1FRAA

Tertiary structure of erabutoxin b in aqueous solution elucidated by two-dimensional nuclear magnetic resonance
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERABUTOXIN B
publication title Tertiary structure of erabutoxin b in aqueous solution as elucidated by two-dimensional nuclear magnetic resonance.
pubmed doi rcsb
source organism Laticauda semifasciata
molecule tags Toxin
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1994-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1fraA00
1TXBA 1TXAA 4P7UA 1CRFA 4DO8A 1IKCA 1KS6A 2N99A 1CTXA 1ZADA 3NH7A 1KFHA 2L5SA 1I02A 2MUPA 1XT3A 2HLRA 4OM5A 1CXOA 2OFSA 1CXNA 4ZQYA 1LXGA 2QJBC 2J8BA 2H7ZB 1JBDA 1G6MA 2BTXA 1FSCA 1CHVS 3BT2U 2CCXA 2MJ4A 4IYEA 4AEAA 1L4WA 1KTZB 2QJAC 3FEVA 2MHYA 1NXBA 4OM4A 1TGXA 1ERAA 1KC4A 2FD6U 5DZ5A 3NDSA 3BT1U 1NTNA 1PLOA 2H64C 2VLWA 1IDHA 3ERAA 2LA1A 2ABXA 2CRSA 2JQPA 1CB9A 1RL5A 1ONJA 2PJYB 1LJZA 2H62C 2MJ0A 1VB0A 1HOYA 4LFTA 1FASA 1IJCA 2JVEA 1HC9A 1NYUA 3EVSC 1RGJA 1KL8A 2X8BB 1NTXA 3KFDI 1CREA 2H7ZA 1CCQA 1TFSA 1H0JA 1FFJA 1NYSA 1KBTA 5EBXA 1ES7B 1KXIA 1BTEA 1FRAA 1YWHA 1FSSB 1COEA 2PJYC 2GOOB 1IDGA 2LCRA 2CTXA 1BXPA 1KBSA 1JE9A 2H8UA 1HAJA 2CDXA 2NBTA 3QB4B 3EBXA 1JGKA 2L03A 1DRSA 4XJJA 1MR6A 1IDIA 2H62D 4UY2C 1ERGA 1M9ZA 3KFDE 5IMYC 5IMTD 1FF4A 1NORA 1QKDA 1LSIA 3HH7A 1MAHF 4HQPF 1CDSA 2I9BE 1S4YA 2MUOA 1QM7A 1LXHA 1KBAA 1NEAA 1W6BA 1B41B 1CDTA 1QKEA 2MFAA 3LAQU 3NEQA 4BDTB 2ERAA 4QTIU 2CRTA 2QC1A 1IQ9A 4FAOC 2H64B 3U74U 1CDQA 1V6PA 4RUDA 1UG4A 1CVOA 1F8UB 4EY8B 1HC9B 1CDRA 1HAAA 2MJYA 3PLCA 4FAOE 6EBXA 1REWC 5DO6A 1CODA 2BHIA 2K3GA 1IK8A 1KU6B 4BIKB 2H5FA 2HLQA 5DU1A 1LX5B 3U73U 2QJ9C 1IDLA 2GOOC 2UWRA 2UX2A 1ABTA 3VTSA 1F94A
chains in the Genus database with same CATH superfamily
1TXBA 1TXAA 4P7UA 1CRFA 4DO8A 1IKCA 1KS6A 2N99A 1CTXA 1ZADA 3NH7A 1KFHA 2L5SA 1I02A 2MUPA 1XT3A 2HLRA 4OM5A 1CXOA 2OFSA 1CXNA 4ZQYA 1LXGA 2QJBC 2J8BA 2H7ZB 1JBDA 1G6MA 2BTXA 1FSCA 1CHVS 3BT2U 2CCXA 2MJ4A 4IYEA 4AEAA 1L4WA 1KTZB 2QJAC 3FEVA 2MHYA 1NXBA 4OM4A 1TGXA 1ERAA 1KC4A 2FD6U 5DZ5A 3NDSA 3BT1U 1NTNA 1PLOA 2H64C 2VLWA 1IDHA 3ERAA 2LA1A 2ABXA 2CRSA 2JQPA 1CB9A 1RL5A 1ONJA 2PJYB 1LJZA 2H62C 2MJ0A 1VB0A 1HOYA 4LFTA 1FASA 1IJCA 2JVEA 1HC9A 1NYUA 3EVSC 1RGJA 1KL8A 2X8BB 1NTXA 3KFDI 1CREA 2H7ZA 1CCQA 1TFSA 1H0JA 4KSNA 1NYSA 1FFJA 1KBTA 5EBXA 1ES7B 1KXIA 1BTEA 1FRAA 1YWHA 1FSSB 1COEA 2PJYC 2GOOB 1IDGA 2LCRA 2CTXA 1BXPA 1KBSA 1JE9A 2H8UA 1HAJA 2CDXA 2NBTA 3QB4B 3EBXA 1JGKA 2L03A 1DRSA 4XJJA 1MR6A 1IDIA 2H62D 4UY2C 1ERGA 1M9ZA 3KFDE 5IMYC 5IMTD 1FF4A 1NORA 1QKDA 1LSIA 3HH7A 1MAHF 4HQPF 1CDSA 2I9BE 1S4YA 2MUOA 1QM7A 1LXHA 1KBAA 1NEAA 1W6BA 1B41B 1CDTA 1QKEA 2MFAA 3LAQU 3NEQA 4BDTB 2ERAA 4QTIU 2CRTA 2QC1A 1IQ9A 4FAOC 2H64B 3U74U 1CDQA 1V6PA 4RUDA 1UG4A 1CVOA 1F8UB 4EY8B 1HC9B 1CDRA 1HAAA 2MJYA 3PLCA 4FAOE 6EBXA 1REWC 5DO6A 1CODA 2BHIA 2K3GA 1IK8A 1KU6B 4BIKB 2H5FA 2HLQA 5DU1A 1LX5B 3U73U 2QJ9C 1IDLA 2GOOC 2UWRA 2UX2A 1ABTA 3VTSA 1F94A
chains in the Genus database with same CATH topology
1TXBA 1TXAA 4P7UA 1CRFA 4DO8A 1IKCA 1KS6A 2N99A 1CTXA 1ZADA 3NH7A 1KFHA 2L5SA 1I02A 2MUPA 1XT3A 2HLRA 4OM5A 1CXOA 2OFSA 1CXNA 4ZQYA 1LXGA 2QJBC 2J8BA 2H7ZB 1JBDA 1G6MA 2BTXA 1FSCA 1CHVS 3BT2U 2CCXA 2MJ4A 4IYEA 4AEAA 1L4WA 1KTZB 2QJAC 3FEVA 2MHYA 1NXBA 4OM4A 1TGXA 1ERAA 1KC4A 2FD6U 5DZ5A 3NDSA 3BT1U 1NTNA 1PLOA 2H64C 2VLWA 1IDHA 3ERAA 2LA1A 2ABXA 2CRSA 2JQPA 1CB9A 1RL5A 1ONJA 2PJYB 1LJZA 2H62C 2MJ0A 1VB0A 1HOYA 4LFTA 1FASA 1IJCA 2JVEA 1HC9A 1NYUA 3EVSC 1RGJA 1KL8A 2X8BB 1NTXA 3KFDI 1CREA 2H7ZA 1CCQA 1TFSA 1H0JA 4KSNA 1NYSA 1FFJA 1KBTA 5EBXA 1ES7B 1KXIA 1BTEA 1FRAA 1YWHA 1FSSB 1COEA 2PJYC 2GOOB 1IDGA 2LCRA 2CTXA 1BXPA 1KBSA 1JE9A 2H8UA 1HAJA 2CDXA 2NBTA 3QB4B 3EBXA 1JGKA 2L03A 1DRSA 4XJJA 1MR6A 1IDIA 2H62D 4UY2C 1ERGA 1M9ZA 3KFDE 5IMYC 5IMTD 1FF4A 1NORA 1QKDA 1LSIA 3HH7A 1MAHF 4HQPF 1CDSA 2I9BE 1S4YA 2MUOA 1QM7A 1LXHA 1KBAA 1NEAA 1W6BA 1B41B 1CDTA 1QKEA 2MFAA 3LAQU 3NEQA 4BDTB 2ERAA 4QTIU 2CRTA 2QC1A 1IQ9A 4FAOC 2H64B 3U74U 1CDQA 1V6PA 4RUDA 1UG4A 1CVOA 1F8UB 4EY8B 1HC9B 1CDRA 1HAAA 2MJYA 3PLCA 4FAOE 6EBXA 1REWC 5DO6A 1CODA 2BHIA 2K3GA 1IK8A 1KU6B 4BIKB 2H5FA 2HLQA 5DU1A 1LX5B 3U73U 2QJ9C 1IDLA 2GOOC 2UWRA 2UX2A 1ABTA 3VTSA 1F94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXB A;  1TXA A;  4P7U A;  1CRF A;  4DO8 A;  1IKC A;  1KS6 A;  2N99 A;  1CTX A;  1ZAD A;  3NH7 A;  1KFH A;  2L5S A;  1I02 A;  2MUP A;  1XT3 A;  2HLR A;  4OM5 A;  1CXO A;  2OFS A;  1CXN A;  4ZQY A;  1LXG A;  2QJB C;  2J8B A;  2H7Z B;  1JBD A;  1G6M A;  2BTX A;  1FSC A;  1CHV S;  3BT2 U;  2CCX A;  2MJ4 A;  4IYE A;  4AEA A;  1L4W A;  1KTZ B;  2QJA C;  3FEV A;  2MHY A;  1NXB A;  4OM4 A;  1TGX A;  1ERA A;  1KC4 A;  2FD6 U;  5DZ5 A;  3NDS A;  3BT1 U;  1NTN A;  1PLO A;  2H64 C;  2VLW A;  1IDH A;  3ERA A;  2LA1 A;  2ABX A;  2CRS A;  2JQP A;  1CB9 A;  1RL5 A;  1ONJ A;  2PJY B;  1LJZ A;  2H62 C;  2MJ0 A;  1VB0 A;  1HOY A;  4LFT A;  1FAS A;  1IJC A;  2JVE A;  1HC9 A;  1NYU A;  3EVS C;  1RGJ A;  1KL8 A;  2X8B B;  1NTX A;  3KFD I;  1CRE A;  2H7Z A;  1CCQ A;  1TFS A;  1H0J A;  1FFJ A;  1NYS A;  1KBT A;  5EBX A;  1ES7 B;  1KXI A;  1BTE A;  1FRA A;  1YWH A;  1FSS B;  1COE A;  2PJY C;  2GOO B;  1IDG A;  2LCR A;  2CTX A;  1BXP A;  1KBS A;  1JE9 A;  2H8U A;  1HAJ A;  2CDX A;  2NBT A;  3QB4 B;  3EBX A;  1JGK A;  2L03 A;  1DRS A;  4XJJ A;  1MR6 A;  1IDI A;  2H62 D;  4UY2 C;  1ERG A;  1M9Z A;  3KFD E;  5IMY C;  5IMT D;  1FF4 A;  1NOR A;  1QKD A;  1LSI A;  3HH7 A;  1MAH F;  4HQP F;  1CDS A;  2I9B E;  1S4Y A;  2MUO A;  1QM7 A;  1LXH A;  1KBA A;  1NEA A;  1W6B A;  1B41 B;  1CDT A;  1QKE A;  2MFA A;  3LAQ U;  3NEQ A;  4BDT B;  2ERA A;  4QTI U;  2CRT A;  2QC1 A;  1IQ9 A;  4FAO C;  2H64 B;  3U74 U;  1CDQ A;  1V6P A;  4RUD A;  1UG4 A;  1CVO A;  1F8U B;  4EY8 B;  1HC9 B;  1CDR A;  1HAA A;  2MJY A;  3PLC A;  4FAO E;  6EBX A;  1REW C;  5DO6 A;  1COD A;  2BHI A;  2K3G A;  1IK8 A;  1KU6 B;  4BIK B;  2H5F A;  2HLQ A;  5DU1 A;  1LX5 B;  3U73 U;  2QJ9 C;  1IDL A;  2GOO C;  2UWR A;  2UX2 A;  1ABT A;  3VTS A;  1F94 A; 
#chains in the Genus database with same CATH topology
 1TXB A;  1TXA A;  4P7U A;  1CRF A;  4DO8 A;  1IKC A;  1KS6 A;  2N99 A;  1CTX A;  1ZAD A;  3NH7 A;  1KFH A;  2L5S A;  1I02 A;  2MUP A;  1XT3 A;  2HLR A;  4OM5 A;  1CXO A;  2OFS A;  1CXN A;  4ZQY A;  1LXG A;  2QJB C;  2J8B A;  2H7Z B;  1JBD A;  1G6M A;  2BTX A;  1FSC A;  1CHV S;  3BT2 U;  2CCX A;  2MJ4 A;  4IYE A;  4AEA A;  1L4W A;  1KTZ B;  2QJA C;  3FEV A;  2MHY A;  1NXB A;  4OM4 A;  1TGX A;  1ERA A;  1KC4 A;  2FD6 U;  5DZ5 A;  3NDS A;  3BT1 U;  1NTN A;  1PLO A;  2H64 C;  2VLW A;  1IDH A;  3ERA A;  2LA1 A;  2ABX A;  2CRS A;  2JQP A;  1CB9 A;  1RL5 A;  1ONJ A;  2PJY B;  1LJZ A;  2H62 C;  2MJ0 A;  1VB0 A;  1HOY A;  4LFT A;  1FAS A;  1IJC A;  2JVE A;  1HC9 A;  1NYU A;  3EVS C;  1RGJ A;  1KL8 A;  2X8B B;  1NTX A;  3KFD I;  1CRE A;  2H7Z A;  1CCQ A;  1TFS A;  1H0J A;  4KSN A;  1NYS A;  1FFJ A;  1KBT A;  5EBX A;  1ES7 B;  1KXI A;  1BTE A;  1FRA A;  1YWH A;  1FSS B;  1COE A;  2PJY C;  2GOO B;  1IDG A;  2LCR A;  2CTX A;  1BXP A;  1KBS A;  1JE9 A;  2H8U A;  1HAJ A;  2CDX A;  2NBT A;  3QB4 B;  3EBX A;  1JGK A;  2L03 A;  1DRS A;  4XJJ A;  1MR6 A;  1IDI A;  2H62 D;  4UY2 C;  1ERG A;  1M9Z A;  3KFD E;  5IMY C;  5IMT D;  1FF4 A;  1NOR A;  1QKD A;  1LSI A;  3HH7 A;  1MAH F;  4HQP F;  1CDS A;  2I9B E;  1S4Y A;  2MUO A;  1QM7 A;  1LXH A;  1KBA A;  1NEA A;  1W6B A;  1B41 B;  1CDT A;  1QKE A;  2MFA A;  3LAQ U;  3NEQ A;  4BDT B;  2ERA A;  4QTI U;  2CRT A;  2QC1 A;  1IQ9 A;  4FAO C;  2H64 B;  3U74 U;  1CDQ A;  1V6P A;  4RUD A;  1UG4 A;  1CVO A;  1F8U B;  4EY8 B;  1HC9 B;  1CDR A;  1HAA A;  2MJY A;  3PLC A;  4FAO E;  6EBX A;  1REW C;  5DO6 A;  1COD A;  2BHI A;  2K3G A;  1IK8 A;  1KU6 B;  4BIK B;  2H5F A;  2HLQ A;  5DU1 A;  1LX5 B;  3U73 U;  2QJ9 C;  1IDL A;  2GOO C;  2UWR A;  2UX2 A;  1ABT A;  3VTS A;  1F94 A; 
#chains in the Genus database with same CATH homology
 1TXB A;  1TXA A;  4P7U A;  1CRF A;  4DO8 A;  1IKC A;  1KS6 A;  2N99 A;  1CTX A;  1ZAD A;  3NH7 A;  1KFH A;  2L5S A;  1I02 A;  2MUP A;  1XT3 A;  2HLR A;  4OM5 A;  1CXO A;  2OFS A;  1CXN A;  4ZQY A;  1LXG A;  2QJB C;  2J8B A;  2H7Z B;  1JBD A;  1G6M A;  2BTX A;  1FSC A;  1CHV S;  3BT2 U;  2CCX A;  2MJ4 A;  4IYE A;  4AEA A;  1L4W A;  1KTZ B;  2QJA C;  3FEV A;  2MHY A;  1NXB A;  4OM4 A;  1TGX A;  1ERA A;  1KC4 A;  2FD6 U;  5DZ5 A;  3NDS A;  3BT1 U;  1NTN A;  1PLO A;  2H64 C;  2VLW A;  1IDH A;  3ERA A;  2LA1 A;  2ABX A;  2CRS A;  2JQP A;  1CB9 A;  1RL5 A;  1ONJ A;  2PJY B;  1LJZ A;  2H62 C;  2MJ0 A;  1VB0 A;  1HOY A;  4LFT A;  1FAS A;  1IJC A;  2JVE A;  1HC9 A;  1NYU A;  3EVS C;  1RGJ A;  1KL8 A;  2X8B B;  1NTX A;  3KFD I;  1CRE A;  2H7Z A;  1CCQ A;  1TFS A;  1H0J A;  4KSN A;  1NYS A;  1FFJ A;  1KBT A;  5EBX A;  1ES7 B;  1KXI A;  1BTE A;  1FRA A;  1YWH A;  1FSS B;  1COE A;  2PJY C;  2GOO B;  1IDG A;  2LCR A;  2CTX A;  1BXP A;  1KBS A;  1JE9 A;  2H8U A;  1HAJ A;  2CDX A;  2NBT A;  3QB4 B;  3EBX A;  1JGK A;  2L03 A;  1DRS A;  4XJJ A;  1MR6 A;  1IDI A;  2H62 D;  4UY2 C;  1ERG A;  1M9Z A;  3KFD E;  5IMY C;  5IMT D;  1FF4 A;  1NOR A;  1QKD A;  1LSI A;  3HH7 A;  1MAH F;  4HQP F;  1CDS A;  2I9B E;  1S4Y A;  2MUO A;  1QM7 A;  1LXH A;  1KBA A;  1NEA A;  1W6B A;  1B41 B;  1CDT A;  1QKE A;  2MFA A;  3LAQ U;  3NEQ A;  4BDT B;  2ERA A;  4QTI U;  2CRT A;  2QC1 A;  1IQ9 A;  4FAO C;  2H64 B;  3U74 U;  1CDQ A;  1V6P A;  4RUD A;  1UG4 A;  1CVO A;  1F8U B;  4EY8 B;  1HC9 B;  1CDR A;  1HAA A;  2MJY A;  3PLC A;  4FAO E;  6EBX A;  1REW C;  5DO6 A;  1COD A;  2BHI A;  2K3G A;  1IK8 A;  1KU6 B;  4BIK B;  2H5F A;  2HLQ A;  5DU1 A;  1LX5 B;  3U73 U;  2QJ9 C;  1IDL A;  2GOO C;  2UWR A;  2UX2 A;  1ABT A;  3VTS A;  1F94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...