO6 A;  5DZ5 A;  2MFA A;  2MJ4 A;  2J8B A;  2H62 D;  1CRF A;  4HQP F;  3FEV A;  1BXP A;  1NYU A;  2MUP A;  1RL5 A;  1CXN A; 
#chains in the Genus database with same CATH homology
 1FSC A;  1ONJ A;  2CCX A;  2LCR A;  3EBX A;  1LXG A;  4XJJ A;  2GOO B;  1FSS B;  1LSI A;  3EVS C;  4OM4 A;  4RUD A;  1LJZ A;  5EBX A;  2UWR A;  2H7Z A;  1CB9 A;  1CDS A;  1W6B A;  2QC1 A;  2JVE A;  1COE A;  4EY8 B;  2QJA C;  1F8U B;  2MJY A;  3HH7 A;  2ABX A;  1CCQ A;  2BTX A;  4BDT B;  2UX2 A;  1NYS A;  4KSN A;  1CHV S;  2NBT A;  1KFH A;  2OFS A;  1XT3 A;  1L4W A;  1ERG A;  1LX5 B;  2H62 C;  1KBA A;  1M9Z A;  4IYE A;  1HAJ A;  2H64 C;  1B41 B;  1TXB A;  1IKC A;  1KBS A;  2BHI A;  1TXA A;  3LAQ U;  1CDT A;  1CRE A;  3U73 U;  2CRS A;  4ZQY A;  3BT2 U;  1MR6 A;  2H64 B;  1FRA A;  2K3G A;  2H7Z B;  1MAH F;  2PJY C;  1TGX A;  1I02 A;  1IDI A;  1IDL A;  2L5S A;  1HOY A;  1BTE A;  1CXO A;  4OM5 A;  1FAS A;  2ERA A;  2MUO A;  2N99 A;  2FD6 U;  2H5F A;  3NDS A;  2PJY B;  1IQ9 A;  4FAO C;  3KFD I;  3NEQ A;  1NTN A;  2LA1 A;  1S4Y A;  1IK8 A;  2JQP A;  3VTS A;  2MHY A;  1ERA A;  1H0J A;  2QJB C;  2H8U A;  3NH7 A;  1QKD A;  1ABT A;  1HC9 A;  1PLO A;  4BIK B;  1TFS A;  1KXI A;  1KU6 B;  2MJ0 A;  1CTX A;  1LXH A;  1CVO A;  1RGJ A;  3ERA A;  2HLQ A;  1V6P A;  1JBD A;  6EBX A;  1VB0 A;  4QTI U;  1CDQ A;  1COD A;  1DRS A;  1KTZ B;  2X8B B;  4FAO E;  1FF4 A;  3QB4 B;  1NOR A;  2HLR A;  4UY2 C;  1IDH A;  1JGK A;  2CDX A;  1KC4 A;  5IMT D;  1CDR A;  1KL8 A;  1NXB A;  2VLW A;  3U74 U;  2GOO C;  2CRT A;  2QJ9 C;  4P7U A;  2L03 A;  1NEA A;  1HC9 B;  5DU1 A;  1KS6 A;  1QKE A;  2CTX A;  1ZAD A;  1FFJ A;  3KFD E;  4AEA A;  1ES7 B;  1F94 A;  3PLC A;  3BT1 U;  1UG4 A;  1IJC A;  1REW C;  2I9B E;  1IDG A;  1KBT A;  4DO8 A;  1HAA A;  1QM7 A;  5IMY C;  1G6M A;  4LFT A;  1JE9 A;  1YWH A;  1NTX A;  5DO6 A;  5DZ5 A;  2MFA A;  2MJ4 A;  2J8B A;  2H62 D;  1CRF A;  4HQP F;  3FEV A;  1BXP A;  1NYU A;  2MUP A;  1RL5 A;  1CXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...