1HOYA

Nmr structure of the complex between a-bungarotoxin and a mimotope of the nicotinic acetylcholine receptor
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LONG NEUROTOXIN 1
publication title NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor.
pubmed doi rcsb
molecule tags Toxin
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1hoyA00
3PLCA 1CHVS 3EVSC 3KFDE 1LJZA 1BTEA 2GOOB 1L4WA 1NORA 2K3GA 3ERAA 1LX5B 1NTNA 1RL5A 4OM5A 1FSSB 1DRSA 3LAQU 4ZQYA 4XJJA 1HC9B 1CODA 2LCRA 1TXBA 2H8UA 2I9BE 1KTZB 1CRFA 1YWHA 2UX2A 1IDGA 4EY8B 2H64C 1KXIA 2H62D 1QM7A 4AEAA 2JVEA 3NEQA 1ABTA 1NXBA 1KBAA 1COEA 1FRAA 1CTXA 1LXGA 2MFAA 3KFDI 2PJYB 1CREA 2H62C 1VB0A 3QB4B 3U74U 1BXPA 1TGXA 1CXNA 1CCQA 2H5FA 1CDQA 4BDTB 1NEAA 3VTSA 5IMTD 1W6BA 1QKEA 1IJCA 1IDLA 1B41B 2H7ZB 1KU6B 4BIKB 2MJ4A 3FEVA 1RGJA 1KS6A 1TXAA 1CDRA 1LSIA 1HC9A 2ABXA 1F94A 4FAOC 2OFSA 6EBXA 1ERAA 2LA1A 5DZ5A 1IDHA 1MR6A 1ZADA 2L03A 1IKCA 2MJ0A 2VLWA 1G6MA 2QC1A 4DO8A 1FFJA 1TFSA 1S4YA 2CTXA 2CRTA 1CDTA 2GOOC 2MUPA 1NYUA 4FAOE 3EBXA 1I02A 1ONJA 1F8UB 2BHIA 1KBSA 2ERAA 1M9ZA 1HAAA 2MHYA 1NTXA 3BT2U 2N99A 2QJBC 2BTXA 1IQ9A 2X8BB 2UWRA 1ERGA 2L5SA 3HH7A 1NYSA 2HLRA 1CVOA 1KBTA 1IDIA 5DO6A 1JE9A 3NH7A 2PJYC 4IYEA 1UG4A 1CDSA 1CB9A 4HQPF 5EBXA 1H0JA 2MUOA 1FASA 1CXOA 1FF4A 1ES7B 4QTIU 2CRSA 2FD6U 3NDSA 2CDXA 1HAJA 3U73U 4RUDA 5DU1A 2QJAC 5IMYC 1HOYA 1KL8A 1MAHF 4OM4A 1XT3A 1JBDA 2HLQA 2JQPA 2H64B 3BT1U 1REWC 1KC4A 1V6PA 1LXHA 1PLOA 1QKDA 1KFHA 1IK8A 2CCXA 2QJ9C 1FSCA 2NBTA 2MJYA 2H7ZA 1JGKA 2J8BA 4P7UA 4LFTA 4UY2C
chains in the Genus database with same CATH superfamily
3PLCA 1CHVS 3EVSC 3KFDE 1LJZA 1BTEA 2GOOB 1L4WA 1NORA 2K3GA 3ERAA 1LX5B 1NTNA 1RL5A 4OM5A 1FSSB 1DRSA 3LAQU 4ZQYA 4XJJA 1HC9B 1CODA 2LCRA 1TXBA 2H8UA 2I9BE 1KTZB 1CRFA 1YWHA 2UX2A 1IDGA 4EY8B 2H64C 1KXIA 2H62D 1QM7A 4AEAA 2JVEA 3NEQA 1ABTA 1NXBA 1KBAA 1COEA 1FRAA 1CTXA 1LXGA 2MFAA 3KFDI 2PJYB 1CREA 2H62C 1VB0A 3QB4B 3U74U 1BXPA 1TGXA 1CXNA 1CCQA 2H5FA 1CDQA 4BDTB 1NEAA 3VTSA 5IMTD 1W6BA 1QKEA 1IJCA 1IDLA 1B41B 2H7ZB 1KU6B 4BIKB 2MJ4A 3FEVA 1RGJA 1KS6A 1TXAA 1CDRA 1LSIA 1HC9A 2ABXA 1F94A 4FAOC 2OFSA 6EBXA 1ERAA 2LA1A 5DZ5A 1IDHA 1MR6A 1ZADA 2L03A 1IKCA 2MJ0A 2VLWA 1G6MA 2QC1A 4DO8A 1FFJA 1TFSA 1S4YA 2CTXA 2CRTA 1CDTA 2GOOC 2MUPA 1NYUA 4FAOE 3EBXA 1I02A 1ONJA 1F8UB 2BHIA 1KBSA 2ERAA 1M9ZA 1HAAA 2MHYA 1NTXA 3BT2U 2N99A 2QJBC 2BTXA 1IQ9A 2X8BB 2UWRA 1ERGA 2L5SA 3HH7A 1NYSA 2HLRA 1CVOA 1KBTA 1IDIA 5DO6A 1JE9A 3NH7A 2PJYC 4IYEA 1UG4A 1CDSA 1CB9A 4HQPF 5EBXA 1H0JA 2MUOA 1FASA 1CXOA 1FF4A 1ES7B 4QTIU 2CRSA 2FD6U 3NDSA 2CDXA 1HAJA 3U73U 4RUDA 5DU1A 2QJAC 5IMYC 1HOYA 1KL8A 1MAHF 4OM4A 1XT3A 1JBDA 2HLQA 2JQPA 2H64B 3BT1U 1REWC 1KC4A 1V6PA 1LXHA 1PLOA 1QKDA 4KSNA 1IK8A 1KFHA 2CCXA 2QJ9C 1FSCA 2NBTA 2MJYA 2H7ZA 1JGKA 2J8BA 4P7UA 4LFTA 4UY2C
chains in the Genus database with same CATH topology
3PLCA 1CHVS 3EVSC 3KFDE 1LJZA 1BTEA 2GOOB 1L4WA 1NORA 2K3GA 3ERAA 1LX5B 1NTNA 1RL5A 4OM5A 1FSSB 1DRSA 3LAQU 4ZQYA 4XJJA 1HC9B 1CODA 2LCRA 1TXBA 2H8UA 2I9BE 1KTZB 1CRFA 1YWHA 2UX2A 1IDGA 4EY8B 2H64C 1KXIA 2H62D 1QM7A 4AEAA 2JVEA 3NEQA 1ABTA 1NXBA 1KBAA 1COEA 1FRAA 1CTXA 1LXGA 2MFAA 3KFDI 2PJYB 1CREA 2H62C 1VB0A 3QB4B 3U74U 1BXPA 1TGXA 1CXNA 1CCQA 2H5FA 1CDQA 4BDTB 1NEAA 3VTSA 5IMTD 1W6BA 1QKEA 1IJCA 1IDLA 1B41B 2H7ZB 1KU6B 4BIKB 2MJ4A 3FEVA 1RGJA 1KS6A 1TXAA 1CDRA 1LSIA 1HC9A 2ABXA 1F94A 4FAOC 2OFSA 6EBXA 1ERAA 2LA1A 5DZ5A 1IDHA 1MR6A 1ZADA 2L03A 1IKCA 2MJ0A 2VLWA 1G6MA 2QC1A 4DO8A 1FFJA 1TFSA 1S4YA 2CTXA 2CRTA 1CDTA 2GOOC 2MUPA 1NYUA 4FAOE 3EBXA 1I02A 1ONJA 1F8UB 2BHIA 1KBSA 2ERAA 1M9ZA 1HAAA 2MHYA 1NTXA 3BT2U 2N99A 2QJBC 2BTXA 1IQ9A 2X8BB 2UWRA 1ERGA 2L5SA 3HH7A 1NYSA 2HLRA 1CVOA 1KBTA 1IDIA 5DO6A 1JE9A 3NH7A 2PJYC 4IYEA 1UG4A 1CDSA 1CB9A 4HQPF 5EBXA 1H0JA 2MUOA 1FASA 1CXOA 1FF4A 1ES7B 4QTIU 2CRSA 2FD6U 3NDSA 2CDXA 1HAJA 3U73U 4RUDA 5DU1A 2QJAC 5IMYC 1HOYA 1KL8A 1MAHF 4OM4A 1XT3A 1JBDA 2HLQA 2JQPA 2H64B 3BT1U 1REWC 1KC4A 1V6PA 1LXHA 1PLOA 1QKDA 4KSNA 1IK8A 1KFHA 2CCXA 2QJ9C 1FSCA 2NBTA 2MJYA 2H7ZA 1JGKA 2J8BA 4P7UA 4LFTA 4UY2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLC A;  1CHV S;  3EVS C;  3KFD E;  1LJZ A;  1BTE A;  2GOO B;  1L4W A;  1NOR A;  2K3G A;  3ERA A;  1LX5 B;  1NTN A;  1RL5 A;  4OM5 A;  1FSS B;  1DRS A;  3LAQ U;  4ZQY A;  4XJJ A;  1HC9 B;  1COD A;  2LCR A;  1TXB A;  2H8U A;  2I9B E;  1KTZ B;  1CRF A;  1YWH A;  2UX2 A;  1IDG A;  4EY8 B;  2H64 C;  1KXI A;  2H62 D;  1QM7 A;  4AEA A;  2JVE A;  3NEQ A;  1ABT A;  1NXB A;  1KBA A;  1COE A;  1FRA A;  1CTX A;  1LXG A;  2MFA A;  3KFD I;  2PJY B;  1CRE A;  2H62 C;  1VB0 A;  3QB4 B;  3U74 U;  1BXP A;  1TGX A;  1CXN A;  1CCQ A;  2H5F A;  1CDQ A;  4BDT B;  1NEA A;  3VTS A;  5IMT D;  1W6B A;  1QKE A;  1IJC A;  1IDL A;  1B41 B;  2H7Z B;  1KU6 B;  4BIK B;  2MJ4 A;  3FEV A;  1RGJ A;  1KS6 A;  1TXA A;  1CDR A;  1LSI A;  1HC9 A;  2ABX A;  1F94 A;  4FAO C;  2OFS A;  6EBX A;  1ERA A;  2LA1 A;  5DZ5 A;  1IDH A;  1MR6 A;  1ZAD A;  2L03 A;  1IKC A;  2MJ0 A;  2VLW A;  1G6M A;  2QC1 A;  4DO8 A;  1FFJ A;  1TFS A;  1S4Y A;  2CTX A;  2CRT A;  1CDT A;  2GOO C;  2MUP A;  1NYU A;  4FAO E;  3EBX A;  1I02 A;  1ONJ A;  1F8U B;  2BHI A;  1KBS A;  2ERA A;  1M9Z A;  1HAA A;  2MHY A;  1NTX A;  3BT2 U;  2N99 A;  2QJB C;  2BTX A;  1IQ9 A;  2X8B B;  2UWR A;  1ERG A;  2L5S A;  3HH7 A;  1NYS A;  2HLR A;  1CVO A;  1KBT A;  1IDI A;  5DO6 A;  1JE9 A;  3NH7 A;  2PJY C;  4IYE A;  1UG4 A;  1CDS A;  1CB9 A;  4HQP F;  5EBX A;  1H0J A;  2MUO A;  1FAS A;  1CXO A;  1FF4 A;  1ES7 B;  4QTI U;  2CRS A;  2FD6 U;  3NDS A;  2CDX A;  1HAJ A;  3U73 U;  4RUD A;  5DU1 A;  2QJA C;  5IMY C;  1HOY A;  1KL8 A;  1MAH F;  4OM4 A;  1XT3 A;  1JBD A;  2HLQ A;  2JQP A;  2H64 B;  3BT1 U;  1REW C;  1KC4 A;  1V6P A;  1LXH A;  1PLO A;  1QKD A;  1KFH A;  1IK8 A;  2CCX A;  2QJ9 C;  1FSC A;  2NBT A;  2MJY A;  2H7Z A;  1JGK A;  2J8B A;  4P7U A;  4LFT A;  4UY2 C; 
#chains in the Genus database with same CATH topology
 3PLC A;  1CHV S;  3EVS C;  3KFD E;  1LJZ A;  1BTE A;  2GOO B;  1L4W A;  1NOR A;  2K3G A;  3ERA A;  1LX5 B;  1NTN A;  1RL5 A;  4OM5 A;  1FSS B;  1DRS A;  3LAQ U;  4ZQY A;  4XJJ A;  1HC9 B;  1COD A;  2LCR A;  1TXB A;  2H8U A;  2I9B E;  1KTZ B;  1CRF A;  1YWH A;  2UX2 A;  1IDG A;  4EY8 B;  2H64 C;  1KXI A;  2H62 D;  1QM7 A;  4AEA A;  2JVE A;  3NEQ A;  1ABT A;  1NXB A;  1KBA A;  1COE A;  1FRA A;  1CTX A;  1LXG A;  2MFA A;  3KFD I;  2PJY B;  1CRE A;  2H62 C;  1VB0 A;  3QB4 B;  3U74 U;  1BXP A;  1TGX A;  1CXN A;  1CCQ A;  2H5F A;  1CDQ A;  4BDT B;  1NEA A;  3VTS A;  5IMT D;  1W6B A;  1QKE A;  1IJC A;  1IDL A;  1B41 B;  2H7Z B;  1KU6 B;  4BIK B;  2MJ4 A;  3FEV A;  1RGJ A;  1KS6 A;  1TXA A;  1CDR A;  1LSI A;  1HC9 A;  2ABX A;  1F94 A;  4FAO C;  2OFS A;  6EBX A;  1ERA A;  2LA1 A;  5DZ5 A;  1IDH A;  1MR6 A;  1ZAD A;  2L03 A;  1IKC A;  2MJ0 A;  2VLW A;  1G6M A;  2QC1 A;  4DO8 A;  1FFJ A;  1TFS A;  1S4Y A;  2CTX A;  2CRT A;  1CDT A;  2GOO C;  2MUP A;  1NYU A;  4FAO E;  3EBX A;  1I02 A;  1ONJ A;  1F8U B;  2BHI A;  1KBS A;  2ERA A;  1M9Z A;  1HAA A;  2MHY A;  1NTX A;  3BT2 U;  2N99 A;  2QJB C;  2BTX A;  1IQ9 A;  2X8B B;  2UWR A;  1ERG A;  2L5S A;  3HH7 A;  1NYS A;  2HLR A;  1CVO A;  1KBT A;  1IDI A;  5DO6 A;  1JE9 A;  3NH7 A;  2PJY C;  4IYE A;  1UG4 A;  1CDS A;  1CB9 A;  4HQP F;  5EBX A;  1H0J A;  2MUO A;  1FAS A;  1CXO A;  1FF4 A;  1ES7 B;  4QTI U;  2CRS A;  2FD6 U;  3NDS A;  2CDX A;  1HAJ A;  3U73 U;  4RUD A;  5DU1 A;  2QJA C;  5IMY C;  1HOY A;  1KL8 A;  1MAH F;  4OM4 A;  1XT3 A;  1JBD A;  2HLQ A;  2JQP A;  2H64 B;  3BT1 U;  1REW C;  1KC4 A;  1V6P A;  1LXH A;  1PLO A;  1QKD A;  4KSN A;  1IK8 A;  1KFH A;  2CCX A;  2QJ9 C;  1FSC A;  2NBT A;  2MJY A;  2H7Z A;  1JGK A;  2J8B A;  4P7U A;  4LFT A;  4UY2 C; 
#chains in the Genus database with same CATH homology
 3PLC A;  1CHV S;  3EVS C;  3KFD E;  1LJZ A;  1BTE A;  2GOO B;  1L4W A;  1NOR A;  2K3G A;  3ERA A;  1LX5 B;  1NTN A;  1RL5 A;  4OM5 A;  1FSS B;  1DRS A;  3LAQ U;  4ZQY A;  4XJJ A;  1HC9 B;  1COD A;  2LCR A;  1TXB A;  2H8U A;  2I9B E;  1KTZ B;  1CRF A;  1YWH A;  2UX2 A;  1IDG A;  4EY8 B;  2H64 C;  1KXI A;  2H62 D;  1QM7 A;  4AEA A;  2JVE A;  3NEQ A;  1ABT A;  1NXB A;  1KBA A;  1COE A;  1FRA A;  1CTX A;  1LXG A;  2MFA A;  3KFD I;  2PJY B;  1CRE A;  2H62 C;  1VB0 A;  3QB4 B;  3U74 U;  1BXP A;  1TGX A;  1CXN A;  1CCQ A;  2H5F A;  1CDQ A;  4BDT B;  1NEA A;  3VTS A;  5IMT D;  1W6B A;  1QKE A;  1IJC A;  1IDL A;  1B41 B;  2H7Z B;  1KU6 B;  4BIK B;  2MJ4 A;  3FEV A;  1RGJ A;  1KS6 A;  1TXA A;  1CDR A;  1LSI A;  1HC9 A;  2ABX A;  1F94 A;  4FAO C;  2OFS A;  6EBX A;  1ERA A;  2LA1 A;  5DZ5 A;  1IDH A;  1MR6 A;  1ZAD A;  2L03 A;  1IKC A;  2MJ0 A;  2VLW A;  1G6M A;  2QC1 A;  4DO8 A;  1FFJ A;  1TFS A;  1S4Y A;  2CTX A;  2CRT A;  1CDT A;  2GOO C;  2MUP A;  1NYU A;  4FAO E;  3EBX A;  1I02 A;  1ONJ A;  1F8U B;  2BHI A;  1KBS A;  2ERA A;  1M9Z A;  1HAA A;  2MHY A;  1NTX A;  3BT2 U;  2N99 A;  2QJB C;  2BTX A;  1IQ9 A;  2X8B B;  2UWR A;  1ERG A;  2L5S A;  3HH7 A;  1NYS A;  2HLR A;  1CVO A;  1KBT A;  1IDI A;  5DO6 A;  1JE9 A;  3NH7 A;  2PJY C;  4IYE A;  1UG4 A;  1CDS A;  1CB9 A;  4HQP F;  5EBX A;  1H0J A;  2MUO A;  1FAS A;  1CXO A;  1FF4 A;  1ES7 B;  4QTI U;  2CRS A;  2FD6 U;  3NDS A;  2CDX A;  1HAJ A;  3U73 U;  4RUD A;  5DU1 A;  2QJA C;  5IMY C;  1HOY A;  1KL8 A;  1MAH F;  4OM4 A;  1XT3 A;  1JBD A;  2HLQ A;  2JQP A;  2H64 B;  3BT1 U;  1REW C;  1KC4 A;  1V6P A;  1LXH A;  1PLO A;  1QKD A;  4KSN A;  1IK8 A;  1KFH A;  2CCX A;  2QJ9 C;  1FSC A;  2NBT A;  2MJY A;  2H7Z A;  1JGK A;  2J8B A;  4P7U A;  4LFT A;  4UY2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...