1HOYA

Nmr structure of the complex between a-bungarotoxin and a mimotope of the nicotinic acetylcholine receptor
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords LONG NEUROTOXIN 1
publication title NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor.
pubmed doi rcsb
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1hoyA00
1REWC 2BHIA 1FASA 2MUPA 3FEVA 2X8BB 2H62D 1NYUA 4OM4A 2CTXA 1CDRA 2MJ4A 2K3GA 4BIKB 1QKDA 1F8UB 2H5FA 4FAOC 4P7UA 2J8BA 3VTSA 1QKEA 4OM5A 2QC1A 3HH7A 5DU1A 1TXBA 3EVSC 3PLCA 2I9BE 3U73U 1JE9A 1PLOA 4AEAA 1CVOA 1CXOA 4BDTB 2PJYB 1KBAA 5IMYC 2OFSA 1ERGA 1IK8A 2H64B 1LSIA 2LCRA 1JGKA 1IJCA 1YWHA 1CXNA 1HC9B 2H7ZB 1MR6A 3EBXA 1NTNA 1FFJA 2GOOB 2HLQA 1S4YA 4RUDA 1DRSA 1KS6A 1MAHF 1G6MA 1IDHA 2MJ0A 1V6PA 1HAAA 4IYEA 2BTXA 2H64C 1TXAA 2CDXA 1IDGA 1VB0A 1HAJA 1KL8A 1RL5A 2CRTA 1KBSA 1CODA 1H0JA 1XT3A 2H62C 2QJ9C 2GOOC 2QJAC 2MHYA 1COEA 2MUOA 1M9ZA 2JVEA 4XJJA 1FSCA 2N99A 1KXIA 4QTIU 1CTXA 2MFAA 1CRFA 1NORA 1HOYA 3U74U 2ERAA 2NBTA 4LFTA 5EBXA 1CCQA 1CB9A 1KC4A 2PJYC 1BTEA 1LJZA 1LXHA 1F94A 1CHVS 1IQ9A 3KFDE 4DO8A 1KFHA 3BT2U 1LXGA 1ES7B 1IDIA 3NDSA 2JQPA 1ABTA 1CDQA 1B41B 2LA1A 1KU6B 5DO6A 3NEQA 2L5SA 2HLRA 1NTXA 1TGXA 1JBDA 1NXBA 5DZ5A 1BXPA 2VLWA 2FD6U 1I02A 4EY8B 1NYSA 1LX5B 2CRSA 2L03A 1CDTA 1ZADA 1IKCA 3QB4B 1KTZB 1TFSA 3BT1U 4HQPF 3LAQU 1UG4A 3NH7A 3ERAA 1ERAA 1RGJA 1FF4A 6EBXA 4ZQYA 1NEAA 2UX2A 1FSSB 1ONJA 4UY2C 1W6BA 1L4WA 1KBTA 1IDLA 2UWRA 1FRAA 3KFDI 1HC9A 2H7ZA 5IMTD 1CDSA 2CCXA 2H8UA 4FAOE 1QM7A 1CREA 2QJBC 2MJYA 2ABXA
chains in the Genus database with same CATH superfamily
1REWC 2BHIA 1FASA 2MUPA 3FEVA 2X8BB 2H62D 1NYUA 4OM4A 2CTXA 1CDRA 2MJ4A 2K3GA 4BIKB 1QKDA 1F8UB 2H5FA 4FAOC 4P7UA 2J8BA 3VTSA 1QKEA 4OM5A 2QC1A 3HH7A 5DU1A 1TXBA 3EVSC 3PLCA 2I9BE 3U73U 1JE9A 1PLOA 4AEAA 1CVOA 1CXOA 4BDTB 2PJYB 1KBAA 5IMYC 2OFSA 1ERGA 1IK8A 2H64B 1LSIA 2LCRA 1JGKA 1IJCA 1YWHA 1CXNA 1HC9B 2H7ZB 1MR6A 3EBXA 1NTNA 1FFJA 2GOOB 2HLQA 1S4YA 4RUDA 1DRSA 1KS6A 1MAHF 1G6MA 1IDHA 2MJ0A 1V6PA 1HAAA 4IYEA 2BTXA 2H64C 1TXAA 2CDXA 1IDGA 1VB0A 1HAJA 1KL8A 1RL5A 2CRTA 1KBSA 1CODA 1H0JA 1XT3A 2H62C 2QJ9C 2GOOC 2QJAC 2MHYA 1COEA 2MUOA 1M9ZA 2JVEA 4XJJA 1FSCA 2N99A 1KXIA 4QTIU 1CTXA 2MFAA 1CRFA 1NORA 1HOYA 3U74U 2ERAA 2NBTA 4LFTA 5EBXA 1CCQA 1CB9A 1KC4A 2PJYC 1BTEA 1LJZA 1LXHA 1F94A 1CHVS 1IQ9A 3KFDE 4DO8A 1KFHA 4KSNA 3BT2U 1LXGA 1ES7B 1IDIA 3NDSA 2JQPA 1ABTA 1CDQA 1B41B 2LA1A 1KU6B 5DO6A 3NEQA 2L5SA 2HLRA 1NTXA 1TGXA 1JBDA 1NXBA 5DZ5A 1BXPA 2VLWA 2FD6U 1I02A 4EY8B 1NYSA 1LX5B 2CRSA 2L03A 1CDTA 1ZADA 1IKCA 3QB4B 1KTZB 1TFSA 3BT1U 4HQPF 3LAQU 1UG4A 3NH7A 3ERAA 1ERAA 1RGJA 1FF4A 6EBXA 4ZQYA 1NEAA 2UX2A 1FSSB 1ONJA 4UY2C 1W6BA 1L4WA 1KBTA 1IDLA 2UWRA 1FRAA 3KFDI 1HC9A 2H7ZA 5IMTD 1CDSA 2CCXA 2H8UA 4FAOE 1QM7A 1CREA 2QJBC 2MJYA 2ABXA
chains in the Genus database with same CATH topology
1REWC 2BHIA 1FASA 2MUPA 3FEVA 2X8BB 2H62D 1NYUA 4OM4A 2CTXA 1CDRA 2MJ4A 2K3GA 4BIKB 1QKDA 1F8UB 2H5FA 4FAOC 4P7UA 2J8BA 3VTSA 1QKEA 4OM5A 2QC1A 3HH7A 5DU1A 1TXBA 3EVSC 3PLCA 2I9BE 3U73U 1JE9A 1PLOA 4AEAA 1CVOA 1CXOA 4BDTB 2PJYB 1KBAA 5IMYC 2OFSA 1ERGA 1IK8A 2H64B 1LSIA 2LCRA 1JGKA 1IJCA 1YWHA 1CXNA 1HC9B 2H7ZB 1MR6A 3EBXA 1NTNA 1FFJA 2GOOB 2HLQA 1S4YA 4RUDA 1DRSA 1KS6A 1MAHF 1G6MA 1IDHA 2MJ0A 1V6PA 1HAAA 4IYEA 2BTXA 2H64C 1TXAA 2CDXA 1IDGA 1VB0A 1HAJA 1KL8A 1RL5A 2CRTA 1KBSA 1CODA 1H0JA 1XT3A 2H62C 2QJ9C 2GOOC 2QJAC 2MHYA 1COEA 2MUOA 1M9ZA 2JVEA 4XJJA 1FSCA 2N99A 1KXIA 4QTIU 1CTXA 2MFAA 1CRFA 1NORA 1HOYA 3U74U 2ERAA 2NBTA 4LFTA 5EBXA 1CCQA 1CB9A 1KC4A 2PJYC 1BTEA 1LJZA 1LXHA 1F94A 1CHVS 1IQ9A 3KFDE 4DO8A 1KFHA 4KSNA 3BT2U 1LXGA 1ES7B 1IDIA 3NDSA 2JQPA 1ABTA 1CDQA 1B41B 2LA1A 1KU6B 5DO6A 3NEQA 2L5SA 2HLRA 1NTXA 1TGXA 1JBDA 1NXBA 5DZ5A 1BXPA 2VLWA 2FD6U 1I02A 4EY8B 1NYSA 1LX5B 2CRSA 2L03A 1CDTA 1ZADA 1IKCA 3QB4B 1KTZB 1TFSA 3BT1U 4HQPF 3LAQU 1UG4A 3NH7A 3ERAA 1ERAA 1RGJA 1FF4A 6EBXA 4ZQYA 1NEAA 2UX2A 1FSSB 1ONJA 4UY2C 1W6BA 1L4WA 1KBTA 1IDLA 2UWRA 1FRAA 3KFDI 1HC9A 2H7ZA 5IMTD 1CDSA 2CCXA 2H8UA 4FAOE 1QM7A 1CREA 2QJBC 2MJYA 2ABXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1REW C;  2BHI A;  1FAS A;  2MUP A;  3FEV A;  2X8B B;  2H62 D;  1NYU A;  4OM4 A;  2CTX A;  1CDR A;  2MJ4 A;  2K3G A;  4BIK B;  1QKD A;  1F8U B;  2H5F A;  4FAO C;  4P7U A;  2J8B A;  3VTS A;  1QKE A;  4OM5 A;  2QC1 A;  3HH7 A;  5DU1 A;  1TXB A;  3EVS C;  3PLC A;  2I9B E;  3U73 U;  1JE9 A;  1PLO A;  4AEA A;  1CVO A;  1CXO A;  4BDT B;  2PJY B;  1KBA A;  5IMY C;  2OFS A;  1ERG A;  1IK8 A;  2H64 B;  1LSI A;  2LCR A;  1JGK A;  1IJC A;  1YWH A;  1CXN A;  1HC9 B;  2H7Z B;  1MR6 A;  3EBX A;  1NTN A;  1FFJ A;  2GOO B;  2HLQ A;  1S4Y A;  4RUD A;  1DRS A;  1KS6 A;  1MAH F;  1G6M A;  1IDH A;  2MJ0 A;  1V6P A;  1HAA A;  4IYE A;  2BTX A;  2H64 C;  1TXA A;  2CDX A;  1IDG A;  1VB0 A;  1HAJ A;  1KL8 A;  1RL5 A;  2CRT A;  1KBS A;  1COD A;  1H0J A;  1XT3 A;  2H62 C;  2QJ9 C;  2GOO C;  2QJA C;  2MHY A;  1COE A;  2MUO A;  1M9Z A;  2JVE A;  4XJJ A;  1FSC A;  2N99 A;  1KXI A;  4QTI U;  1CTX A;  2MFA A;  1CRF A;  1NOR A;  1HOY A;  3U74 U;  2ERA A;  2NBT A;  4LFT A;  5EBX A;  1CCQ A;  1CB9 A;  1KC4 A;  2PJY C;  1BTE A;  1LJZ A;  1LXH A;  1F94 A;  1CHV S;  1IQ9 A;  3KFD E;  4DO8 A;  1KFH A;  3BT2 U;  1LXG A;  1ES7 B;  1IDI A;  3NDS A;  2JQP A;  1ABT A;  1CDQ A;  1B41 B;  2LA1 A;  1KU6 B;  5DO6 A;  3NEQ A;  2L5S A;  2HLR A;  1NTX A;  1TGX A;  1JBD A;  1NXB A;  5DZ5 A;  1BXP A;  2VLW A;  2FD6 U;  1I02 A;  4EY8 B;  1NYS A;  1LX5 B;  2CRS A;  2L03 A;  1CDT A;  1ZAD A;  1IKC A;  3QB4 B;  1KTZ B;  1TFS A;  3BT1 U;  4HQP F;  3LAQ U;  1UG4 A;  3NH7 A;  3ERA A;  1ERA A;  1RGJ A;  1FF4 A;  6EBX A;  4ZQY A;  1NEA A;  2UX2 A;  1FSS B;  1ONJ A;  4UY2 C;  1W6B A;  1L4W A;  1KBT A;  1IDL A;  2UWR A;  1FRA A;  3KFD I;  1HC9 A;  2H7Z A;  5IMT D;  1CDS A;  2CCX A;  2H8U A;  4FAO E;  1QM7 A;  1CRE A;  2QJB C;  2MJY A;  2ABX A; 
#chains in the Genus database with same CATH topology
 1REW C;  2BHI A;  1FAS A;  2MUP A;  3FEV A;  2X8B B;  2H62 D;  1NYU A;  4OM4 A;  2CTX A;  1CDR A;  2MJ4 A;  2K3G A;  4BIK B;  1QKD A;  1F8U B;  2H5F A;  4FAO C;  4P7U A;  2J8B A;  3VTS A;  1QKE A;  4OM5 A;  2QC1 A;  3HH7 A;  5DU1 A;  1TXB A;  3EVS C;  3PLC A;  2I9B E;  3U73 U;  1JE9 A;  1PLO A;  4AEA A;  1CVO A;  1CXO A;  4BDT B;  2PJY B;  1KBA A;  5IMY C;  2OFS A;  1ERG A;  1IK8 A;  2H64 B;  1LSI A;  2LCR A;  1JGK A;  1IJC A;  1YWH A;  1CXN A;  1HC9 B;  2H7Z B;  1MR6 A;  3EBX A;  1NTN A;  1FFJ A;  2GOO B;  2HLQ A;  1S4Y A;  4RUD A;  1DRS A;  1KS6 A;  1MAH F;  1G6M A;  1IDH A;  2MJ0 A;  1V6P A;  1HAA A;  4IYE A;  2BTX A;  2H64 C;  1TXA A;  2CDX A;  1IDG A;  1VB0 A;  1HAJ A;  1KL8 A;  1RL5 A;  2CRT A;  1KBS A;  1COD A;  1H0J A;  1XT3 A;  2H62 C;  2QJ9 C;  2GOO C;  2QJA C;  2MHY A;  1COE A;  2MUO A;  1M9Z A;  2JVE A;  4XJJ A;  1FSC A;  2N99 A;  1KXI A;  4QTI U;  1CTX A;  2MFA A;  1CRF A;  1NOR A;  1HOY A;  3U74 U;  2ERA A;  2NBT A;  4LFT A;  5EBX A;  1CCQ A;  1CB9 A;  1KC4 A;  2PJY C;  1BTE A;  1LJZ A;  1LXH A;  1F94 A;  1CHV S;  1IQ9 A;  3KFD E;  4DO8 A;  1KFH A;  4KSN A;  3BT2 U;  1LXG A;  1ES7 B;  1IDI A;  3NDS A;  2JQP A;  1ABT A;  1CDQ A;  1B41 B;  2LA1 A;  1KU6 B;  5DO6 A;  3NEQ A;  2L5S A;  2HLR A;  1NTX A;  1TGX A;  1JBD A;  1NXB A;  5DZ5 A;  1BXP A;  2VLW A;  2FD6 U;  1I02 A;  4EY8 B;  1NYS A;  1LX5 B;  2CRS A;  2L03 A;  1CDT A;  1ZAD A;  1IKC A;  3QB4 B;  1KTZ B;  1TFS A;  3BT1 U;  4HQP F;  3LAQ U;  1UG4 A;  3NH7 A;  3ERA A;  1ERA A;  1RGJ A;  1FF4 A;  6EBX A;  4ZQY A;  1NEA A;  2UX2 A;  1FSS B;  1ONJ A;  4UY2 C;  1W6B A;  1L4W A;  1KBT A;  1IDL A;  2UWR A;  1FRA A;  3KFD I;  1HC9 A;  2H7Z A;  5IMT D;  1CDS A;  2CCX A;  2H8U A;  4FAO E;  1QM7 A;  1CRE A;  2QJB C;  2MJY A;  2ABX A; 
#chains in the Genus database with same CATH homology
 1REW C;  2BHI A;  1FAS A;  2MUP A;  3FEV A;  2X8B B;  2H62 D;  1NYU A;  4OM4 A;  2CTX A;  1CDR A;  2MJ4 A;  2K3G A;  4BIK B;  1QKD A;  1F8U B;  2H5F A;  4FAO C;  4P7U A;  2J8B A;  3VTS A;  1QKE A;  4OM5 A;  2QC1 A;  3HH7 A;  5DU1 A;  1TXB A;  3EVS C;  3PLC A;  2I9B E;  3U73 U;  1JE9 A;  1PLO A;  4AEA A;  1CVO A;  1CXO A;  4BDT B;  2PJY B;  1KBA A;  5IMY C;  2OFS A;  1ERG A;  1IK8 A;  2H64 B;  1LSI A;  2LCR A;  1JGK A;  1IJC A;  1YWH A;  1CXN A;  1HC9 B;  2H7Z B;  1MR6 A;  3EBX A;  1NTN A;  1FFJ A;  2GOO B;  2HLQ A;  1S4Y A;  4RUD A;  1DRS A;  1KS6 A;  1MAH F;  1G6M A;  1IDH A;  2MJ0 A;  1V6P A;  1HAA A;  4IYE A;  2BTX A;  2H64 C;  1TXA A;  2CDX A;  1IDG A;  1VB0 A;  1HAJ A;  1KL8 A;  1RL5 A;  2CRT A;  1KBS A;  1COD A;  1H0J A;  1XT3 A;  2H62 C;  2QJ9 C;  2GOO C;  2QJA C;  2MHY A;  1COE A;  2MUO A;  1M9Z A;  2JVE A;  4XJJ A;  1FSC A;  2N99 A;  1KXI A;  4QTI U;  1CTX A;  2MFA A;  1CRF A;  1NOR A;  1HOY A;  3U74 U;  2ERA A;  2NBT A;  4LFT A;  5EBX A;  1CCQ A;  1CB9 A;  1KC4 A;  2PJY C;  1BTE A;  1LJZ A;  1LXH A;  1F94 A;  1CHV S;  1IQ9 A;  3KFD E;  4DO8 A;  1KFH A;  4KSN A;  3BT2 U;  1LXG A;  1ES7 B;  1IDI A;  3NDS A;  2JQP A;  1ABT A;  1CDQ A;  1B41 B;  2LA1 A;  1KU6 B;  5DO6 A;  3NEQ A;  2L5S A;  2HLR A;  1NTX A;  1TGX A;  1JBD A;  1NXB A;  5DZ5 A;  1BXP A;  2VLW A;  2FD6 U;  1I02 A;  4EY8 B;  1NYS A;  1LX5 B;  2CRS A;  2L03 A;  1CDT A;  1ZAD A;  1IKC A;  3QB4 B;  1KTZ B;  1TFS A;  3BT1 U;  4HQP F;  3LAQ U;  1UG4 A;  3NH7 A;  3ERA A;  1ERA A;  1RGJ A;  1FF4 A;  6EBX A;  4ZQY A;  1NEA A;  2UX2 A;  1FSS B;  1ONJ A;  4UY2 C;  1W6B A;  1L4W A;  1KBT A;  1IDL A;  2UWR A;  1FRA A;  3KFD I;  1HC9 A;  2H7Z A;  5IMT D;  1CDS A;  2CCX A;  2H8U A;  4FAO E;  1QM7 A;  1CRE A;  2QJB C;  2MJY A;  2ABX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...