1FRAA

Tertiary structure of erabutoxin b in aqueous solution elucidated by two-dimensional nuclear magnetic resonance
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure of erabutoxin b in aqueous solution as elucidated by two-dimensional nuclear magnetic resonance.
pubmed doi rcsb
source organism Laticauda semifasciata
molecule tags Toxin
molecule keywords ERABUTOXIN B
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1994-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1fraA00
1KBTA 1LX5B 2CDXA 1MR6A 3U73U 2ABXA 2QJ9C 1FFJA 2MJ0A 2LCRA 4UY2C 5EBXA 4FAOC 1RL5A 2CRTA 3ERAA 2JQPA 1KFHA 3VTSA 2MHYA 1CDQA 1KBSA 2GOOB 2JVEA 1FSCA 1NEAA 2QC1A 3U74U 1CRFA 2N99A 1HAJA 1JE9A 4ZQYA 1ERAA 2LA1A 1VB0A 2BTXA 2PJYC 1ES7B 1TFSA 1IDLA 1MAHF 2J8BA 3BT1U 4AEAA 1CXNA 1IJCA 1CDRA 1KXIA 5DU1A 1QKDA 1NXBA 1PLOA 4XJJA 2H8UA 1LXGA 1M9ZA 1IDHA 1HC9A 3EBXA 2H62C 1JGKA 3LAQU 1ABTA 4P7UA 2MUOA 3NEQA 2L5SA 4OM4A 1FASA 1CODA 2HLRA 4DO8A 1YWHA 1CCQA 1NTNA 2GOOC 2FD6U 1KC4A 1ZADA 2L03A 1F94A 1NORA 1COEA 1DRSA 2QJAC 5DO6A 1IDIA 4BIKB 2H7ZB 2UWRA 4LFTA 1CHVS 1TXAA 2MJ4A 2H62D 2K3GA 2MUPA 2ERAA 1QM7A 1TGXA 1HAAA 1KS6A 2H5FA 1CVOA 1LXHA 2NBTA 1TXBA 4RUDA 3PLCA 4EY8B 2VLWA 1KU6B 2MJYA 1KTZB 1H0JA 1HC9B 2UX2A 5DZ5A 1B41B 2CRSA 4QTIU 4FAOE 1IKCA 1FSSB 1CREA 1HOYA 5IMYC 5IMTD 1IDGA 2PJYB 3KFDE 1UG4A 2HLQA 6EBXA 1BTEA 3EVSC 1FRAA 1G6MA 1FF4A 1XT3A 3NDSA 2H64C 1LJZA 2MFAA 1KL8A 1CTXA 1NYUA 1F8UB 1LSIA 3HH7A 2OFSA 4BDTB 1KBAA 1NTXA 1BXPA 1L4WA 1ONJA 1IQ9A 1REWC 1CB9A 2CCXA 2CTXA 1QKEA 3BT2U 1CXOA 1JBDA 3NH7A 2QJBC 1CDSA 1NYSA 4OM5A 4HQPF 2I9BE 3FEVA 1S4YA 1I02A 1W6BA 3KFDI 1RGJA 1IK8A 4IYEA 2H64B 2H7ZA 2BHIA 2X8BB 3QB4B 1ERGA 1CDTA 1V6PA
chains in the Genus database with same CATH superfamily
1KBTA 1LX5B 2CDXA 1MR6A 3U73U 2ABXA 2QJ9C 1FFJA 2MJ0A 2LCRA 4UY2C 5EBXA 4FAOC 1RL5A 2CRTA 3ERAA 2JQPA 1KFHA 3VTSA 2MHYA 1CDQA 1KBSA 2GOOB 2JVEA 1FSCA 1NEAA 2QC1A 3U74U 1CRFA 2N99A 1HAJA 1JE9A 4ZQYA 1ERAA 2LA1A 1VB0A 2BTXA 2PJYC 1ES7B 1TFSA 1IDLA 1MAHF 2J8BA 3BT1U 4AEAA 1CXNA 1IJCA 1CDRA 1KXIA 5DU1A 1QKDA 1NXBA 1PLOA 4XJJA 2H8UA 1LXGA 1M9ZA 1IDHA 1HC9A 3EBXA 2H62C 1JGKA 3LAQU 1ABTA 4P7UA 2MUOA 3NEQA 2L5SA 4OM4A 1FASA 1CODA 2HLRA 4DO8A 1YWHA 1CCQA 1NTNA 2GOOC 2FD6U 1KC4A 1ZADA 2L03A 1F94A 1NORA 1COEA 1DRSA 2QJAC 5DO6A 1IDIA 4KSNA 4BIKB 2H7ZB 2UWRA 4LFTA 1CHVS 1TXAA 2MJ4A 2H62D 2K3GA 2MUPA 2ERAA 1QM7A 1TGXA 1HAAA 1KS6A 2H5FA 1CVOA 1LXHA 2NBTA 1TXBA 4RUDA 3PLCA 4EY8B 2VLWA 1KU6B 2MJYA 1KTZB 1H0JA 1HC9B 2UX2A 5DZ5A 1B41B 2CRSA 4QTIU 4FAOE 1IKCA 1FSSB 1CREA 1HOYA 5IMYC 5IMTD 1IDGA 2PJYB 3KFDE 1UG4A 2HLQA 6EBXA 1BTEA 3EVSC 1FRAA 1G6MA 1FF4A 1XT3A 3NDSA 2H64C 1LJZA 2MFAA 1KL8A 1CTXA 1NYUA 1F8UB 1LSIA 3HH7A 2OFSA 4BDTB 1KBAA 1NTXA 1BXPA 1L4WA 1ONJA 1IQ9A 1REWC 1CB9A 2CCXA 2CTXA 1QKEA 3BT2U 1CXOA 1JBDA 3NH7A 2QJBC 1CDSA 1NYSA 4OM5A 4HQPF 2I9BE 3FEVA 1S4YA 1I02A 1W6BA 3KFDI 1RGJA 1IK8A 4IYEA 2H64B 2H7ZA 2BHIA 2X8BB 3QB4B 1ERGA 1CDTA 1V6PA
chains in the Genus database with same CATH topology
1KBTA 1LX5B 2CDXA 1MR6A 3U73U 2ABXA 2QJ9C 1FFJA 2MJ0A 2LCRA 4UY2C 5EBXA 4FAOC 1RL5A 2CRTA 3ERAA 2JQPA 1KFHA 3VTSA 2MHYA 1CDQA 1KBSA 2GOOB 2JVEA 1FSCA 1NEAA 2QC1A 3U74U 1CRFA 2N99A 1HAJA 1JE9A 4ZQYA 1ERAA 2LA1A 1VB0A 2BTXA 2PJYC 1ES7B 1TFSA 1IDLA 1MAHF 2J8BA 3BT1U 4AEAA 1CXNA 1IJCA 1CDRA 1KXIA 5DU1A 1QKDA 1NXBA 1PLOA 4XJJA 2H8UA 1LXGA 1M9ZA 1IDHA 1HC9A 3EBXA 2H62C 1JGKA 3LAQU 1ABTA 4P7UA 2MUOA 3NEQA 2L5SA 4OM4A 1FASA 1CODA 2HLRA 4DO8A 1YWHA 1CCQA 1NTNA 2GOOC 2FD6U 1KC4A 1ZADA 2L03A 1F94A 1NORA 1COEA 1DRSA 2QJAC 5DO6A 1IDIA 4KSNA 4BIKB 2H7ZB 2UWRA 4LFTA 1CHVS 1TXAA 2MJ4A 2H62D 2K3GA 2MUPA 2ERAA 1QM7A 1TGXA 1HAAA 1KS6A 2H5FA 1CVOA 1LXHA 2NBTA 1TXBA 4RUDA 3PLCA 4EY8B 2VLWA 1KU6B 2MJYA 1KTZB 1H0JA 1HC9B 2UX2A 5DZ5A 1B41B 2CRSA 4QTIU 4FAOE 1IKCA 1FSSB 1CREA 1HOYA 5IMYC 5IMTD 1IDGA 2PJYB 3KFDE 1UG4A 2HLQA 6EBXA 1BTEA 3EVSC 1FRAA 1G6MA 1FF4A 1XT3A 3NDSA 2H64C 1LJZA 2MFAA 1KL8A 1CTXA 1NYUA 1F8UB 1LSIA 3HH7A 2OFSA 4BDTB 1KBAA 1NTXA 1BXPA 1L4WA 1ONJA 1IQ9A 1REWC 1CB9A 2CCXA 2CTXA 1QKEA 3BT2U 1CXOA 1JBDA 3NH7A 2QJBC 1CDSA 1NYSA 4OM5A 4HQPF 2I9BE 3FEVA 1S4YA 1I02A 1W6BA 3KFDI 1RGJA 1IK8A 4IYEA 2H64B 2H7ZA 2BHIA 2X8BB 3QB4B 1ERGA 1CDTA 1V6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBT A;  1LX5 B;  2CDX A;  1MR6 A;  3U73 U;  2ABX A;  2QJ9 C;  1FFJ A;  2MJ0 A;  2LCR A;  4UY2 C;  5EBX A;  4FAO C;  1RL5 A;  2CRT A;  3ERA A;  2JQP A;  1KFH A;  3VTS A;  2MHY A;  1CDQ A;  1KBS A;  2GOO B;  2JVE A;  1FSC A;  1NEA A;  2QC1 A;  3U74 U;  1CRF A;  2N99 A;  1HAJ A;  1JE9 A;  4ZQY A;  1ERA A;  2LA1 A;  1VB0 A;  2BTX A;  2PJY C;  1ES7 B;  1TFS A;  1IDL A;  1MAH F;  2J8B A;  3BT1 U;  4AEA A;  1CXN A;  1IJC A;  1CDR A;  1KXI A;  5DU1 A;  1QKD A;  1NXB A;  1PLO A;  4XJJ A;  2H8U A;  1LXG A;  1M9Z A;  1IDH A;  1HC9 A;  3EBX A;  2H62 C;  1JGK A;  3LAQ U;  1ABT A;  4P7U A;  2MUO A;  3NEQ A;  2L5S A;  4OM4 A;  1FAS A;  1COD A;  2HLR A;  4DO8 A;  1YWH A;  1CCQ A;  1NTN A;  2GOO C;  2FD6 U;  1KC4 A;  1ZAD A;  2L03 A;  1F94 A;  1NOR A;  1COE A;  1DRS A;  2QJA C;  5DO6 A;  1IDI A;  4BIK B;  2H7Z B;  2UWR A;  4LFT A;  1CHV S;  1TXA A;  2MJ4 A;  2H62 D;  2K3G A;  2MUP A;  2ERA A;  1QM7 A;  1TGX A;  1HAA A;  1KS6 A;  2H5F A;  1CVO A;  1LXH A;  2NBT A;  1TXB A;  4RUD A;  3PLC A;  4EY8 B;  2VLW A;  1KU6 B;  2MJY A;  1KTZ B;  1H0J A;  1HC9 B;  2UX2 A;  5DZ5 A;  1B41 B;  2CRS A;  4QTI U;  4FAO E;  1IKC A;  1FSS B;  1CRE A;  1HOY A;  5IMY C;  5IMT D;  1IDG A;  2PJY B;  3KFD E;  1UG4 A;  2HLQ A;  6EBX A;  1BTE A;  3EVS C;  1FRA A;  1G6M A;  1FF4 A;  1XT3 A;  3NDS A;  2H64 C;  1LJZ A;  2MFA A;  1KL8 A;  1CTX A;  1NYU A;  1F8U B;  1LSI A;  3HH7 A;  2OFS A;  4BDT B;  1KBA A;  1NTX A;  1BXP A;  1L4W A;  1ONJ A;  1IQ9 A;  1REW C;  1CB9 A;  2CCX A;  2CTX A;  1QKE A;  3BT2 U;  1CXO A;  1JBD A;  3NH7 A;  2QJB C;  1CDS A;  1NYS A;  4OM5 A;  4HQP F;  2I9B E;  3FEV A;  1S4Y A;  1I02 A;  1W6B A;  3KFD I;  1RGJ A;  1IK8 A;  4IYE A;  2H64 B;  2H7Z A;  2BHI A;  2X8B B;  3QB4 B;  1ERG A;  1CDT A;  1V6P A; 
#chains in the Genus database with same CATH topology
 1KBT A;  1LX5 B;  2CDX A;  1MR6 A;  3U73 U;  2ABX A;  2QJ9 C;  1FFJ A;  2MJ0 A;  2LCR A;  4UY2 C;  5EBX A;  4FAO C;  1RL5 A;  2CRT A;  3ERA A;  2JQP A;  1KFH A;  3VTS A;  2MHY A;  1CDQ A;  1KBS A;  2GOO B;  2JVE A;  1FSC A;  1NEA A;  2QC1 A;  3U74 U;  1CRF A;  2N99 A;  1HAJ A;  1JE9 A;  4ZQY A;  1ERA A;  2LA1 A;  1VB0 A;  2BTX A;  2PJY C;  1ES7 B;  1TFS A;  1IDL A;  1MAH F;  2J8B A;  3BT1 U;  4AEA A;  1CXN A;  1IJC A;  1CDR A;  1KXI A;  5DU1 A;  1QKD A;  1NXB A;  1PLO A;  4XJJ A;  2H8U A;  1LXG A;  1M9Z A;  1IDH A;  1HC9 A;  3EBX A;  2H62 C;  1JGK A;  3LAQ U;  1ABT A;  4P7U A;  2MUO A;  3NEQ A;  2L5S A;  4OM4 A;  1FAS A;  1COD A;  2HLR A;  4DO8 A;  1YWH A;  1CCQ A;  1NTN A;  2GOO C;  2FD6 U;  1KC4 A;  1ZAD A;  2L03 A;  1F94 A;  1NOR A;  1COE A;  1DRS A;  2QJA C;  5DO6 A;  1IDI A;  4KSN A;  4BIK B;  2H7Z B;  2UWR A;  4LFT A;  1CHV S;  1TXA A;  2MJ4 A;  2H62 D;  2K3G A;  2MUP A;  2ERA A;  1QM7 A;  1TGX A;  1HAA A;  1KS6 A;  2H5F A;  1CVO A;  1LXH A;  2NBT A;  1TXB A;  4RUD A;  3PLC A;  4EY8 B;  2VLW A;  1KU6 B;  2MJY A;  1KTZ B;  1H0J A;  1HC9 B;  2UX2 A;  5DZ5 A;  1B41 B;  2CRS A;  4QTI U;  4FAO E;  1IKC A;  1FSS B;  1CRE A;  1HOY A;  5IMY C;  5IMT D;  1IDG A;  2PJY B;  3KFD E;  1UG4 A;  2HLQ A;  6EBX A;  1BTE A;  3EVS C;  1FRA A;  1G6M A;  1FF4 A;  1XT3 A;  3NDS A;  2H64 C;  1LJZ A;  2MFA A;  1KL8 A;  1CTX A;  1NYU A;  1F8U B;  1LSI A;  3HH7 A;  2OFS A;  4BDT B;  1KBA A;  1NTX A;  1BXP A;  1L4W A;  1ONJ A;  1IQ9 A;  1REW C;  1CB9 A;  2CCX A;  2CTX A;  1QKE A;  3BT2 U;  1CXO A;  1JBD A;  3NH7 A;  2QJB C;  1CDS A;  1NYS A;  4OM5 A;  4HQP F;  2I9B E;  3FEV A;  1S4Y A;  1I02 A;  1W6B A;  3KFD I;  1RGJ A;  1IK8 A;  4IYE A;  2H64 B;  2H7Z A;  2BHI A;  2X8B B;  3QB4 B;  1ERG A;  1CDT A;  1V6P A; 
#chains in the Genus database with same CATH homology
 1KBT A;  1LX5 B;  2CDX A;  1MR6 A;  3U73 U;  2ABX A;  2QJ9 C;  1FFJ A;  2MJ0 A;  2LCR A;  4UY2 C;  5EBX A;  4FAO C;  1RL5 A;  2CRT A;  3ERA A;  2JQP A;  1KFH A;  3VTS A;  2MHY A;  1CDQ A;  1KBS A;  2GOO B;  2JVE A;  1FSC A;  1NEA A;  2QC1 A;  3U74 U;  1CRF A;  2N99 A;  1HAJ A;  1JE9 A;  4ZQY A;  1ERA A;  2LA1 A;  1VB0 A;  2BTX A;  2PJY C;  1ES7 B;  1TFS A;  1IDL A;  1MAH F;  2J8B A;  3BT1 U;  4AEA A;  1CXN A;  1IJC A;  1CDR A;  1KXI A;  5DU1 A;  1QKD A;  1NXB A;  1PLO A;  4XJJ A;  2H8U A;  1LXG A;  1M9Z A;  1IDH A;  1HC9 A;  3EBX A;  2H62 C;  1JGK A;  3LAQ U;  1ABT A;  4P7U A;  2MUO A;  3NEQ A;  2L5S A;  4OM4 A;  1FAS A;  1COD A;  2HLR A;  4DO8 A;  1YWH A;  1CCQ A;  1NTN A;  2GOO C;  2FD6 U;  1KC4 A;  1ZAD A;  2L03 A;  1F94 A;  1NOR A;  1COE A;  1DRS A;  2QJA C;  5DO6 A;  1IDI A;  4KSN A;  4BIK B;  2H7Z B;  2UWR A;  4LFT A;  1CHV S;  1TXA A;  2MJ4 A;  2H62 D;  2K3G A;  2MUP A;  2ERA A;  1QM7 A;  1TGX A;  1HAA A;  1KS6 A;  2H5F A;  1CVO A;  1LXH A;  2NBT A;  1TXB A;  4RUD A;  3PLC A;  4EY8 B;  2VLW A;  1KU6 B;  2MJY A;  1KTZ B;  1H0J A;  1HC9 B;  2UX2 A;  5DZ5 A;  1B41 B;  2CRS A;  4QTI U;  4FAO E;  1IKC A;  1FSS B;  1CRE A;  1HOY A;  5IMY C;  5IMT D;  1IDG A;  2PJY B;  3KFD E;  1UG4 A;  2HLQ A;  6EBX A;  1BTE A;  3EVS C;  1FRA A;  1G6M A;  1FF4 A;  1XT3 A;  3NDS A;  2H64 C;  1LJZ A;  2MFA A;  1KL8 A;  1CTX A;  1NYU A;  1F8U B;  1LSI A;  3HH7 A;  2OFS A;  4BDT B;  1KBA A;  1NTX A;  1BXP A;  1L4W A;  1ONJ A;  1IQ9 A;  1REW C;  1CB9 A;  2CCX A;  2CTX A;  1QKE A;  3BT2 U;  1CXO A;  1JBD A;  3NH7 A;  2QJB C;  1CDS A;  1NYS A;  4OM5 A;  4HQP F;  2I9B E;  3FEV A;  1S4Y A;  1I02 A;  1W6B A;  3KFD I;  1RGJ A;  1IK8 A;  4IYE A;  2H64 B;  2H7Z A;  2BHI A;  2X8B B;  3QB4 B;  1ERG A;  1CDT A;  1V6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...