1DRSA

Three-dimensional structure of the rgd-containing neurotoxin homologue, dendroaspin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
RICYNHLGTKPPTTETCQEDSCYKNIWTFDNIIRRGCGCFTPRGDMPGPYCCESDKCNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DENDROASPIN
publication title Three-dimensional structure of the RGD-containing neurotoxin homologue dendroaspin.
pubmed doi rcsb
source organism Dendroaspis jamesoni kaimosae
molecule tags Cell adhesion protein
total genus 12
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1994-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1drsA00
1KL8A 3BT1U 2NBTA 1IK8A 5DU1A 1F8UB 1ZADA 1V6PA 1NORA 2CRTA 1I02A 2QJAC 4DO8A 1KBTA 1LSIA 1CDQA 1M9ZA 1NTNA 2JVEA 2MUPA 4XJJA 1G6MA 2QC1A 2H62D 2JQPA 4ZQYA 3HH7A 2CTXA 2MJYA 5DO6A 1CDRA 1IQ9A 1IDIA 1DRSA 1FASA 2PJYB 1CODA 1F94A 1LXHA 4AEAA 1HAJA 1L4WA 4HQPF 2UWRA 2H8UA 1IJCA 2MFAA 1REWC 2QJ9C 2QJBC 2X8BB 1PLOA 1IDGA 3EBXA 4P7UA 1CB9A 1KXIA 1IKCA 3KFDI 2N99A 1KC4A 1TGXA 1KBAA 1KU6B 1JE9A 1FF4A 2MJ0A 1NYUA 1UG4A 3ERAA 1KTZB 1LXGA 1CRFA 1FSSB 1TXAA 3NDSA 1NYSA 2HLQA 1NXBA 2FD6U 1H0JA 2L5SA 2CRSA 4OM4A 1B41B 2MHYA 1CDSA 4BDTB 1JBDA 4EY8B 6EBXA 2H5FA 1IDHA 5EBXA 1LJZA 4FAOE 1QKDA 3FEVA 3EVSC 2H64C 1CREA 1NEAA 4IYEA 1CVOA 1CTXA 1TFSA 1FSCA 2L03A 3PLCA 3U73U 3VTSA 1HOYA 3KFDE 1RGJA 1LX5B 1CXNA 2BTXA 1KFHA 1BXPA 1W6BA 1IDLA 3BT2U 2CCXA 4BIKB 2H7ZA 1ES7B 2K3GA 1CHVS 2H62C 4UY2C 1RL5A 1TXBA 2GOOC 3QB4B 3U74U 5IMTD 1QM7A 2MUOA 1YWHA 1XT3A 1ERGA 4OM5A 1HC9B 1ONJA 2H7ZB 2ERAA 1CCQA 2LCRA 1VB0A 2UX2A 1CXOA 3NH7A 4RUDA 1FRAA 2LA1A 2CDXA 5DZ5A 2GOOB 1MR6A 1JGKA 1BTEA 1ERAA 2PJYC 2OFSA 1COEA 2ABXA 2J8BA 2HLRA 2MJ4A 1NTXA 3NEQA 1KS6A 1KBSA 2BHIA 1FFJA 1HAAA 2H64B 2I9BE 1CDTA 4LFTA 1HC9A 1MAHF 4QTIU 5IMYC 1S4YA 4FAOC 1ABTA 2VLWA 1QKEA 3LAQU
chains in the Genus database with same CATH superfamily
1KL8A 3BT1U 2NBTA 1IK8A 5DU1A 1F8UB 1ZADA 1V6PA 1NORA 2CRTA 1I02A 2QJAC 4DO8A 1KBTA 1LSIA 1CDQA 1M9ZA 1NTNA 2JVEA 2MUPA 4XJJA 1G6MA 2QC1A 2H62D 2JQPA 4ZQYA 3HH7A 2CTXA 2MJYA 5DO6A 1CDRA 1IQ9A 1IDIA 1DRSA 1FASA 2PJYB 1CODA 1F94A 1LXHA 4AEAA 1HAJA 1L4WA 4HQPF 2UWRA 2H8UA 1IJCA 2MFAA 4KSNA 1REWC 2QJ9C 2QJBC 2X8BB 1PLOA 1IDGA 3EBXA 4P7UA 1CB9A 1KXIA 1IKCA 3KFDI 2N99A 1KC4A 1TGXA 1KBAA 1KU6B 1JE9A 1FF4A 2MJ0A 1NYUA 1UG4A 3ERAA 1KTZB 1LXGA 1CRFA 1FSSB 1TXAA 3NDSA 1NYSA 2HLQA 1NXBA 2FD6U 1H0JA 2L5SA 2CRSA 4OM4A 1B41B 2MHYA 1CDSA 4BDTB 1JBDA 4EY8B 6EBXA 2H5FA 1IDHA 5EBXA 1LJZA 4FAOE 1QKDA 3FEVA 3EVSC 2H64C 1CREA 1NEAA 4IYEA 1CVOA 1CTXA 1TFSA 1FSCA 2L03A 3PLCA 3U73U 3VTSA 1HOYA 3KFDE 1RGJA 1LX5B 1CXNA 2BTXA 1KFHA 1BXPA 1W6BA 1IDLA 3BT2U 2CCXA 4BIKB 2H7ZA 1ES7B 2K3GA 1CHVS 2H62C 4UY2C 1RL5A 1TXBA 2GOOC 3QB4B 3U74U 5IMTD 1QM7A 2MUOA 1YWHA 1XT3A 1ERGA 4OM5A 1HC9B 1ONJA 2H7ZB 2ERAA 1CCQA 2LCRA 1VB0A 2UX2A 1CXOA 3NH7A 4RUDA 1FRAA 2LA1A 2CDXA 5DZ5A 2GOOB 1MR6A 1JGKA 1BTEA 1ERAA 2PJYC 2OFSA 1COEA 2ABXA 2J8BA 2HLRA 2MJ4A 1NTXA 3NEQA 1KS6A 1KBSA 2BHIA 1FFJA 1HAAA 2H64B 2I9BE 1CDTA 4LFTA 1HC9A 1MAHF 4QTIU 5IMYC 1S4YA 4FAOC 1ABTA 2VLWA 1QKEA 3LAQU
chains in the Genus database with same CATH topology
1KL8A 3BT1U 2NBTA 1IK8A 5DU1A 1F8UB 1ZADA 1V6PA 1NORA 2CRTA 1I02A 2QJAC 4DO8A 1KBTA 1LSIA 1CDQA 1M9ZA 1NTNA 2JVEA 2MUPA 4XJJA 1G6MA 2QC1A 2H62D 2JQPA 4ZQYA 3HH7A 2CTXA 2MJYA 5DO6A 1CDRA 1IQ9A 1IDIA 1DRSA 1FASA 2PJYB 1CODA 1F94A 1LXHA 4AEAA 1HAJA 1L4WA 4HQPF 2UWRA 2H8UA 1IJCA 2MFAA 4KSNA 1REWC 2QJ9C 2QJBC 2X8BB 1PLOA 1IDGA 3EBXA 4P7UA 1CB9A 1KXIA 1IKCA 3KFDI 2N99A 1KC4A 1TGXA 1KBAA 1KU6B 1JE9A 1FF4A 2MJ0A 1NYUA 1UG4A 3ERAA 1KTZB 1LXGA 1CRFA 1FSSB 1TXAA 3NDSA 1NYSA 2HLQA 1NXBA 2FD6U 1H0JA 2L5SA 2CRSA 4OM4A 1B41B 2MHYA 1CDSA 4BDTB 1JBDA 4EY8B 6EBXA 2H5FA 1IDHA 5EBXA 1LJZA 4FAOE 1QKDA 3FEVA 3EVSC 2H64C 1CREA 1NEAA 4IYEA 1CVOA 1CTXA 1TFSA 1FSCA 2L03A 3PLCA 3U73U 3VTSA 1HOYA 3KFDE 1RGJA 1LX5B 1CXNA 2BTXA 1KFHA 1BXPA 1W6BA 1IDLA 3BT2U 2CCXA 4BIKB 2H7ZA 1ES7B 2K3GA 1CHVS 2H62C 4UY2C 1RL5A 1TXBA 2GOOC 3QB4B 3U74U 5IMTD 1QM7A 2MUOA 1YWHA 1XT3A 1ERGA 4OM5A 1HC9B 1ONJA 2H7ZB 2ERAA 1CCQA 2LCRA 1VB0A 2UX2A 1CXOA 3NH7A 4RUDA 1FRAA 2LA1A 2CDXA 5DZ5A 2GOOB 1MR6A 1JGKA 1BTEA 1ERAA 2PJYC 2OFSA 1COEA 2ABXA 2J8BA 2HLRA 2MJ4A 1NTXA 3NEQA 1KS6A 1KBSA 2BHIA 1FFJA 1HAAA 2H64B 2I9BE 1CDTA 4LFTA 1HC9A 1MAHF 4QTIU 5IMYC 1S4YA 4FAOC 1ABTA 2VLWA 1QKEA 3LAQU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KL8 A;  3BT1 U;  2NBT A;  1IK8 A;  5DU1 A;  1F8U B;  1ZAD A;  1V6P A;  1NOR A;  2CRT A;  1I02 A;  2QJA C;  4DO8 A;  1KBT A;  1LSI A;  1CDQ A;  1M9Z A;  1NTN A;  2JVE A;  2MUP A;  4XJJ A;  1G6M A;  2QC1 A;  2H62 D;  2JQP A;  4ZQY A;  3HH7 A;  2CTX A;  2MJY A;  5DO6 A;  1CDR A;  1IQ9 A;  1IDI A;  1DRS A;  1FAS A;  2PJY B;  1COD A;  1F94 A;  1LXH A;  4AEA A;  1HAJ A;  1L4W A;  4HQP F;  2UWR A;  2H8U A;  1IJC A;  2MFA A;  1REW C;  2QJ9 C;  2QJB C;  2X8B B;  1PLO A;  1IDG A;  3EBX A;  4P7U A;  1CB9 A;  1KXI A;  1IKC A;  3KFD I;  2N99 A;  1KC4 A;  1TGX A;  1KBA A;  1KU6 B;  1JE9 A;  1FF4 A;  2MJ0 A;  1NYU A;  1UG4 A;  3ERA A;  1KTZ B;  1LXG A;  1CRF A;  1FSS B;  1TXA A;  3NDS A;  1NYS A;  2HLQ A;  1NXB A;  2FD6 U;  1H0J A;  2L5S A;  2CRS A;  4OM4 A;  1B41 B;  2MHY A;  1CDS A;  4BDT B;  1JBD A;  4EY8 B;  6EBX A;  2H5F A;  1IDH A;  5EBX A;  1LJZ A;  4FAO E;  1QKD A;  3FEV A;  3EVS C;  2H64 C;  1CRE A;  1NEA A;  4IYE A;  1CVO A;  1CTX A;  1TFS A;  1FSC A;  2L03 A;  3PLC A;  3U73 U;  3VTS A;  1HOY A;  3KFD E;  1RGJ A;  1LX5 B;  1CXN A;  2BTX A;  1KFH A;  1BXP A;  1W6B A;  1IDL A;  3BT2 U;  2CCX A;  4BIK B;  2H7Z A;  1ES7 B;  2K3G A;  1CHV S;  2H62 C;  4UY2 C;  1RL5 A;  1TXB A;  2GOO C;  3QB4 B;  3U74 U;  5IMT D;  1QM7 A;  2MUO A;  1YWH A;  1XT3 A;  1ERG A;  4OM5 A;  1HC9 B;  1ONJ A;  2H7Z B;  2ERA A;  1CCQ A;  2LCR A;  1VB0 A;  2UX2 A;  1CXO A;  3NH7 A;  4RUD A;  1FRA A;  2LA1 A;  2CDX A;  5DZ5 A;  2GOO B;  1MR6 A;  1JGK A;  1BTE A;  1ERA A;  2PJY C;  2OFS A;  1COE A;  2ABX A;  2J8B A;  2HLR A;  2MJ4 A;  1NTX A;  3NEQ A;  1KS6 A;  1KBS A;  2BHI A;  1FFJ A;  1HAA A;  2H64 B;  2I9B E;  1CDT A;  4LFT A;  1HC9 A;  1MAH F;  4QTI U;  5IMY C;  1S4Y A;  4FAO C;  1ABT A;  2VLW A;  1QKE A;  3LAQ U; 
#chains in the Genus database with same CATH topology
 1KL8 A;  3BT1 U;  2NBT A;  1IK8 A;  5DU1 A;  1F8U B;  1ZAD A;  1V6P A;  1NOR A;  2CRT A;  1I02 A;  2QJA C;  4DO8 A;  1KBT A;  1LSI A;  1CDQ A;  1M9Z A;  1NTN A;  2JVE A;  2MUP A;  4XJJ A;  1G6M A;  2QC1 A;  2H62 D;  2JQP A;  4ZQY A;  3HH7 A;  2CTX A;  2MJY A;  5DO6 A;  1CDR A;  1IQ9 A;  1IDI A;  1DRS A;  1FAS A;  2PJY B;  1COD A;  1F94 A;  1LXH A;  4AEA A;  1HAJ A;  1L4W A;  4HQP F;  2UWR A;  2H8U A;  1IJC A;  2MFA A;  4KSN A;  1REW C;  2QJ9 C;  2QJB C;  2X8B B;  1PLO A;  1IDG A;  3EBX A;  4P7U A;  1CB9 A;  1KXI A;  1IKC A;  3KFD I;  2N99 A;  1KC4 A;  1TGX A;  1KBA A;  1KU6 B;  1JE9 A;  1FF4 A;  2MJ0 A;  1NYU A;  1UG4 A;  3ERA A;  1KTZ B;  1LXG A;  1CRF A;  1FSS B;  1TXA A;  3NDS A;  1NYS A;  2HLQ A;  1NXB A;  2FD6 U;  1H0J A;  2L5S A;  2CRS A;  4OM4 A;  1B41 B;  2MHY A;  1CDS A;  4BDT B;  1JBD A;  4EY8 B;  6EBX A;  2H5F A;  1IDH A;  5EBX A;  1LJZ A;  4FAO E;  1QKD A;  3FEV A;  3EVS C;  2H64 C;  1CRE A;  1NEA A;  4IYE A;  1CVO A;  1CTX A;  1TFS A;  1FSC A;  2L03 A;  3PLC A;  3U73 U;  3VTS A;  1HOY A;  3KFD E;  1RGJ A;  1LX5 B;  1CXN A;  2BTX A;  1KFH A;  1BXP A;  1W6B A;  1IDL A;  3BT2 U;  2CCX A;  4BIK B;  2H7Z A;  1ES7 B;  2K3G A;  1CHV S;  2H62 C;  4UY2 C;  1RL5 A;  1TXB A;  2GOO C;  3QB4 B;  3U74 U;  5IMT D;  1QM7 A;  2MUO A;  1YWH A;  1XT3 A;  1ERG A;  4OM5 A;  1HC9 B;  1ONJ A;  2H7Z B;  2ERA A;  1CCQ A;  2LCR A;  1VB0 A;  2UX2 A;  1CXO A;  3NH7 A;  4RUD A;  1FRA A;  2LA1 A;  2CDX A;  5DZ5 A;  2GOO B;  1MR6 A;  1JGK A;  1BTE A;  1ERA A;  2PJY C;  2OFS A;  1COE A;  2ABX A;  2J8B A;  2HLR A;  2MJ4 A;  1NTX A;  3NEQ A;  1KS6 A;  1KBS A;  2BHI A;  1FFJ A;  1HAA A;  2H64 B;  2I9B E;  1CDT A;  4LFT A;  1HC9 A;  1MAH F;  4QTI U;  5IMY C;  1S4Y A;  4FAO C;  1ABT A;  2VLW A;  1QKE A;  3LAQ U; 
#chains in the Genus database with same CATH homology
 1KL8 A;  3BT1 U;  2NBT A;  1IK8 A;  5DU1 A;  1F8U B;  1ZAD A;  1V6P A;  1NOR A;  2CRT A;  1I02 A;  2QJA C;  4DO8 A;  1KBT A;  1LSI A;  1CDQ A;  1M9Z A;  1NTN A;  2JVE A;  2MUP A;  4XJJ A;  1G6M A;  2QC1 A;  2H62 D;  2JQP A;  4ZQY A;  3HH7 A;  2CTX A;  2MJY A;  5DO6 A;  1CDR A;  1IQ9 A;  1IDI A;  1DRS A;  1FAS A;  2PJY B;  1COD A;  1F94 A;  1LXH A;  4AEA A;  1HAJ A;  1L4W A;  4HQP F;  2UWR A;  2H8U A;  1IJC A;  2MFA A;  4KSN A;  1REW C;  2QJ9 C;  2QJB C;  2X8B B;  1PLO A;  1IDG A;  3EBX A;  4P7U A;  1CB9 A;  1KXI A;  1IKC A;  3KFD I;  2N99 A;  1KC4 A;  1TGX A;  1KBA A;  1KU6 B;  1JE9 A;  1FF4 A;  2MJ0 A;  1NYU A;  1UG4 A;  3ERA A;  1KTZ B;  1LXG A;  1CRF A;  1FSS B;  1TXA A;  3NDS A;  1NYS A;  2HLQ A;  1NXB A;  2FD6 U;  1H0J A;  2L5S A;  2CRS A;  4OM4 A;  1B41 B;  2MHY A;  1CDS A;  4BDT B;  1JBD A;  4EY8 B;  6EBX A;  2H5F A;  1IDH A;  5EBX A;  1LJZ A;  4FAO E;  1QKD A;  3FEV A;  3EVS C;  2H64 C;  1CRE A;  1NEA A;  4IYE A;  1CVO A;  1CTX A;  1TFS A;  1FSC A;  2L03 A;  3PLC A;  3U73 U;  3VTS A;  1HOY A;  3KFD E;  1RGJ A;  1LX5 B;  1CXN A;  2BTX A;  1KFH A;  1BXP A;  1W6B A;  1IDL A;  3BT2 U;  2CCX A;  4BIK B;  2H7Z A;  1ES7 B;  2K3G A;  1CHV S;  2H62 C;  4UY2 C;  1RL5 A;  1TXB A;  2GOO C;  3QB4 B;  3U74 U;  5IMT D;  1QM7 A;  2MUO A;  1YWH A;  1XT3 A;  1ERG A;  4OM5 A;  1HC9 B;  1ONJ A;  2H7Z B;  2ERA A;  1CCQ A;  2LCR A;  1VB0 A;  2UX2 A;  1CXO A;  3NH7 A;  4RUD A;  1FRA A;  2LA1 A;  2CDX A;  5DZ5 A;  2GOO B;  1MR6 A;  1JGK A;  1BTE A;  1ERA A;  2PJY C;  2OFS A;  1COE A;  2ABX A;  2J8B A;  2HLR A;  2MJ4 A;  1NTX A;  3NEQ A;  1KS6 A;  1KBS A;  2BHI A;  1FFJ A;  1HAA A;  2H64 B;  2I9B E;  1CDT A;  4LFT A;  1HC9 A;  1MAH F;  4QTI U;  5IMY C;  1S4Y A;  4FAO C;  1ABT A;  2VLW A;  1QKE A;  3LAQ U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...