1IJCA

Solution structure of bucandin, a neurotoxin from the venom of the malayan krait
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
63
Chain Sequence
MECYRCGVSGCHLKITCSAEETFCYKWLNKISNERWLGCAKTCTEIDTWNVYNKCCTTNLCNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords bucandin
publication title NMR structure of bucandin, a neurotoxin from the venom of the Malayan krait (Bungarus candidus).
pubmed doi rcsb
total genus 6
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2001-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ijcA00
1QKDA 1HOYA 1XT3A 1NEAA 1UG4A 3ERAA 2QJBC 1HC9A 2H62C 1CDQA 2BHIA 4OM4A 1FRAA 1KC4A 2CCXA 1YWHA 1JBDA 1MR6A 1CHVS 2PJYB 1DRSA 1FASA 1L4WA 1HAJA 1G6MA 1V6PA 4EY8B 1CCQA 5DO6A 1CODA 2I9BE 1ES7B 1RL5A 1KBTA 1LXHA 1NTNA 2MJYA 1VB0A 1CB9A 1KL8A 1JGKA 1LX5B 2J8BA 4BDTB 1NXBA 1FSCA 2QJAC 2H8UA 2H7ZA 2X8BB 3U73U 1CDSA 4DO8A 1CXOA 2BTXA 4IYEA 4QTIU 1IJCA 2H5FA 1KS6A 1CVOA 1FSSB 1ERGA 1M9ZA 1ERAA 1TXAA 3EBXA 4ZQYA 2MJ4A 1QKEA 1W6BA 2CRSA 1ABTA 6EBXA 4AEAA 1CDTA 1LXGA 1BXPA 1IDIA 1HC9B 1TXBA 2FD6U 2MUOA 2GOOB 3KFDE 1KBAA 1FF4A 1F94A 1IKCA 2H64C 2MFAA 2ERAA 2MHYA 2JVEA 1B41B 2N99A 3KFDI 1CTXA 3FEVA 3HH7A 1KBSA 1F8UB 1TGXA 1ZADA 4BIKB 1NTXA 1IDGA 5DU1A 1I02A 3NEQA 3LAQU 2MJ0A 1NYSA 4LFTA 2CTXA 2H7ZB 1H0JA 4RUDA 4P7UA 1PLOA 1KFHA 1S4YA 2QC1A 2HLQA 1CDRA 2MUPA 3EVSC 5IMYC 2NBTA 3U74U 4FAOC 2PJYC 3QB4B 1IK8A 1ONJA 4XJJA 2HLRA 2QJ9C 2VLWA 5EBXA 1IDLA 4OM5A 1NYUA 4UY2C 1KXIA 2L5SA 1JE9A 2UX2A 5IMTD 1KTZB 1IQ9A 2LCRA 5DZ5A 2JQPA 1IDHA 4HQPF 3VTSA 3PLCA 1LSIA 2H64B 1RGJA 1NORA 2K3GA 1FFJA 3NDSA 3NH7A 1QM7A 1COEA 3BT1U 2ABXA 1KU6B 2L03A 3BT2U 1CREA 1LJZA 1REWC 1MAHF 1BTEA 1CRFA 4FAOE 2UWRA 1CXNA 2CDXA 1TFSA 2H62D 2CRTA 2LA1A 2OFSA 1HAAA 2GOOC
chains in the Genus database with same CATH superfamily
1QKDA 1HOYA 1XT3A 1NEAA 1UG4A 3ERAA 2QJBC 1HC9A 2H62C 1CDQA 2BHIA 4OM4A 1FRAA 1KC4A 2CCXA 1YWHA 1JBDA 1MR6A 1CHVS 2PJYB 1DRSA 1FASA 1L4WA 1HAJA 1G6MA 1V6PA 4EY8B 1CCQA 5DO6A 1CODA 2I9BE 1ES7B 1RL5A 1KBTA 1LXHA 1NTNA 2MJYA 1VB0A 1CB9A 1KL8A 1JGKA 1LX5B 2J8BA 4BDTB 1NXBA 1FSCA 2QJAC 2H8UA 2H7ZA 2X8BB 3U73U 1CDSA 4DO8A 1CXOA 2BTXA 4IYEA 4QTIU 1IJCA 2H5FA 1KS6A 1CVOA 1FSSB 1ERGA 1M9ZA 1ERAA 1TXAA 3EBXA 4ZQYA 2MJ4A 1QKEA 1W6BA 2CRSA 1ABTA 6EBXA 4AEAA 1CDTA 1LXGA 1BXPA 1IDIA 1HC9B 1TXBA 2FD6U 2MUOA 2GOOB 3KFDE 1KBAA 1FF4A 1F94A 1IKCA 2H64C 2MFAA 2ERAA 2MHYA 2JVEA 1B41B 2N99A 3KFDI 1CTXA 3FEVA 3HH7A 1KBSA 1F8UB 1TGXA 1ZADA 4BIKB 1NTXA 1IDGA 5DU1A 1I02A 3NEQA 3LAQU 2MJ0A 1NYSA 4LFTA 2CTXA 2H7ZB 1H0JA 4RUDA 4P7UA 1PLOA 1KFHA 1S4YA 2QC1A 2HLQA 1CDRA 2MUPA 3EVSC 5IMYC 2NBTA 3U74U 4FAOC 2PJYC 3QB4B 1IK8A 1ONJA 4XJJA 2HLRA 2QJ9C 2VLWA 5EBXA 1IDLA 4OM5A 1NYUA 4UY2C 1KXIA 2L5SA 1JE9A 2UX2A 5IMTD 1KTZB 1IQ9A 2LCRA 5DZ5A 2JQPA 1IDHA 4HQPF 3VTSA 3PLCA 1LSIA 2H64B 1RGJA 1NORA 2K3GA 1FFJA 3NDSA 3NH7A 1QM7A 1COEA 3BT1U 2ABXA 1KU6B 2L03A 3BT2U 1CREA 1LJZA 1REWC 1MAHF 4KSNA 1BTEA 1CRFA 4FAOE 2UWRA 1CXNA 2CDXA 1TFSA 2H62D 2CRTA 2LA1A 2OFSA 1HAAA 2GOOC
chains in the Genus database with same CATH topology
1QKDA 1HOYA 1XT3A 1NEAA 1UG4A 3ERAA 2QJBC 1HC9A 2H62C 1CDQA 2BHIA 4OM4A 1FRAA 1KC4A 2CCXA 1YWHA 1JBDA 1MR6A 1CHVS 2PJYB 1DRSA 1FASA 1L4WA 1HAJA 1G6MA 1V6PA 4EY8B 1CCQA 5DO6A 1CODA 2I9BE 1ES7B 1RL5A 1KBTA 1LXHA 1NTNA 2MJYA 1VB0A 1CB9A 1KL8A 1JGKA 1LX5B 2J8BA 4BDTB 1NXBA 1FSCA 2QJAC 2H8UA 2H7ZA 2X8BB 3U73U 1CDSA 4DO8A 1CXOA 2BTXA 4IYEA 4QTIU 1IJCA 2H5FA 1KS6A 1CVOA 1FSSB 1ERGA 1M9ZA 1ERAA 1TXAA 3EBXA 4ZQYA 2MJ4A 1QKEA 1W6BA 2CRSA 1ABTA 6EBXA 4AEAA 1CDTA 1LXGA 1BXPA 1IDIA 1HC9B 1TXBA 2FD6U 2MUOA 2GOOB 3KFDE 1KBAA 1FF4A 1F94A 1IKCA 2H64C 2MFAA 2ERAA 2MHYA 2JVEA 1B41B 2N99A 3KFDI 1CTXA 3FEVA 3HH7A 1KBSA 1F8UB 1TGXA 1ZADA 4BIKB 1NTXA 1IDGA 5DU1A 1I02A 3NEQA 3LAQU 2MJ0A 1NYSA 4LFTA 2CTXA 2H7ZB 1H0JA 4RUDA 4P7UA 1PLOA 1KFHA 1S4YA 2QC1A 2HLQA 1CDRA 2MUPA 3EVSC 5IMYC 2NBTA 3U74U 4FAOC 2PJYC 3QB4B 1IK8A 1ONJA 4XJJA 2HLRA 2QJ9C 2VLWA 5EBXA 1IDLA 4OM5A 1NYUA 4UY2C 1KXIA 2L5SA 1JE9A 2UX2A 5IMTD 1KTZB 1IQ9A 2LCRA 5DZ5A 2JQPA 1IDHA 4HQPF 3VTSA 3PLCA 1LSIA 2H64B 1RGJA 1NORA 2K3GA 1FFJA 3NDSA 3NH7A 1QM7A 1COEA 3BT1U 2ABXA 1KU6B 2L03A 3BT2U 1CREA 1LJZA 1REWC 1MAHF 4KSNA 1BTEA 1CRFA 4FAOE 2UWRA 1CXNA 2CDXA 1TFSA 2H62D 2CRTA 2LA1A 2OFSA 1HAAA 2GOOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKD A;  1HOY A;  1XT3 A;  1NEA A;  1UG4 A;  3ERA A;  2QJB C;  1HC9 A;  2H62 C;  1CDQ A;  2BHI A;  4OM4 A;  1FRA A;  1KC4 A;  2CCX A;  1YWH A;  1JBD A;  1MR6 A;  1CHV S;  2PJY B;  1DRS A;  1FAS A;  1L4W A;  1HAJ A;  1G6M A;  1V6P A;  4EY8 B;  1CCQ A;  5DO6 A;  1COD A;  2I9B E;  1ES7 B;  1RL5 A;  1KBT A;  1LXH A;  1NTN A;  2MJY A;  1VB0 A;  1CB9 A;  1KL8 A;  1JGK A;  1LX5 B;  2J8B A;  4BDT B;  1NXB A;  1FSC A;  2QJA C;  2H8U A;  2H7Z A;  2X8B B;  3U73 U;  1CDS A;  4DO8 A;  1CXO A;  2BTX A;  4IYE A;  4QTI U;  1IJC A;  2H5F A;  1KS6 A;  1CVO A;  1FSS B;  1ERG A;  1M9Z A;  1ERA A;  1TXA A;  3EBX A;  4ZQY A;  2MJ4 A;  1QKE A;  1W6B A;  2CRS A;  1ABT A;  6EBX A;  4AEA A;  1CDT A;  1LXG A;  1BXP A;  1IDI A;  1HC9 B;  1TXB A;  2FD6 U;  2MUO A;  2GOO B;  3KFD E;  1KBA A;  1FF4 A;  1F94 A;  1IKC A;  2H64 C;  2MFA A;  2ERA A;  2MHY A;  2JVE A;  1B41 B;  2N99 A;  3KFD I;  1CTX A;  3FEV A;  3HH7 A;  1KBS A;  1F8U B;  1TGX A;  1ZAD A;  4BIK B;  1NTX A;  1IDG A;  5DU1 A;  1I02 A;  3NEQ A;  3LAQ U;  2MJ0 A;  1NYS A;  4LFT A;  2CTX A;  2H7Z B;  1H0J A;  4RUD A;  4P7U A;  1PLO A;  1KFH A;  1S4Y A;  2QC1 A;  2HLQ A;  1CDR A;  2MUP A;  3EVS C;  5IMY C;  2NBT A;  3U74 U;  4FAO C;  2PJY C;  3QB4 B;  1IK8 A;  1ONJ A;  4XJJ A;  2HLR A;  2QJ9 C;  2VLW A;  5EBX A;  1IDL A;  4OM5 A;  1NYU A;  4UY2 C;  1KXI A;  2L5S A;  1JE9 A;  2UX2 A;  5IMT D;  1KTZ B;  1IQ9 A;  2LCR A;  5DZ5 A;  2JQP A;  1IDH A;  4HQP F;  3VTS A;  3PLC A;  1LSI A;  2H64 B;  1RGJ A;  1NOR A;  2K3G A;  1FFJ A;  3NDS A;  3NH7 A;  1QM7 A;  1COE A;  3BT1 U;  2ABX A;  1KU6 B;  2L03 A;  3BT2 U;  1CRE A;  1LJZ A;  1REW C;  1MAH F;  1BTE A;  1CRF A;  4FAO E;  2UWR A;  1CXN A;  2CDX A;  1TFS A;  2H62 D;  2CRT A;  2LA1 A;  2OFS A;  1HAA A;  2GOO C; 
#chains in the Genus database with same CATH topology
 1QKD A;  1HOY A;  1XT3 A;  1NEA A;  1UG4 A;  3ERA A;  2QJB C;  1HC9 A;  2H62 C;  1CDQ A;  2BHI A;  4OM4 A;  1FRA A;  1KC4 A;  2CCX A;  1YWH A;  1JBD A;  1MR6 A;  1CHV S;  2PJY B;  1DRS A;  1FAS A;  1L4W A;  1HAJ A;  1G6M A;  1V6P A;  4EY8 B;  1CCQ A;  5DO6 A;  1COD A;  2I9B E;  1ES7 B;  1RL5 A;  1KBT A;  1LXH A;  1NTN A;  2MJY A;  1VB0 A;  1CB9 A;  1KL8 A;  1JGK A;  1LX5 B;  2J8B A;  4BDT B;  1NXB A;  1FSC A;  2QJA C;  2H8U A;  2H7Z A;  2X8B B;  3U73 U;  1CDS A;  4DO8 A;  1CXO A;  2BTX A;  4IYE A;  4QTI U;  1IJC A;  2H5F A;  1KS6 A;  1CVO A;  1FSS B;  1ERG A;  1M9Z A;  1ERA A;  1TXA A;  3EBX A;  4ZQY A;  2MJ4 A;  1QKE A;  1W6B A;  2CRS A;  1ABT A;  6EBX A;  4AEA A;  1CDT A;  1LXG A;  1BXP A;  1IDI A;  1HC9 B;  1TXB A;  2FD6 U;  2MUO A;  2GOO B;  3KFD E;  1KBA A;  1FF4 A;  1F94 A;  1IKC A;  2H64 C;  2MFA A;  2ERA A;  2MHY A;  2JVE A;  1B41 B;  2N99 A;  3KFD I;  1CTX A;  3FEV A;  3HH7 A;  1KBS A;  1F8U B;  1TGX A;  1ZAD A;  4BIK B;  1NTX A;  1IDG A;  5DU1 A;  1I02 A;  3NEQ A;  3LAQ U;  2MJ0 A;  1NYS A;  4LFT A;  2CTX A;  2H7Z B;  1H0J A;  4RUD A;  4P7U A;  1PLO A;  1KFH A;  1S4Y A;  2QC1 A;  2HLQ A;  1CDR A;  2MUP A;  3EVS C;  5IMY C;  2NBT A;  3U74 U;  4FAO C;  2PJY C;  3QB4 B;  1IK8 A;  1ONJ A;  4XJJ A;  2HLR A;  2QJ9 C;  2VLW A;  5EBX A;  1IDL A;  4OM5 A;  1NYU A;  4UY2 C;  1KXI A;  2L5S A;  1JE9 A;  2UX2 A;  5IMT D;  1KTZ B;  1IQ9 A;  2LCR A;  5DZ5 A;  2JQP A;  1IDH A;  4HQP F;  3VTS A;  3PLC A;  1LSI A;  2H64 B;  1RGJ A;  1NOR A;  2K3G A;  1FFJ A;  3NDS A;  3NH7 A;  1QM7 A;  1COE A;  3BT1 U;  2ABX A;  1KU6 B;  2L03 A;  3BT2 U;  1CRE A;  1LJZ A;  1REW C;  1MAH F;  4KSN A;  1BTE A;  1CRF A;  4FAO E;  2UWR A;  1CXN A;  2CDX A;  1TFS A;  2H62 D;  2CRT A;  2LA1 A;  2OFS A;  1HAA A;  2GOO C; 
#chains in the Genus database with same CATH homology
 1QKD A;  1HOY A;  1XT3 A;  1NEA A;  1UG4 A;  3ERA A;  2QJB C;  1HC9 A;  2H62 C;  1CDQ A;  2BHI A;  4OM4 A;  1FRA A;  1KC4 A;  2CCX A;  1YWH A;  1JBD A;  1MR6 A;  1CHV S;  2PJY B;  1DRS A;  1FAS A;  1L4W A;  1HAJ A;  1G6M A;  1V6P A;  4EY8 B;  1CCQ A;  5DO6 A;  1COD A;  2I9B E;  1ES7 B;  1RL5 A;  1KBT A;  1LXH A;  1NTN A;  2MJY A;  1VB0 A;  1CB9 A;  1KL8 A;  1JGK A;  1LX5 B;  2J8B A;  4BDT B;  1NXB A;  1FSC A;  2QJA C;  2H8U A;  2H7Z A;  2X8B B;  3U73 U;  1CDS A;  4DO8 A;  1CXO A;  2BTX A;  4IYE A;  4QTI U;  1IJC A;  2H5F A;  1KS6 A;  1CVO A;  1FSS B;  1ERG A;  1M9Z A;  1ERA A;  1TXA A;  3EBX A;  4ZQY A;  2MJ4 A;  1QKE A;  1W6B A;  2CRS A;  1ABT A;  6EBX A;  4AEA A;  1CDT A;  1LXG A;  1BXP A;  1IDI A;  1HC9 B;  1TXB A;  2FD6 U;  2MUO A;  2GOO B;  3KFD E;  1KBA A;  1FF4 A;  1F94 A;  1IKC A;  2H64 C;  2MFA A;  2ERA A;  2MHY A;  2JVE A;  1B41 B;  2N99 A;  3KFD I;  1CTX A;  3FEV A;  3HH7 A;  1KBS A;  1F8U B;  1TGX A;  1ZAD A;  4BIK B;  1NTX A;  1IDG A;  5DU1 A;  1I02 A;  3NEQ A;  3LAQ U;  2MJ0 A;  1NYS A;  4LFT A;  2CTX A;  2H7Z B;  1H0J A;  4RUD A;  4P7U A;  1PLO A;  1KFH A;  1S4Y A;  2QC1 A;  2HLQ A;  1CDR A;  2MUP A;  3EVS C;  5IMY C;  2NBT A;  3U74 U;  4FAO C;  2PJY C;  3QB4 B;  1IK8 A;  1ONJ A;  4XJJ A;  2HLR A;  2QJ9 C;  2VLW A;  5EBX A;  1IDL A;  4OM5 A;  1NYU A;  4UY2 C;  1KXI A;  2L5S A;  1JE9 A;  2UX2 A;  5IMT D;  1KTZ B;  1IQ9 A;  2LCR A;  5DZ5 A;  2JQP A;  1IDH A;  4HQP F;  3VTS A;  3PLC A;  1LSI A;  2H64 B;  1RGJ A;  1NOR A;  2K3G A;  1FFJ A;  3NDS A;  3NH7 A;  1QM7 A;  1COE A;  3BT1 U;  2ABX A;  1KU6 B;  2L03 A;  3BT2 U;  1CRE A;  1LJZ A;  1REW C;  1MAH F;  4KSN A;  1BTE A;  1CRF A;  4FAO E;  2UWR A;  1CXN A;  2CDX A;  1TFS A;  2H62 D;  2CRT A;  2LA1 A;  2OFS A;  1HAA A;  2GOO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...