1DRSA

Three-dimensional structure of the rgd-containing neurotoxin homologue, dendroaspin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
RICYNHLGTKPPTTETCQEDSCYKNIWTFDNIIRRGCGCFTPRGDMPGPYCCESDKCNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion protein
molecule keywords DENDROASPIN
publication title Three-dimensional structure of the RGD-containing neurotoxin homologue dendroaspin.
pubmed doi rcsb
source organism Dendroaspis jamesoni kaimosae
total genus 12
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1994-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1drsA00
1RL5A 1HAAA 2MUOA 1FSSB 1KBAA 1LSIA 2ABXA 3U73U 3ERAA 2MUPA 1IK8A 1ES7B 1F94A 1HC9A 3NDSA 1QM7A 1HC9B 1FF4A 3QB4B 2QJBC 1IQ9A 4FAOE 1KU6B 1CXOA 1UG4A 3EVSC 4LFTA 1F8UB 1DRSA 1CB9A 3HH7A 1ZADA 2CRSA 1FSCA 2PJYB 3NH7A 1XT3A 2H62C 1FFJA 1MR6A 3KFDI 2H64B 1S4YA 1HOYA 2MFAA 1NYSA 4OM5A 3U74U 1CODA 4DO8A 4IYEA 1TXAA 1NTNA 5IMTD 4QTIU 1LXHA 1JBDA 2UX2A 1QKEA 1W6BA 1ERGA 2L5SA 4OM4A 4UY2C 2K3GA 1CTXA 2CRTA 2MJ0A 4EY8B 2UWRA 5IMYC 2ERAA 1CDTA 1I02A 1PLOA 1CDSA 1H0JA 1CCQA 1ONJA 2X8BB 1NYUA 5DO6A 1LX5B 2NBTA 3FEVA 1BTEA 1NTXA 3LAQU 3VTSA 1KBTA 1JE9A 2VLWA 2GOOB 1NXBA 2MHYA 1V6PA 4FAOC 1ERAA 4BIKB 1LJZA 2H62D 1REWC 1TXBA 1CXNA 2N99A 2I9BE 1MAHF 2L03A 2LA1A 2BTXA 1IDHA 1G6MA 2QJAC 2OFSA 2JVEA 1KTZB 1TFSA 4XJJA 1JGKA 1CREA 2FD6U 4ZQYA 1BXPA 1QKDA 4HQPF 1IKCA 3KFDE 2JQPA 2HLQA 1KFHA 2QJ9C 1IJCA 2PJYC 6EBXA 3EBXA 4AEAA 2J8BA 1HAJA 1CVOA 5DZ5A 2H64C 3PLCA 1KS6A 2MJYA 1IDLA 5EBXA 1RGJA 3BT2U 1VB0A 1CDRA 1TGXA 1NEAA 1IDGA 1B41B 1KC4A 2CCXA 2CTXA 4P7UA 1FRAA 1IDIA 2MJ4A 1FASA 2BHIA 3BT1U 4BDTB 1YWHA 1CHVS 1KL8A 2H5FA 1CRFA 2H8UA 2H7ZA 2H7ZB 2HLRA 2CDXA 1KXIA 1M9ZA 1NORA 3NEQA 1ABTA 1LXGA 1KBSA 2GOOC 2QC1A 1COEA 1L4WA 2LCRA 5DU1A 4RUDA 1CDQA
chains in the Genus database with same CATH superfamily
1RL5A 1HAAA 2MUOA 1FSSB 1KBAA 1LSIA 2ABXA 3U73U 3ERAA 2MUPA 1IK8A 1ES7B 1F94A 1HC9A 3NDSA 1QM7A 1HC9B 1FF4A 3QB4B 2QJBC 1IQ9A 4FAOE 1KU6B 1CXOA 1UG4A 3EVSC 4LFTA 1F8UB 1DRSA 1CB9A 3HH7A 1ZADA 2CRSA 1FSCA 2PJYB 3NH7A 1XT3A 2H62C 1FFJA 1MR6A 3KFDI 2H64B 1S4YA 1HOYA 2MFAA 1NYSA 4OM5A 3U74U 1CODA 4KSNA 4DO8A 4IYEA 1TXAA 1NTNA 5IMTD 4QTIU 1LXHA 1JBDA 2UX2A 1QKEA 1W6BA 1ERGA 2L5SA 4OM4A 4UY2C 2K3GA 1CTXA 2CRTA 2MJ0A 4EY8B 2UWRA 5IMYC 2ERAA 1CDTA 1I02A 1PLOA 1CDSA 1H0JA 1CCQA 1ONJA 2X8BB 1NYUA 5DO6A 1LX5B 2NBTA 3FEVA 1BTEA 1NTXA 3LAQU 3VTSA 1KBTA 1JE9A 2VLWA 2GOOB 1NXBA 2MHYA 1V6PA 4FAOC 1ERAA 4BIKB 1LJZA 2H62D 1REWC 1TXBA 1CXNA 2N99A 2I9BE 1MAHF 2L03A 2LA1A 2BTXA 1IDHA 1G6MA 2QJAC 2OFSA 2JVEA 1KTZB 1TFSA 4XJJA 1JGKA 1CREA 2FD6U 4ZQYA 1BXPA 1QKDA 4HQPF 1IKCA 3KFDE 2JQPA 2HLQA 1KFHA 2QJ9C 1IJCA 2PJYC 6EBXA 3EBXA 4AEAA 2J8BA 1HAJA 1CVOA 5DZ5A 2H64C 3PLCA 1KS6A 2MJYA 1IDLA 5EBXA 1RGJA 3BT2U 1VB0A 1CDRA 1TGXA 1NEAA 1IDGA 1B41B 1KC4A 2CCXA 2CTXA 4P7UA 1FRAA 1IDIA 2MJ4A 1FASA 2BHIA 3BT1U 4BDTB 1YWHA 1CHVS 1KL8A 2H5FA 1CRFA 2H8UA 2H7ZA 2H7ZB 2HLRA 2CDXA 1KXIA 1M9ZA 1NORA 3NEQA 1ABTA 1LXGA 1KBSA 2GOOC 2QC1A 1COEA 1L4WA 2LCRA 5DU1A 4RUDA 1CDQA
chains in the Genus database with same CATH topology
1RL5A 1HAAA 2MUOA 1FSSB 1KBAA 1LSIA 2ABXA 3U73U 3ERAA 2MUPA 1IK8A 1ES7B 1F94A 1HC9A 3NDSA 1QM7A 1HC9B 1FF4A 3QB4B 2QJBC 1IQ9A 4FAOE 1KU6B 1CXOA 1UG4A 3EVSC 4LFTA 1F8UB 1DRSA 1CB9A 3HH7A 1ZADA 2CRSA 1FSCA 2PJYB 3NH7A 1XT3A 2H62C 1FFJA 1MR6A 3KFDI 2H64B 1S4YA 1HOYA 2MFAA 1NYSA 4OM5A 3U74U 1CODA 4KSNA 4DO8A 4IYEA 1TXAA 1NTNA 5IMTD 4QTIU 1LXHA 1JBDA 2UX2A 1QKEA 1W6BA 1ERGA 2L5SA 4OM4A 4UY2C 2K3GA 1CTXA 2CRTA 2MJ0A 4EY8B 2UWRA 5IMYC 2ERAA 1CDTA 1I02A 1PLOA 1CDSA 1H0JA 1CCQA 1ONJA 2X8BB 1NYUA 5DO6A 1LX5B 2NBTA 3FEVA 1BTEA 1NTXA 3LAQU 3VTSA 1KBTA 1JE9A 2VLWA 2GOOB 1NXBA 2MHYA 1V6PA 4FAOC 1ERAA 4BIKB 1LJZA 2H62D 1REWC 1TXBA 1CXNA 2N99A 2I9BE 1MAHF 2L03A 2LA1A 2BTXA 1IDHA 1G6MA 2QJAC 2OFSA 2JVEA 1KTZB 1TFSA 4XJJA 1JGKA 1CREA 2FD6U 4ZQYA 1BXPA 1QKDA 4HQPF 1IKCA 3KFDE 2JQPA 2HLQA 1KFHA 2QJ9C 1IJCA 2PJYC 6EBXA 3EBXA 4AEAA 2J8BA 1HAJA 1CVOA 5DZ5A 2H64C 3PLCA 1KS6A 2MJYA 1IDLA 5EBXA 1RGJA 3BT2U 1VB0A 1CDRA 1TGXA 1NEAA 1IDGA 1B41B 1KC4A 2CCXA 2CTXA 4P7UA 1FRAA 1IDIA 2MJ4A 1FASA 2BHIA 3BT1U 4BDTB 1YWHA 1CHVS 1KL8A 2H5FA 1CRFA 2H8UA 2H7ZA 2H7ZB 2HLRA 2CDXA 1KXIA 1M9ZA 1NORA 3NEQA 1ABTA 1LXGA 1KBSA 2GOOC 2QC1A 1COEA 1L4WA 2LCRA 5DU1A 4RUDA 1CDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RL5 A;  1HAA A;  2MUO A;  1FSS B;  1KBA A;  1LSI A;  2ABX A;  3U73 U;  3ERA A;  2MUP A;  1IK8 A;  1ES7 B;  1F94 A;  1HC9 A;  3NDS A;  1QM7 A;  1HC9 B;  1FF4 A;  3QB4 B;  2QJB C;  1IQ9 A;  4FAO E;  1KU6 B;  1CXO A;  1UG4 A;  3EVS C;  4LFT A;  1F8U B;  1DRS A;  1CB9 A;  3HH7 A;  1ZAD A;  2CRS A;  1FSC A;  2PJY B;  3NH7 A;  1XT3 A;  2H62 C;  1FFJ A;  1MR6 A;  3KFD I;  2H64 B;  1S4Y A;  1HOY A;  2MFA A;  1NYS A;  4OM5 A;  3U74 U;  1COD A;  4DO8 A;  4IYE A;  1TXA A;  1NTN A;  5IMT D;  4QTI U;  1LXH A;  1JBD A;  2UX2 A;  1QKE A;  1W6B A;  1ERG A;  2L5S A;  4OM4 A;  4UY2 C;  2K3G A;  1CTX A;  2CRT A;  2MJ0 A;  4EY8 B;  2UWR A;  5IMY C;  2ERA A;  1CDT A;  1I02 A;  1PLO A;  1CDS A;  1H0J A;  1CCQ A;  1ONJ A;  2X8B B;  1NYU A;  5DO6 A;  1LX5 B;  2NBT A;  3FEV A;  1BTE A;  1NTX A;  3LAQ U;  3VTS A;  1KBT A;  1JE9 A;  2VLW A;  2GOO B;  1NXB A;  2MHY A;  1V6P A;  4FAO C;  1ERA A;  4BIK B;  1LJZ A;  2H62 D;  1REW C;  1TXB A;  1CXN A;  2N99 A;  2I9B E;  1MAH F;  2L03 A;  2LA1 A;  2BTX A;  1IDH A;  1G6M A;  2QJA C;  2OFS A;  2JVE A;  1KTZ B;  1TFS A;  4XJJ A;  1JGK A;  1CRE A;  2FD6 U;  4ZQY A;  1BXP A;  1QKD A;  4HQP F;  1IKC A;  3KFD E;  2JQP A;  2HLQ A;  1KFH A;  2QJ9 C;  1IJC A;  2PJY C;  6EBX A;  3EBX A;  4AEA A;  2J8B A;  1HAJ A;  1CVO A;  5DZ5 A;  2H64 C;  3PLC A;  1KS6 A;  2MJY A;  1IDL A;  5EBX A;  1RGJ A;  3BT2 U;  1VB0 A;  1CDR A;  1TGX A;  1NEA A;  1IDG A;  1B41 B;  1KC4 A;  2CCX A;  2CTX A;  4P7U A;  1FRA A;  1IDI A;  2MJ4 A;  1FAS A;  2BHI A;  3BT1 U;  4BDT B;  1YWH A;  1CHV S;  1KL8 A;  2H5F A;  1CRF A;  2H8U A;  2H7Z A;  2H7Z B;  2HLR A;  2CDX A;  1KXI A;  1M9Z A;  1NOR A;  3NEQ A;  1ABT A;  1LXG A;  1KBS A;  2GOO C;  2QC1 A;  1COE A;  1L4W A;  2LCR A;  5DU1 A;  4RUD A;  1CDQ A; 
#chains in the Genus database with same CATH topology
 1RL5 A;  1HAA A;  2MUO A;  1FSS B;  1KBA A;  1LSI A;  2ABX A;  3U73 U;  3ERA A;  2MUP A;  1IK8 A;  1ES7 B;  1F94 A;  1HC9 A;  3NDS A;  1QM7 A;  1HC9 B;  1FF4 A;  3QB4 B;  2QJB C;  1IQ9 A;  4FAO E;  1KU6 B;  1CXO A;  1UG4 A;  3EVS C;  4LFT A;  1F8U B;  1DRS A;  1CB9 A;  3HH7 A;  1ZAD A;  2CRS A;  1FSC A;  2PJY B;  3NH7 A;  1XT3 A;  2H62 C;  1FFJ A;  1MR6 A;  3KFD I;  2H64 B;  1S4Y A;  1HOY A;  2MFA A;  1NYS A;  4OM5 A;  3U74 U;  1COD A;  4KSN A;  4DO8 A;  4IYE A;  1TXA A;  1NTN A;  5IMT D;  4QTI U;  1LXH A;  1JBD A;  2UX2 A;  1QKE A;  1W6B A;  1ERG A;  2L5S A;  4OM4 A;  4UY2 C;  2K3G A;  1CTX A;  2CRT A;  2MJ0 A;  4EY8 B;  2UWR A;  5IMY C;  2ERA A;  1CDT A;  1I02 A;  1PLO A;  1CDS A;  1H0J A;  1CCQ A;  1ONJ A;  2X8B B;  1NYU A;  5DO6 A;  1LX5 B;  2NBT A;  3FEV A;  1BTE A;  1NTX A;  3LAQ U;  3VTS A;  1KBT A;  1JE9 A;  2VLW A;  2GOO B;  1NXB A;  2MHY A;  1V6P A;  4FAO C;  1ERA A;  4BIK B;  1LJZ A;  2H62 D;  1REW C;  1TXB A;  1CXN A;  2N99 A;  2I9B E;  1MAH F;  2L03 A;  2LA1 A;  2BTX A;  1IDH A;  1G6M A;  2QJA C;  2OFS A;  2JVE A;  1KTZ B;  1TFS A;  4XJJ A;  1JGK A;  1CRE A;  2FD6 U;  4ZQY A;  1BXP A;  1QKD A;  4HQP F;  1IKC A;  3KFD E;  2JQP A;  2HLQ A;  1KFH A;  2QJ9 C;  1IJC A;  2PJY C;  6EBX A;  3EBX A;  4AEA A;  2J8B A;  1HAJ A;  1CVO A;  5DZ5 A;  2H64 C;  3PLC A;  1KS6 A;  2MJY A;  1IDL A;  5EBX A;  1RGJ A;  3BT2 U;  1VB0 A;  1CDR A;  1TGX A;  1NEA A;  1IDG A;  1B41 B;  1KC4 A;  2CCX A;  2CTX A;  4P7U A;  1FRA A;  1IDI A;  2MJ4 A;  1FAS A;  2BHI A;  3BT1 U;  4BDT B;  1YWH A;  1CHV S;  1KL8 A;  2H5F A;  1CRF A;  2H8U A;  2H7Z A;  2H7Z B;  2HLR A;  2CDX A;  1KXI A;  1M9Z A;  1NOR A;  3NEQ A;  1ABT A;  1LXG A;  1KBS A;  2GOO C;  2QC1 A;  1COE A;  1L4W A;  2LCR A;  5DU1 A;  4RUD A;  1CDQ A; 
#chains in the Genus database with same CATH homology
 1RL5 A;  1HAA A;  2MUO A;  1FSS B;  1KBA A;  1LSI A;  2ABX A;  3U73 U;  3ERA A;  2MUP A;  1IK8 A;  1ES7 B;  1F94 A;  1HC9 A;  3NDS A;  1QM7 A;  1HC9 B;  1FF4 A;  3QB4 B;  2QJB C;  1IQ9 A;  4FAO E;  1KU6 B;  1CXO A;  1UG4 A;  3EVS C;  4LFT A;  1F8U B;  1DRS A;  1CB9 A;  3HH7 A;  1ZAD A;  2CRS A;  1FSC A;  2PJY B;  3NH7 A;  1XT3 A;  2H62 C;  1FFJ A;  1MR6 A;  3KFD I;  2H64 B;  1S4Y A;  1HOY A;  2MFA A;  1NYS A;  4OM5 A;  3U74 U;  1COD A;  4KSN A;  4DO8 A;  4IYE A;  1TXA A;  1NTN A;  5IMT D;  4QTI U;  1LXH A;  1JBD A;  2UX2 A;  1QKE A;  1W6B A;  1ERG A;  2L5S A;  4OM4 A;  4UY2 C;  2K3G A;  1CTX A;  2CRT A;  2MJ0 A;  4EY8 B;  2UWR A;  5IMY C;  2ERA A;  1CDT A;  1I02 A;  1PLO A;  1CDS A;  1H0J A;  1CCQ A;  1ONJ A;  2X8B B;  1NYU A;  5DO6 A;  1LX5 B;  2NBT A;  3FEV A;  1BTE A;  1NTX A;  3LAQ U;  3VTS A;  1KBT A;  1JE9 A;  2VLW A;  2GOO B;  1NXB A;  2MHY A;  1V6P A;  4FAO C;  1ERA A;  4BIK B;  1LJZ A;  2H62 D;  1REW C;  1TXB A;  1CXN A;  2N99 A;  2I9B E;  1MAH F;  2L03 A;  2LA1 A;  2BTX A;  1IDH A;  1G6M A;  2QJA C;  2OFS A;  2JVE A;  1KTZ B;  1TFS A;  4XJJ A;  1JGK A;  1CRE A;  2FD6 U;  4ZQY A;  1BXP A;  1QKD A;  4HQP F;  1IKC A;  3KFD E;  2JQP A;  2HLQ A;  1KFH A;  2QJ9 C;  1IJC A;  2PJY C;  6EBX A;  3EBX A;  4AEA A;  2J8B A;  1HAJ A;  1CVO A;  5DZ5 A;  2H64 C;  3PLC A;  1KS6 A;  2MJY A;  1IDL A;  5EBX A;  1RGJ A;  3BT2 U;  1VB0 A;  1CDR A;  1TGX A;  1NEA A;  1IDG A;  1B41 B;  1KC4 A;  2CCX A;  2CTX A;  4P7U A;  1FRA A;  1IDI A;  2MJ4 A;  1FAS A;  2BHI A;  3BT1 U;  4BDT B;  1YWH A;  1CHV S;  1KL8 A;  2H5F A;  1CRF A;  2H8U A;  2H7Z A;  2H7Z B;  2HLR A;  2CDX A;  1KXI A;  1M9Z A;  1NOR A;  3NEQ A;  1ABT A;  1LXG A;  1KBS A;  2GOO C;  2QC1 A;  1COE A;  1L4W A;  2LCR A;  5DU1 A;  4RUD A;  1CDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...