1IJCA

Solution structure of bucandin, a neurotoxin from the venom of the malayan krait
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
63
Chain Sequence
MECYRCGVSGCHLKITCSAEETFCYKWLNKISNERWLGCAKTCTEIDTWNVYNKCCTTNLCNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bucandin
publication title NMR structure of bucandin, a neurotoxin from the venom of the Malayan krait (Bungarus candidus).
pubmed doi rcsb
molecule tags Toxin
total genus 6
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2001-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ijcA00
1CODA 1MR6A 1CREA 1F94A 4UY2C 1IDGA 1JE9A 5IMTD 3U73U 3NEQA 1F8UB 2CRTA 1XT3A 1ES7B 1QKEA 4P7UA 1MAHF 1COEA 2NBTA 1PLOA 1CCQA 3EVSC 1TGXA 4RUDA 1IJCA 1KTZB 2MHYA 3FEVA 2L5SA 4BDTB 2N99A 2CTXA 1LJZA 2HLRA 2OFSA 4OM4A 1CRFA 2UX2A 2MJ0A 4DO8A 1ERAA 2CCXA 2L03A 2H62C 2PJYB 3BT2U 1L4WA 4BIKB 1QM7A 1KXIA 1JBDA 3ERAA 1JGKA 1FFJA 1KS6A 1HAJA 1KBSA 1TFSA 3VTSA 2H7ZB 1M9ZA 2K3GA 1NEAA 1H0JA 1CTXA 1NYUA 3PLCA 1IDIA 2I9BE 2GOOB 3BT1U 1KL8A 3EBXA 2PJYC 1IKCA 1UG4A 2QJBC 1LXGA 2H62D 1HC9A 1VB0A 2JQPA 1DRSA 1NXBA 1KC4A 2MUPA 1CXNA 1ERGA 1TXAA 4ZQYA 5IMYC 3NDSA 2ERAA 1IQ9A 1W6BA 3HH7A 1NORA 3QB4B 5EBXA 1ZADA 4AEAA 1CDQA 2GOOC 2X8BB 1LSIA 2J8BA 2FD6U 2H8UA 1FRAA 1CVOA 1IDHA 1NTXA 1IDLA 1RL5A 1QKDA 1CDTA 1ONJA 1S4YA 2VLWA 1BXPA 1I02A 1NYSA 2H64B 2LCRA 3KFDI 1LXHA 2MJ4A 1RGJA 3U74U 2MJYA 1KU6B 4XJJA 4FAOE 1FF4A 3LAQU 2MFAA 5DZ5A 4OM5A 1ABTA 2BTXA 2H64C 1IK8A 1CDRA 1BTEA 1FSCA 1KBAA 4HQPF 5DO6A 2MUOA 1KFHA 2H5FA 1FASA 1FSSB 2LA1A 4QTIU 2CRSA 2ABXA 4FAOC 3NH7A 2HLQA 2QC1A 4LFTA 2H7ZA 5DU1A 6EBXA 1B41B 2JVEA 3KFDE 1V6PA 1HOYA 1CHVS 1HC9B 2QJ9C 1KBTA 1CXOA 1NTNA 1HAAA 1YWHA 1G6MA 2BHIA 1CB9A 1TXBA 2QJAC 4EY8B 2UWRA 1CDSA 2CDXA 4IYEA 1LX5B 1REWC
chains in the Genus database with same CATH superfamily
1CODA 1MR6A 1CREA 1F94A 4UY2C 1IDGA 1JE9A 5IMTD 3U73U 3NEQA 1F8UB 2CRTA 1XT3A 1ES7B 1QKEA 4P7UA 1MAHF 1COEA 2NBTA 1PLOA 1CCQA 3EVSC 1TGXA 4RUDA 1IJCA 1KTZB 2MHYA 3FEVA 2L5SA 4BDTB 2N99A 2CTXA 1LJZA 2HLRA 2OFSA 4OM4A 1CRFA 2UX2A 2MJ0A 4DO8A 1ERAA 2CCXA 2L03A 2H62C 2PJYB 3BT2U 1L4WA 4BIKB 1QM7A 1KXIA 1JBDA 3ERAA 1JGKA 1FFJA 1KS6A 1HAJA 1KBSA 1TFSA 3VTSA 4KSNA 2H7ZB 1M9ZA 2K3GA 1NEAA 1H0JA 1CTXA 1NYUA 3PLCA 1IDIA 2I9BE 2GOOB 3BT1U 1KL8A 3EBXA 2PJYC 1IKCA 1UG4A 2QJBC 1LXGA 2H62D 1HC9A 1VB0A 2JQPA 1DRSA 1NXBA 1KC4A 2MUPA 1CXNA 1ERGA 1TXAA 4ZQYA 5IMYC 3NDSA 2ERAA 1IQ9A 1W6BA 3HH7A 1NORA 3QB4B 5EBXA 1ZADA 4AEAA 1CDQA 2GOOC 2X8BB 1LSIA 2J8BA 2FD6U 2H8UA 1FRAA 1CVOA 1IDHA 1NTXA 1IDLA 1RL5A 1QKDA 1CDTA 1ONJA 1S4YA 2VLWA 1BXPA 1I02A 1NYSA 2H64B 2LCRA 3KFDI 1LXHA 2MJ4A 1RGJA 3U74U 2MJYA 1KU6B 4XJJA 4FAOE 1FF4A 3LAQU 2MFAA 5DZ5A 4OM5A 1ABTA 2BTXA 2H64C 1IK8A 1CDRA 1BTEA 1FSCA 1KBAA 4HQPF 5DO6A 2MUOA 1KFHA 2H5FA 1FASA 1FSSB 2LA1A 4QTIU 2CRSA 2ABXA 4FAOC 3NH7A 2HLQA 2QC1A 4LFTA 2H7ZA 5DU1A 6EBXA 1B41B 2JVEA 3KFDE 1V6PA 1HOYA 1CHVS 1HC9B 2QJ9C 1KBTA 1CXOA 1NTNA 1HAAA 1YWHA 1G6MA 2BHIA 1CB9A 1TXBA 2QJAC 4EY8B 2UWRA 1CDSA 2CDXA 4IYEA 1LX5B 1REWC
chains in the Genus database with same CATH topology
1CODA 1MR6A 1CREA 1F94A 4UY2C 1IDGA 1JE9A 5IMTD 3U73U 3NEQA 1F8UB 2CRTA 1XT3A 1ES7B 1QKEA 4P7UA 1MAHF 1COEA 2NBTA 1PLOA 1CCQA 3EVSC 1TGXA 4RUDA 1IJCA 1KTZB 2MHYA 3FEVA 2L5SA 4BDTB 2N99A 2CTXA 1LJZA 2HLRA 2OFSA 4OM4A 1CRFA 2UX2A 2MJ0A 4DO8A 1ERAA 2CCXA 2L03A 2H62C 2PJYB 3BT2U 1L4WA 4BIKB 1QM7A 1KXIA 1JBDA 3ERAA 1JGKA 1FFJA 1KS6A 1HAJA 1KBSA 1TFSA 3VTSA 4KSNA 2H7ZB 1M9ZA 2K3GA 1NEAA 1H0JA 1CTXA 1NYUA 3PLCA 1IDIA 2I9BE 2GOOB 3BT1U 1KL8A 3EBXA 2PJYC 1IKCA 1UG4A 2QJBC 1LXGA 2H62D 1HC9A 1VB0A 2JQPA 1DRSA 1NXBA 1KC4A 2MUPA 1CXNA 1ERGA 1TXAA 4ZQYA 5IMYC 3NDSA 2ERAA 1IQ9A 1W6BA 3HH7A 1NORA 3QB4B 5EBXA 1ZADA 4AEAA 1CDQA 2GOOC 2X8BB 1LSIA 2J8BA 2FD6U 2H8UA 1FRAA 1CVOA 1IDHA 1NTXA 1IDLA 1RL5A 1QKDA 1CDTA 1ONJA 1S4YA 2VLWA 1BXPA 1I02A 1NYSA 2H64B 2LCRA 3KFDI 1LXHA 2MJ4A 1RGJA 3U74U 2MJYA 1KU6B 4XJJA 4FAOE 1FF4A 3LAQU 2MFAA 5DZ5A 4OM5A 1ABTA 2BTXA 2H64C 1IK8A 1CDRA 1BTEA 1FSCA 1KBAA 4HQPF 5DO6A 2MUOA 1KFHA 2H5FA 1FASA 1FSSB 2LA1A 4QTIU 2CRSA 2ABXA 4FAOC 3NH7A 2HLQA 2QC1A 4LFTA 2H7ZA 5DU1A 6EBXA 1B41B 2JVEA 3KFDE 1V6PA 1HOYA 1CHVS 1HC9B 2QJ9C 1KBTA 1CXOA 1NTNA 1HAAA 1YWHA 1G6MA 2BHIA 1CB9A 1TXBA 2QJAC 4EY8B 2UWRA 1CDSA 2CDXA 4IYEA 1LX5B 1REWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COD A;  1MR6 A;  1CRE A;  1F94 A;  4UY2 C;  1IDG A;  1JE9 A;  5IMT D;  3U73 U;  3NEQ A;  1F8U B;  2CRT A;  1XT3 A;  1ES7 B;  1QKE A;  4P7U A;  1MAH F;  1COE A;  2NBT A;  1PLO A;  1CCQ A;  3EVS C;  1TGX A;  4RUD A;  1IJC A;  1KTZ B;  2MHY A;  3FEV A;  2L5S A;  4BDT B;  2N99 A;  2CTX A;  1LJZ A;  2HLR A;  2OFS A;  4OM4 A;  1CRF A;  2UX2 A;  2MJ0 A;  4DO8 A;  1ERA A;  2CCX A;  2L03 A;  2H62 C;  2PJY B;  3BT2 U;  1L4W A;  4BIK B;  1QM7 A;  1KXI A;  1JBD A;  3ERA A;  1JGK A;  1FFJ A;  1KS6 A;  1HAJ A;  1KBS A;  1TFS A;  3VTS A;  2H7Z B;  1M9Z A;  2K3G A;  1NEA A;  1H0J A;  1CTX A;  1NYU A;  3PLC A;  1IDI A;  2I9B E;  2GOO B;  3BT1 U;  1KL8 A;  3EBX A;  2PJY C;  1IKC A;  1UG4 A;  2QJB C;  1LXG A;  2H62 D;  1HC9 A;  1VB0 A;  2JQP A;  1DRS A;  1NXB A;  1KC4 A;  2MUP A;  1CXN A;  1ERG A;  1TXA A;  4ZQY A;  5IMY C;  3NDS A;  2ERA A;  1IQ9 A;  1W6B A;  3HH7 A;  1NOR A;  3QB4 B;  5EBX A;  1ZAD A;  4AEA A;  1CDQ A;  2GOO C;  2X8B B;  1LSI A;  2J8B A;  2FD6 U;  2H8U A;  1FRA A;  1CVO A;  1IDH A;  1NTX A;  1IDL A;  1RL5 A;  1QKD A;  1CDT A;  1ONJ A;  1S4Y A;  2VLW A;  1BXP A;  1I02 A;  1NYS A;  2H64 B;  2LCR A;  3KFD I;  1LXH A;  2MJ4 A;  1RGJ A;  3U74 U;  2MJY A;  1KU6 B;  4XJJ A;  4FAO E;  1FF4 A;  3LAQ U;  2MFA A;  5DZ5 A;  4OM5 A;  1ABT A;  2BTX A;  2H64 C;  1IK8 A;  1CDR A;  1BTE A;  1FSC A;  1KBA A;  4HQP F;  5DO6 A;  2MUO A;  1KFH A;  2H5F A;  1FAS A;  1FSS B;  2LA1 A;  4QTI U;  2CRS A;  2ABX A;  4FAO C;  3NH7 A;  2HLQ A;  2QC1 A;  4LFT A;  2H7Z A;  5DU1 A;  6EBX A;  1B41 B;  2JVE A;  3KFD E;  1V6P A;  1HOY A;  1CHV S;  1HC9 B;  2QJ9 C;  1KBT A;  1CXO A;  1NTN A;  1HAA A;  1YWH A;  1G6M A;  2BHI A;  1CB9 A;  1TXB A;  2QJA C;  4EY8 B;  2UWR A;  1CDS A;  2CDX A;  4IYE A;  1LX5 B;  1REW C; 
#chains in the Genus database with same CATH topology
 1COD A;  1MR6 A;  1CRE A;  1F94 A;  4UY2 C;  1IDG A;  1JE9 A;  5IMT D;  3U73 U;  3NEQ A;  1F8U B;  2CRT A;  1XT3 A;  1ES7 B;  1QKE A;  4P7U A;  1MAH F;  1COE A;  2NBT A;  1PLO A;  1CCQ A;  3EVS C;  1TGX A;  4RUD A;  1IJC A;  1KTZ B;  2MHY A;  3FEV A;  2L5S A;  4BDT B;  2N99 A;  2CTX A;  1LJZ A;  2HLR A;  2OFS A;  4OM4 A;  1CRF A;  2UX2 A;  2MJ0 A;  4DO8 A;  1ERA A;  2CCX A;  2L03 A;  2H62 C;  2PJY B;  3BT2 U;  1L4W A;  4BIK B;  1QM7 A;  1KXI A;  1JBD A;  3ERA A;  1JGK A;  1FFJ A;  1KS6 A;  1HAJ A;  1KBS A;  1TFS A;  3VTS A;  4KSN A;  2H7Z B;  1M9Z A;  2K3G A;  1NEA A;  1H0J A;  1CTX A;  1NYU A;  3PLC A;  1IDI A;  2I9B E;  2GOO B;  3BT1 U;  1KL8 A;  3EBX A;  2PJY C;  1IKC A;  1UG4 A;  2QJB C;  1LXG A;  2H62 D;  1HC9 A;  1VB0 A;  2JQP A;  1DRS A;  1NXB A;  1KC4 A;  2MUP A;  1CXN A;  1ERG A;  1TXA A;  4ZQY A;  5IMY C;  3NDS A;  2ERA A;  1IQ9 A;  1W6B A;  3HH7 A;  1NOR A;  3QB4 B;  5EBX A;  1ZAD A;  4AEA A;  1CDQ A;  2GOO C;  2X8B B;  1LSI A;  2J8B A;  2FD6 U;  2H8U A;  1FRA A;  1CVO A;  1IDH A;  1NTX A;  1IDL A;  1RL5 A;  1QKD A;  1CDT A;  1ONJ A;  1S4Y A;  2VLW A;  1BXP A;  1I02 A;  1NYS A;  2H64 B;  2LCR A;  3KFD I;  1LXH A;  2MJ4 A;  1RGJ A;  3U74 U;  2MJY A;  1KU6 B;  4XJJ A;  4FAO E;  1FF4 A;  3LAQ U;  2MFA A;  5DZ5 A;  4OM5 A;  1ABT A;  2BTX A;  2H64 C;  1IK8 A;  1CDR A;  1BTE A;  1FSC A;  1KBA A;  4HQP F;  5DO6 A;  2MUO A;  1KFH A;  2H5F A;  1FAS A;  1FSS B;  2LA1 A;  4QTI U;  2CRS A;  2ABX A;  4FAO C;  3NH7 A;  2HLQ A;  2QC1 A;  4LFT A;  2H7Z A;  5DU1 A;  6EBX A;  1B41 B;  2JVE A;  3KFD E;  1V6P A;  1HOY A;  1CHV S;  1HC9 B;  2QJ9 C;  1KBT A;  1CXO A;  1NTN A;  1HAA A;  1YWH A;  1G6M A;  2BHI A;  1CB9 A;  1TXB A;  2QJA C;  4EY8 B;  2UWR A;  1CDS A;  2CDX A;  4IYE A;  1LX5 B;  1REW C; 
#chains in the Genus database with same CATH homology
 1COD A;  1MR6 A;  1CRE A;  1F94 A;  4UY2 C;  1IDG A;  1JE9 A;  5IMT D;  3U73 U;  3NEQ A;  1F8U B;  2CRT A;  1XT3 A;  1ES7 B;  1QKE A;  4P7U A;  1MAH F;  1COE A;  2NBT A;  1PLO A;  1CCQ A;  3EVS C;  1TGX A;  4RUD A;  1IJC A;  1KTZ B;  2MHY A;  3FEV A;  2L5S A;  4BDT B;  2N99 A;  2CTX A;  1LJZ A;  2HLR A;  2OFS A;  4OM4 A;  1CRF A;  2UX2 A;  2MJ0 A;  4DO8 A;  1ERA A;  2CCX A;  2L03 A;  2H62 C;  2PJY B;  3BT2 U;  1L4W A;  4BIK B;  1QM7 A;  1KXI A;  1JBD A;  3ERA A;  1JGK A;  1FFJ A;  1KS6 A;  1HAJ A;  1KBS A;  1TFS A;  3VTS A;  4KSN A;  2H7Z B;  1M9Z A;  2K3G A;  1NEA A;  1H0J A;  1CTX A;  1NYU A;  3PLC A;  1IDI A;  2I9B E;  2GOO B;  3BT1 U;  1KL8 A;  3EBX A;  2PJY C;  1IKC A;  1UG4 A;  2QJB C;  1LXG A;  2H62 D;  1HC9 A;  1VB0 A;  2JQP A;  1DRS A;  1NXB A;  1KC4 A;  2MUP A;  1CXN A;  1ERG A;  1TXA A;  4ZQY A;  5IMY C;  3NDS A;  2ERA A;  1IQ9 A;  1W6B A;  3HH7 A;  1NOR A;  3QB4 B;  5EBX A;  1ZAD A;  4AEA A;  1CDQ A;  2GOO C;  2X8B B;  1LSI A;  2J8B A;  2FD6 U;  2H8U A;  1FRA A;  1CVO A;  1IDH A;  1NTX A;  1IDL A;  1RL5 A;  1QKD A;  1CDT A;  1ONJ A;  1S4Y A;  2VLW A;  1BXP A;  1I02 A;  1NYS A;  2H64 B;  2LCR A;  3KFD I;  1LXH A;  2MJ4 A;  1RGJ A;  3U74 U;  2MJY A;  1KU6 B;  4XJJ A;  4FAO E;  1FF4 A;  3LAQ U;  2MFA A;  5DZ5 A;  4OM5 A;  1ABT A;  2BTX A;  2H64 C;  1IK8 A;  1CDR A;  1BTE A;  1FSC A;  1KBA A;  4HQP F;  5DO6 A;  2MUO A;  1KFH A;  2H5F A;  1FAS A;  1FSS B;  2LA1 A;  4QTI U;  2CRS A;  2ABX A;  4FAO C;  3NH7 A;  2HLQ A;  2QC1 A;  4LFT A;  2H7Z A;  5DU1 A;  6EBX A;  1B41 B;  2JVE A;  3KFD E;  1V6P A;  1HOY A;  1CHV S;  1HC9 B;  2QJ9 C;  1KBT A;  1CXO A;  1NTN A;  1HAA A;  1YWH A;  1G6M A;  2BHI A;  1CB9 A;  1TXB A;  2QJA C;  4EY8 B;  2UWR A;  1CDS A;  2CDX A;  4IYE A;  1LX5 B;  1REW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...