4ZQYA

Ringhalexin from hemachatus haemachatus: a novel inhibitor of extrinsic tenase complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
RLCLSDYSIFSETIEICPEGHNYCFKKFPKGITRLPWVIRGCAATCPKPEAQVYVDCCARDKCNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ringhalexin
publication title Ringhalexin from Hemachatus haemachatus: A novel inhibitor of extrinsic tenase complex.
pubmed doi rcsb
molecule tags Toxin
total genus 11
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4zqyA00
4OM5A 1ERAA 1QKEA 2CRTA 1TGXA 5DZ5A 1COEA 1FASA 1HOYA 1TXBA 4DO8A 1CDQA 4QTIU 2H62D 1H0JA 1KL8A 1NTXA 1JE9A 5IMTD 1PLOA 1CB9A 1IDLA 1CDTA 5DU1A 1HC9B 1KXIA 2CCXA 2MJYA 1KS6A 2CTXA 1CXOA 1F8UB 1HAJA 1KBSA 6EBXA 2H8UA 1QM7A 2MJ4A 1CVOA 4BIKB 1JGKA 4EY8B 2ERAA 1FRAA 3NDSA 4P7UA 1IKCA 2MHYA 4RUDA 3EVSC 2CRSA 1CDSA 3LAQU 1G6MA 1FSCA 1IDGA 3BT2U 2UX2A 1V6PA 2N99A 1TXAA 4BDTB 4FAOC 1NYSA 1KBAA 1LXHA 2MFAA 4UY2C 1CCQA 1L4WA 2MUPA 1ERGA 1KC4A 1LXGA 2MJ0A 2HLQA 1HAAA 2PJYB 3NEQA 1CRFA 2X8BB 4FAOE 1I02A 2H64B 1RL5A 1BXPA 2CDXA 2PJYC 4OM4A 1NYUA 1F94A 2JVEA 1W6BA 1YWHA 1LJZA 1S4YA 1CDRA 1MAHF 2K3GA 2LCRA 1CXNA 2FD6U 3U73U 2I9BE 1B41B 3KFDE 2UWRA 2OFSA 1RGJA 2BTXA 1IJCA 1M9ZA 3EBXA 4LFTA 3FEVA 2H7ZA 1FSSB 2H5FA 1REWC 1VB0A 1BTEA 1XT3A 2J8BA 2QC1A 1QKDA 3ERAA 1JBDA 3PLCA 4IYEA 1ZADA 1CTXA 3HH7A 1FFJA 1MR6A 2ABXA 2NBTA 1ES7B 2H64C 1UG4A 1KU6B 4XJJA 2L03A 2H62C 2H7ZB 1CODA 4ZQYA 1LSIA 1IQ9A 2QJBC 1CHVS 3NH7A 2GOOB 3KFDI 3QB4B 1NEAA 3BT1U 3VTSA 4AEAA 2VLWA 1NTNA 1KBTA 1IDIA 1IK8A 2GOOC 3U74U 1TFSA 2BHIA 2QJAC 1ABTA 5IMYC 4HQPF 1CREA 5DO6A 1KTZB 1IDHA 2JQPA 5EBXA 2HLRA 1KFHA 1DRSA 1LX5B 1ONJA 1FF4A 1HC9A 2LA1A 1NXBA 1NORA 2MUOA 2QJ9C 2L5SA
chains in the Genus database with same CATH superfamily
4OM5A 1ERAA 1QKEA 2CRTA 1TGXA 5DZ5A 1COEA 1FASA 1HOYA 1TXBA 4DO8A 1CDQA 4QTIU 2H62D 1H0JA 1KL8A 1NTXA 1JE9A 5IMTD 1PLOA 1CB9A 1IDLA 1CDTA 5DU1A 1HC9B 1KXIA 2CCXA 2MJYA 1KS6A 2CTXA 1CXOA 1F8UB 1HAJA 1KBSA 6EBXA 2H8UA 1QM7A 2MJ4A 1CVOA 4BIKB 1JGKA 4EY8B 2ERAA 1FRAA 3NDSA 4P7UA 1IKCA 2MHYA 4RUDA 3EVSC 2CRSA 1CDSA 3LAQU 1G6MA 1FSCA 1IDGA 3BT2U 2UX2A 1V6PA 2N99A 1TXAA 4BDTB 4FAOC 1NYSA 1KBAA 1LXHA 2MFAA 4UY2C 1CCQA 1L4WA 2MUPA 1ERGA 4KSNA 1LXGA 1KC4A 2MJ0A 2HLQA 1HAAA 2PJYB 3NEQA 1CRFA 2X8BB 4FAOE 1I02A 2H64B 1RL5A 1BXPA 2CDXA 2PJYC 4OM4A 1NYUA 1F94A 2JVEA 1W6BA 1YWHA 1LJZA 1S4YA 1CDRA 1MAHF 2K3GA 2LCRA 1CXNA 2FD6U 3U73U 2I9BE 1B41B 3KFDE 2UWRA 2OFSA 1RGJA 2BTXA 1IJCA 1M9ZA 3EBXA 4LFTA 3FEVA 2H7ZA 1FSSB 2H5FA 1REWC 1VB0A 1BTEA 1XT3A 2J8BA 2QC1A 1QKDA 3ERAA 1JBDA 3PLCA 4IYEA 1ZADA 1CTXA 3HH7A 1FFJA 1MR6A 2ABXA 2NBTA 1ES7B 2H64C 1UG4A 1KU6B 4XJJA 2L03A 2H62C 2H7ZB 1CODA 4ZQYA 1LSIA 1IQ9A 2QJBC 1CHVS 3NH7A 2GOOB 3KFDI 3QB4B 1NEAA 3BT1U 3VTSA 4AEAA 2VLWA 1NTNA 1KBTA 1IDIA 1IK8A 2GOOC 3U74U 1TFSA 2BHIA 2QJAC 1ABTA 5IMYC 4HQPF 1CREA 5DO6A 1KTZB 1IDHA 2JQPA 5EBXA 2HLRA 1KFHA 1DRSA 1LX5B 1ONJA 1FF4A 1HC9A 2LA1A 1NXBA 1NORA 2MUOA 2QJ9C 2L5SA
chains in the Genus database with same CATH topology
4OM5A 1ERAA 1QKEA 2CRTA 1TGXA 5DZ5A 1COEA 1FASA 1HOYA 1TXBA 4DO8A 1CDQA 4QTIU 2H62D 1H0JA 1KL8A 1NTXA 1JE9A 5IMTD 1PLOA 1CB9A 1IDLA 1CDTA 5DU1A 1HC9B 1KXIA 2CCXA 2MJYA 1KS6A 2CTXA 1CXOA 1F8UB 1HAJA 1KBSA 6EBXA 2H8UA 1QM7A 2MJ4A 1CVOA 4BIKB 1JGKA 4EY8B 2ERAA 1FRAA 3NDSA 4P7UA 1IKCA 2MHYA 4RUDA 3EVSC 2CRSA 1CDSA 3LAQU 1G6MA 1FSCA 1IDGA 3BT2U 2UX2A 1V6PA 2N99A 1TXAA 4BDTB 4FAOC 1NYSA 1KBAA 1LXHA 2MFAA 4UY2C 1CCQA 1L4WA 2MUPA 1ERGA 4KSNA 1LXGA 1KC4A 2MJ0A 2HLQA 1HAAA 2PJYB 3NEQA 1CRFA 2X8BB 4FAOE 1I02A 2H64B 1RL5A 1BXPA 2CDXA 2PJYC 4OM4A 1NYUA 1F94A 2JVEA 1W6BA 1YWHA 1LJZA 1S4YA 1CDRA 1MAHF 2K3GA 2LCRA 1CXNA 2FD6U 3U73U 2I9BE 1B41B 3KFDE 2UWRA 2OFSA 1RGJA 2BTXA 1IJCA 1M9ZA 3EBXA 4LFTA 3FEVA 2H7ZA 1FSSB 2H5FA 1REWC 1VB0A 1BTEA 1XT3A 2J8BA 2QC1A 1QKDA 3ERAA 1JBDA 3PLCA 4IYEA 1ZADA 1CTXA 3HH7A 1FFJA 1MR6A 2ABXA 2NBTA 1ES7B 2H64C 1UG4A 1KU6B 4XJJA 2L03A 2H62C 2H7ZB 1CODA 4ZQYA 1LSIA 1IQ9A 2QJBC 1CHVS 3NH7A 2GOOB 3KFDI 3QB4B 1NEAA 3BT1U 3VTSA 4AEAA 2VLWA 1NTNA 1KBTA 1IDIA 1IK8A 2GOOC 3U74U 1TFSA 2BHIA 2QJAC 1ABTA 5IMYC 4HQPF 1CREA 5DO6A 1KTZB 1IDHA 2JQPA 5EBXA 2HLRA 1KFHA 1DRSA 1LX5B 1ONJA 1FF4A 1HC9A 2LA1A 1NXBA 1NORA 2MUOA 2QJ9C 2L5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OM5 A;  1ERA A;  1QKE A;  2CRT A;  1TGX A;  5DZ5 A;  1COE A;  1FAS A;  1HOY A;  1TXB A;  4DO8 A;  1CDQ A;  4QTI U;  2H62 D;  1H0J A;  1KL8 A;  1NTX A;  1JE9 A;  5IMT D;  1PLO A;  1CB9 A;  1IDL A;  1CDT A;  5DU1 A;  1HC9 B;  1KXI A;  2CCX A;  2MJY A;  1KS6 A;  2CTX A;  1CXO A;  1F8U B;  1HAJ A;  1KBS A;  6EBX A;  2H8U A;  1QM7 A;  2MJ4 A;  1CVO A;  4BIK B;  1JGK A;  4EY8 B;  2ERA A;  1FRA A;  3NDS A;  4P7U A;  1IKC A;  2MHY A;  4RUD A;  3EVS C;  2CRS A;  1CDS A;  3LAQ U;  1G6M A;  1FSC A;  1IDG A;  3BT2 U;  2UX2 A;  1V6P A;  2N99 A;  1TXA A;  4BDT B;  4FAO C;  1NYS A;  1KBA A;  1LXH A;  2MFA A;  4UY2 C;  1CCQ A;  1L4W A;  2MUP A;  1ERG A;  1KC4 A;  1LXG A;  2MJ0 A;  2HLQ A;  1HAA A;  2PJY B;  3NEQ A;  1CRF A;  2X8B B;  4FAO E;  1I02 A;  2H64 B;  1RL5 A;  1BXP A;  2CDX A;  2PJY C;  4OM4 A;  1NYU A;  1F94 A;  2JVE A;  1W6B A;  1YWH A;  1LJZ A;  1S4Y A;  1CDR A;  1MAH F;  2K3G A;  2LCR A;  1CXN A;  2FD6 U;  3U73 U;  2I9B E;  1B41 B;  3KFD E;  2UWR A;  2OFS A;  1RGJ A;  2BTX A;  1IJC A;  1M9Z A;  3EBX A;  4LFT A;  3FEV A;  2H7Z A;  1FSS B;  2H5F A;  1REW C;  1VB0 A;  1BTE A;  1XT3 A;  2J8B A;  2QC1 A;  1QKD A;  3ERA A;  1JBD A;  3PLC A;  4IYE A;  1ZAD A;  1CTX A;  3HH7 A;  1FFJ A;  1MR6 A;  2ABX A;  2NBT A;  1ES7 B;  2H64 C;  1UG4 A;  1KU6 B;  4XJJ A;  2L03 A;  2H62 C;  2H7Z B;  1COD A;  4ZQY A;  1LSI A;  1IQ9 A;  2QJB C;  1CHV S;  3NH7 A;  2GOO B;  3KFD I;  3QB4 B;  1NEA A;  3BT1 U;  3VTS A;  4AEA A;  2VLW A;  1NTN A;  1KBT A;  1IDI A;  1IK8 A;  2GOO C;  3U74 U;  1TFS A;  2BHI A;  2QJA C;  1ABT A;  5IMY C;  4HQP F;  1CRE A;  5DO6 A;  1KTZ B;  1IDH A;  2JQP A;  5EBX A;  2HLR A;  1KFH A;  1DRS A;  1LX5 B;  1ONJ A;  1FF4 A;  1HC9 A;  2LA1 A;  1NXB A;  1NOR A;  2MUO A;  2QJ9 C;  2L5S A; 
#chains in the Genus database with same CATH topology
 4OM5 A;  1ERA A;  1QKE A;  2CRT A;  1TGX A;  5DZ5 A;  1COE A;  1FAS A;  1HOY A;  1TXB A;  4DO8 A;  1CDQ A;  4QTI U;  2H62 D;  1H0J A;  1KL8 A;  1NTX A;  1JE9 A;  5IMT D;  1PLO A;  1CB9 A;  1IDL A;  1CDT A;  5DU1 A;  1HC9 B;  1KXI A;  2CCX A;  2MJY A;  1KS6 A;  2CTX A;  1CXO A;  1F8U B;  1HAJ A;  1KBS A;  6EBX A;  2H8U A;  1QM7 A;  2MJ4 A;  1CVO A;  4BIK B;  1JGK A;  4EY8 B;  2ERA A;  1FRA A;  3NDS A;  4P7U A;  1IKC A;  2MHY A;  4RUD A;  3EVS C;  2CRS A;  1CDS A;  3LAQ U;  1G6M A;  1FSC A;  1IDG A;  3BT2 U;  2UX2 A;  1V6P A;  2N99 A;  1TXA A;  4BDT B;  4FAO C;  1NYS A;  1KBA A;  1LXH A;  2MFA A;  4UY2 C;  1CCQ A;  1L4W A;  2MUP A;  1ERG A;  4KSN A;  1LXG A;  1KC4 A;  2MJ0 A;  2HLQ A;  1HAA A;  2PJY B;  3NEQ A;  1CRF A;  2X8B B;  4FAO E;  1I02 A;  2H64 B;  1RL5 A;  1BXP A;  2CDX A;  2PJY C;  4OM4 A;  1NYU A;  1F94 A;  2JVE A;  1W6B A;  1YWH A;  1LJZ A;  1S4Y A;  1CDR A;  1MAH F;  2K3G A;  2LCR A;  1CXN A;  2FD6 U;  3U73 U;  2I9B E;  1B41 B;  3KFD E;  2UWR A;  2OFS A;  1RGJ A;  2BTX A;  1IJC A;  1M9Z A;  3EBX A;  4LFT A;  3FEV A;  2H7Z A;  1FSS B;  2H5F A;  1REW C;  1VB0 A;  1BTE A;  1XT3 A;  2J8B A;  2QC1 A;  1QKD A;  3ERA A;  1JBD A;  3PLC A;  4IYE A;  1ZAD A;  1CTX A;  3HH7 A;  1FFJ A;  1MR6 A;  2ABX A;  2NBT A;  1ES7 B;  2H64 C;  1UG4 A;  1KU6 B;  4XJJ A;  2L03 A;  2H62 C;  2H7Z B;  1COD A;  4ZQY A;  1LSI A;  1IQ9 A;  2QJB C;  1CHV S;  3NH7 A;  2GOO B;  3KFD I;  3QB4 B;  1NEA A;  3BT1 U;  3VTS A;  4AEA A;  2VLW A;  1NTN A;  1KBT A;  1IDI A;  1IK8 A;  2GOO C;  3U74 U;  1TFS A;  2BHI A;  2QJA C;  1ABT A;  5IMY C;  4HQP F;  1CRE A;  5DO6 A;  1KTZ B;  1IDH A;  2JQP A;  5EBX A;  2HLR A;  1KFH A;  1DRS A;  1LX5 B;  1ONJ A;  1FF4 A;  1HC9 A;  2LA1 A;  1NXB A;  1NOR A;  2MUO A;  2QJ9 C;  2L5S A; 
#chains in the Genus database with same CATH homology
 4OM5 A;  1ERA A;  1QKE A;  2CRT A;  1TGX A;  5DZ5 A;  1COE A;  1FAS A;  1HOY A;  1TXB A;  4DO8 A;  1CDQ A;  4QTI U;  2H62 D;  1H0J A;  1KL8 A;  1NTX A;  1JE9 A;  5IMT D;  1PLO A;  1CB9 A;  1IDL A;  1CDT A;  5DU1 A;  1HC9 B;  1KXI A;  2CCX A;  2MJY A;  1KS6 A;  2CTX A;  1CXO A;  1F8U B;  1HAJ A;  1KBS A;  6EBX A;  2H8U A;  1QM7 A;  2MJ4 A;  1CVO A;  4BIK B;  1JGK A;  4EY8 B;  2ERA A;  1FRA A;  3NDS A;  4P7U A;  1IKC A;  2MHY A;  4RUD A;  3EVS C;  2CRS A;  1CDS A;  3LAQ U;  1G6M A;  1FSC A;  1IDG A;  3BT2 U;  2UX2 A;  1V6P A;  2N99 A;  1TXA A;  4BDT B;  4FAO C;  1NYS A;  1KBA A;  1LXH A;  2MFA A;  4UY2 C;  1CCQ A;  1L4W A;  2MUP A;  1ERG A;  4KSN A;  1LXG A;  1KC4 A;  2MJ0 A;  2HLQ A;  1HAA A;  2PJY B;  3NEQ A;  1CRF A;  2X8B B;  4FAO E;  1I02 A;  2H64 B;  1RL5 A;  1BXP A;  2CDX A;  2PJY C;  4OM4 A;  1NYU A;  1F94 A;  2JVE A;  1W6B A;  1YWH A;  1LJZ A;  1S4Y A;  1CDR A;  1MAH F;  2K3G A;  2LCR A;  1CXN A;  2FD6 U;  3U73 U;  2I9B E;  1B41 B;  3KFD E;  2UWR A;  2OFS A;  1RGJ A;  2BTX A;  1IJC A;  1M9Z A;  3EBX A;  4LFT A;  3FEV A;  2H7Z A;  1FSS B;  2H5F A;  1REW C;  1VB0 A;  1BTE A;  1XT3 A;  2J8B A;  2QC1 A;  1QKD A;  3ERA A;  1JBD A;  3PLC A;  4IYE A;  1ZAD A;  1CTX A;  3HH7 A;  1FFJ A;  1MR6 A;  2ABX A;  2NBT A;  1ES7 B;  2H64 C;  1UG4 A;  1KU6 B;  4XJJ A;  2L03 A;  2H62 C;  2H7Z B;  1COD A;  4ZQY A;  1LSI A;  1IQ9 A;  2QJB C;  1CHV S;  3NH7 A;  2GOO B;  3KFD I;  3QB4 B;  1NEA A;  3BT1 U;  3VTS A;  4AEA A;  2VLW A;  1NTN A;  1KBT A;  1IDI A;  1IK8 A;  2GOO C;  3U74 U;  1TFS A;  2BHI A;  2QJA C;  1ABT A;  5IMY C;  4HQP F;  1CRE A;  5DO6 A;  1KTZ B;  1IDH A;  2JQP A;  5EBX A;  2HLR A;  1KFH A;  1DRS A;  1LX5 B;  1ONJ A;  1FF4 A;  1HC9 A;  2LA1 A;  1NXB A;  1NOR A;  2MUO A;  2QJ9 C;  2L5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...