4ZQYA

Ringhalexin from hemachatus haemachatus: a novel inhibitor of extrinsic tenase complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
RLCLSDYSIFSETIEICPEGHNYCFKKFPKGITRLPWVIRGCAATCPKPEAQVYVDCCARDKCNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Ringhalexin
publication title Ringhalexin from Hemachatus haemachatus: A novel inhibitor of extrinsic tenase complex.
pubmed doi rcsb
total genus 11
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4zqyA00
1IKCA 2X8BB 2MJYA 3EBXA 1MAHF 1IDHA 3KFDE 1CDSA 1ZADA 2HLRA 2L03A 1CCQA 1ERGA 2MFAA 4AEAA 1FRAA 4EY8B 1LXHA 4ZQYA 6EBXA 1IDLA 2NBTA 1ABTA 2PJYC 1S4YA 4OM4A 1ERAA 5IMYC 2K3GA 2QC1A 2N99A 1CREA 1HC9A 2CRSA 2H64B 1FSCA 1HOYA 3NEQA 1KBAA 2GOOB 1QKDA 4HQPF 1FSSB 1LJZA 1KBSA 2H62D 2UWRA 4LFTA 2GOOC 1VB0A 5EBXA 1BTEA 1CRFA 1CXNA 1LSIA 1CDQA 1HAJA 2H5FA 1IDGA 1CHVS 3ERAA 1KU6B 4FAOC 1KS6A 1KC4A 2JQPA 2I9BE 3HH7A 1DRSA 3U73U 1CVOA 4IYEA 2BHIA 1IQ9A 2MJ0A 1G6MA 1TXBA 3QB4B 1NORA 3EVSC 2LA1A 1XT3A 1I02A 1JGKA 2CDXA 1JBDA 1FASA 2QJ9C 1TFSA 1QM7A 2JVEA 1CODA 2MHYA 1PLOA 1NTXA 1MR6A 1IJCA 1NYSA 1H0JA 1CDTA 1TXAA 3NDSA 4QTIU 2H64C 1HC9B 2H7ZA 1NXBA 1COEA 1FFJA 2FD6U 2QJAC 2OFSA 1JE9A 1ES7B 1CXOA 1BXPA 2H62C 3U74U 1RL5A 1HAAA 1QKEA 4BDTB 1UG4A 1M9ZA 1F94A 2CTXA 1CB9A 2LCRA 4FAOE 1LX5B 5DO6A 4P7UA 1TGXA 1RGJA 1L4WA 2ERAA 3LAQU 1CTXA 1CDRA 1ONJA 1F8UB 2BTXA 4XJJA 2HLQA 5DZ5A 2L5SA 2J8BA 2UX2A 3PLCA 5DU1A 1LXGA 1B41B 3BT2U 2PJYB 2H7ZB 4BIKB 2MUOA 3NH7A 1KXIA 2CCXA 1REWC 4OM5A 3BT1U 1KL8A 4DO8A 2CRTA 1W6BA 3FEVA 5IMTD 1YWHA 1NTNA 2ABXA 4RUDA 1KBTA 3KFDI 1NYUA 2VLWA 1FF4A 1V6PA 1IK8A 1KTZB 1IDIA 1NEAA 1KFHA 2H8UA 4UY2C 2MUPA 2QJBC 2MJ4A 3VTSA
chains in the Genus database with same CATH superfamily
1IKCA 2X8BB 2MJYA 3EBXA 1MAHF 1IDHA 3KFDE 1CDSA 1ZADA 2HLRA 2L03A 1CCQA 1ERGA 2MFAA 4AEAA 1FRAA 4EY8B 1LXHA 4ZQYA 6EBXA 1IDLA 2NBTA 1ABTA 2PJYC 1S4YA 4OM4A 1ERAA 5IMYC 2K3GA 2QC1A 2N99A 1CREA 1HC9A 2CRSA 2H64B 1FSCA 1HOYA 3NEQA 1KBAA 2GOOB 1QKDA 4HQPF 1FSSB 1LJZA 1KBSA 2H62D 2UWRA 4LFTA 2GOOC 1VB0A 5EBXA 1BTEA 1CRFA 1CXNA 1LSIA 1CDQA 1HAJA 2H5FA 1IDGA 1CHVS 3ERAA 1KU6B 4FAOC 1KS6A 1KC4A 2JQPA 2I9BE 3HH7A 1DRSA 3U73U 1CVOA 4IYEA 2BHIA 1IQ9A 2MJ0A 1G6MA 1TXBA 3QB4B 1NORA 3EVSC 2LA1A 1XT3A 1I02A 1JGKA 2CDXA 1JBDA 1FASA 2QJ9C 1TFSA 1QM7A 2JVEA 1CODA 2MHYA 1PLOA 1NTXA 1MR6A 1IJCA 1NYSA 1H0JA 1CDTA 1TXAA 3NDSA 4QTIU 2H64C 1HC9B 2H7ZA 1NXBA 1COEA 1FFJA 2FD6U 2QJAC 2OFSA 1JE9A 1ES7B 1CXOA 1BXPA 2H62C 3U74U 1RL5A 1HAAA 1QKEA 4BDTB 1UG4A 1M9ZA 1F94A 2CTXA 1CB9A 2LCRA 4FAOE 1LX5B 5DO6A 4P7UA 1TGXA 1RGJA 1L4WA 2ERAA 3LAQU 1CTXA 1CDRA 1ONJA 1F8UB 2BTXA 4XJJA 2HLQA 5DZ5A 2L5SA 2J8BA 2UX2A 3PLCA 5DU1A 1LXGA 1B41B 3BT2U 2PJYB 2H7ZB 4BIKB 2MUOA 3NH7A 1KXIA 2CCXA 1REWC 4OM5A 3BT1U 1KL8A 4DO8A 2CRTA 1W6BA 3FEVA 5IMTD 1YWHA 1NTNA 2ABXA 4KSNA 4RUDA 1KBTA 3KFDI 1NYUA 2VLWA 1FF4A 1V6PA 1IK8A 1KTZB 1IDIA 1NEAA 1KFHA 2H8UA 4UY2C 2MUPA 2QJBC 2MJ4A 3VTSA
chains in the Genus database with same CATH topology
1IKCA 2X8BB 2MJYA 3EBXA 1MAHF 1IDHA 3KFDE 1CDSA 1ZADA 2HLRA 2L03A 1CCQA 1ERGA 2MFAA 4AEAA 1FRAA 4EY8B 1LXHA 4ZQYA 6EBXA 1IDLA 2NBTA 1ABTA 2PJYC 1S4YA 4OM4A 1ERAA 5IMYC 2K3GA 2QC1A 2N99A 1CREA 1HC9A 2CRSA 2H64B 1FSCA 1HOYA 3NEQA 1KBAA 2GOOB 1QKDA 4HQPF 1FSSB 1LJZA 1KBSA 2H62D 2UWRA 4LFTA 2GOOC 1VB0A 5EBXA 1BTEA 1CRFA 1CXNA 1LSIA 1CDQA 1HAJA 2H5FA 1IDGA 1CHVS 3ERAA 1KU6B 4FAOC 1KS6A 1KC4A 2JQPA 2I9BE 3HH7A 1DRSA 3U73U 1CVOA 4IYEA 2BHIA 1IQ9A 2MJ0A 1G6MA 1TXBA 3QB4B 1NORA 3EVSC 2LA1A 1XT3A 1I02A 1JGKA 2CDXA 1JBDA 1FASA 2QJ9C 1TFSA 1QM7A 2JVEA 1CODA 2MHYA 1PLOA 1NTXA 1MR6A 1IJCA 1NYSA 1H0JA 1CDTA 1TXAA 3NDSA 4QTIU 2H64C 1HC9B 2H7ZA 1NXBA 1COEA 1FFJA 2FD6U 2QJAC 2OFSA 1JE9A 1ES7B 1CXOA 1BXPA 2H62C 3U74U 1RL5A 1HAAA 1QKEA 4BDTB 1UG4A 1M9ZA 1F94A 2CTXA 1CB9A 2LCRA 4FAOE 1LX5B 5DO6A 4P7UA 1TGXA 1RGJA 1L4WA 2ERAA 3LAQU 1CTXA 1CDRA 1ONJA 1F8UB 2BTXA 4XJJA 2HLQA 5DZ5A 2L5SA 2J8BA 2UX2A 3PLCA 5DU1A 1LXGA 1B41B 3BT2U 2PJYB 2H7ZB 4BIKB 2MUOA 3NH7A 1KXIA 2CCXA 1REWC 4OM5A 3BT1U 1KL8A 4DO8A 2CRTA 1W6BA 3FEVA 5IMTD 1YWHA 1NTNA 2ABXA 4KSNA 4RUDA 1KBTA 3KFDI 1NYUA 2VLWA 1FF4A 1V6PA 1IK8A 1KTZB 1IDIA 1NEAA 1KFHA 2H8UA 4UY2C 2MUPA 2QJBC 2MJ4A 3VTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKC A;  2X8B B;  2MJY A;  3EBX A;  1MAH F;  1IDH A;  3KFD E;  1CDS A;  1ZAD A;  2HLR A;  2L03 A;  1CCQ A;  1ERG A;  2MFA A;  4AEA A;  1FRA A;  4EY8 B;  1LXH A;  4ZQY A;  6EBX A;  1IDL A;  2NBT A;  1ABT A;  2PJY C;  1S4Y A;  4OM4 A;  1ERA A;  5IMY C;  2K3G A;  2QC1 A;  2N99 A;  1CRE A;  1HC9 A;  2CRS A;  2H64 B;  1FSC A;  1HOY A;  3NEQ A;  1KBA A;  2GOO B;  1QKD A;  4HQP F;  1FSS B;  1LJZ A;  1KBS A;  2H62 D;  2UWR A;  4LFT A;  2GOO C;  1VB0 A;  5EBX A;  1BTE A;  1CRF A;  1CXN A;  1LSI A;  1CDQ A;  1HAJ A;  2H5F A;  1IDG A;  1CHV S;  3ERA A;  1KU6 B;  4FAO C;  1KS6 A;  1KC4 A;  2JQP A;  2I9B E;  3HH7 A;  1DRS A;  3U73 U;  1CVO A;  4IYE A;  2BHI A;  1IQ9 A;  2MJ0 A;  1G6M A;  1TXB A;  3QB4 B;  1NOR A;  3EVS C;  2LA1 A;  1XT3 A;  1I02 A;  1JGK A;  2CDX A;  1JBD A;  1FAS A;  2QJ9 C;  1TFS A;  1QM7 A;  2JVE A;  1COD A;  2MHY A;  1PLO A;  1NTX A;  1MR6 A;  1IJC A;  1NYS A;  1H0J A;  1CDT A;  1TXA A;  3NDS A;  4QTI U;  2H64 C;  1HC9 B;  2H7Z A;  1NXB A;  1COE A;  1FFJ A;  2FD6 U;  2QJA C;  2OFS A;  1JE9 A;  1ES7 B;  1CXO A;  1BXP A;  2H62 C;  3U74 U;  1RL5 A;  1HAA A;  1QKE A;  4BDT B;  1UG4 A;  1M9Z A;  1F94 A;  2CTX A;  1CB9 A;  2LCR A;  4FAO E;  1LX5 B;  5DO6 A;  4P7U A;  1TGX A;  1RGJ A;  1L4W A;  2ERA A;  3LAQ U;  1CTX A;  1CDR A;  1ONJ A;  1F8U B;  2BTX A;  4XJJ A;  2HLQ A;  5DZ5 A;  2L5S A;  2J8B A;  2UX2 A;  3PLC A;  5DU1 A;  1LXG A;  1B41 B;  3BT2 U;  2PJY B;  2H7Z B;  4BIK B;  2MUO A;  3NH7 A;  1KXI A;  2CCX A;  1REW C;  4OM5 A;  3BT1 U;  1KL8 A;  4DO8 A;  2CRT A;  1W6B A;  3FEV A;  5IMT D;  1YWH A;  1NTN A;  2ABX A;  4RUD A;  1KBT A;  3KFD I;  1NYU A;  2VLW A;  1FF4 A;  1V6P A;  1IK8 A;  1KTZ B;  1IDI A;  1NEA A;  1KFH A;  2H8U A;  4UY2 C;  2MUP A;  2QJB C;  2MJ4 A;  3VTS A; 
#chains in the Genus database with same CATH topology
 1IKC A;  2X8B B;  2MJY A;  3EBX A;  1MAH F;  1IDH A;  3KFD E;  1CDS A;  1ZAD A;  2HLR A;  2L03 A;  1CCQ A;  1ERG A;  2MFA A;  4AEA A;  1FRA A;  4EY8 B;  1LXH A;  4ZQY A;  6EBX A;  1IDL A;  2NBT A;  1ABT A;  2PJY C;  1S4Y A;  4OM4 A;  1ERA A;  5IMY C;  2K3G A;  2QC1 A;  2N99 A;  1CRE A;  1HC9 A;  2CRS A;  2H64 B;  1FSC A;  1HOY A;  3NEQ A;  1KBA A;  2GOO B;  1QKD A;  4HQP F;  1FSS B;  1LJZ A;  1KBS A;  2H62 D;  2UWR A;  4LFT A;  2GOO C;  1VB0 A;  5EBX A;  1BTE A;  1CRF A;  1CXN A;  1LSI A;  1CDQ A;  1HAJ A;  2H5F A;  1IDG A;  1CHV S;  3ERA A;  1KU6 B;  4FAO C;  1KS6 A;  1KC4 A;  2JQP A;  2I9B E;  3HH7 A;  1DRS A;  3U73 U;  1CVO A;  4IYE A;  2BHI A;  1IQ9 A;  2MJ0 A;  1G6M A;  1TXB A;  3QB4 B;  1NOR A;  3EVS C;  2LA1 A;  1XT3 A;  1I02 A;  1JGK A;  2CDX A;  1JBD A;  1FAS A;  2QJ9 C;  1TFS A;  1QM7 A;  2JVE A;  1COD A;  2MHY A;  1PLO A;  1NTX A;  1MR6 A;  1IJC A;  1NYS A;  1H0J A;  1CDT A;  1TXA A;  3NDS A;  4QTI U;  2H64 C;  1HC9 B;  2H7Z A;  1NXB A;  1COE A;  1FFJ A;  2FD6 U;  2QJA C;  2OFS A;  1JE9 A;  1ES7 B;  1CXO A;  1BXP A;  2H62 C;  3U74 U;  1RL5 A;  1HAA A;  1QKE A;  4BDT B;  1UG4 A;  1M9Z A;  1F94 A;  2CTX A;  1CB9 A;  2LCR A;  4FAO E;  1LX5 B;  5DO6 A;  4P7U A;  1TGX A;  1RGJ A;  1L4W A;  2ERA A;  3LAQ U;  1CTX A;  1CDR A;  1ONJ A;  1F8U B;  2BTX A;  4XJJ A;  2HLQ A;  5DZ5 A;  2L5S A;  2J8B A;  2UX2 A;  3PLC A;  5DU1 A;  1LXG A;  1B41 B;  3BT2 U;  2PJY B;  2H7Z B;  4BIK B;  2MUO A;  3NH7 A;  1KXI A;  2CCX A;  1REW C;  4OM5 A;  3BT1 U;  1KL8 A;  4DO8 A;  2CRT A;  1W6B A;  3FEV A;  5IMT D;  1YWH A;  1NTN A;  2ABX A;  4KSN A;  4RUD A;  1KBT A;  3KFD I;  1NYU A;  2VLW A;  1FF4 A;  1V6P A;  1IK8 A;  1KTZ B;  1IDI A;  1NEA A;  1KFH A;  2H8U A;  4UY2 C;  2MUP A;  2QJB C;  2MJ4 A;  3VTS A; 
#chains in the Genus database with same CATH homology
 1IKC A;  2X8B B;  2MJY A;  3EBX A;  1MAH F;  1IDH A;  3KFD E;  1CDS A;  1ZAD A;  2HLR A;  2L03 A;  1CCQ A;  1ERG A;  2MFA A;  4AEA A;  1FRA A;  4EY8 B;  1LXH A;  4ZQY A;  6EBX A;  1IDL A;  2NBT A;  1ABT A;  2PJY C;  1S4Y A;  4OM4 A;  1ERA A;  5IMY C;  2K3G A;  2QC1 A;  2N99 A;  1CRE A;  1HC9 A;  2CRS A;  2H64 B;  1FSC A;  1HOY A;  3NEQ A;  1KBA A;  2GOO B;  1QKD A;  4HQP F;  1FSS B;  1LJZ A;  1KBS A;  2H62 D;  2UWR A;  4LFT A;  2GOO C;  1VB0 A;  5EBX A;  1BTE A;  1CRF A;  1CXN A;  1LSI A;  1CDQ A;  1HAJ A;  2H5F A;  1IDG A;  1CHV S;  3ERA A;  1KU6 B;  4FAO C;  1KS6 A;  1KC4 A;  2JQP A;  2I9B E;  3HH7 A;  1DRS A;  3U73 U;  1CVO A;  4IYE A;  2BHI A;  1IQ9 A;  2MJ0 A;  1G6M A;  1TXB A;  3QB4 B;  1NOR A;  3EVS C;  2LA1 A;  1XT3 A;  1I02 A;  1JGK A;  2CDX A;  1JBD A;  1FAS A;  2QJ9 C;  1TFS A;  1QM7 A;  2JVE A;  1COD A;  2MHY A;  1PLO A;  1NTX A;  1MR6 A;  1IJC A;  1NYS A;  1H0J A;  1CDT A;  1TXA A;  3NDS A;  4QTI U;  2H64 C;  1HC9 B;  2H7Z A;  1NXB A;  1COE A;  1FFJ A;  2FD6 U;  2QJA C;  2OFS A;  1JE9 A;  1ES7 B;  1CXO A;  1BXP A;  2H62 C;  3U74 U;  1RL5 A;  1HAA A;  1QKE A;  4BDT B;  1UG4 A;  1M9Z A;  1F94 A;  2CTX A;  1CB9 A;  2LCR A;  4FAO E;  1LX5 B;  5DO6 A;  4P7U A;  1TGX A;  1RGJ A;  1L4W A;  2ERA A;  3LAQ U;  1CTX A;  1CDR A;  1ONJ A;  1F8U B;  2BTX A;  4XJJ A;  2HLQ A;  5DZ5 A;  2L5S A;  2J8B A;  2UX2 A;  3PLC A;  5DU1 A;  1LXG A;  1B41 B;  3BT2 U;  2PJY B;  2H7Z B;  4BIK B;  2MUO A;  3NH7 A;  1KXI A;  2CCX A;  1REW C;  4OM5 A;  3BT1 U;  1KL8 A;  4DO8 A;  2CRT A;  1W6B A;  3FEV A;  5IMT D;  1YWH A;  1NTN A;  2ABX A;  4KSN A;  4RUD A;  1KBT A;  3KFD I;  1NYU A;  2VLW A;  1FF4 A;  1V6P A;  1IK8 A;  1KTZ B;  1IDI A;  1NEA A;  1KFH A;  2H8U A;  4UY2 C;  2MUP A;  2QJB C;  2MJ4 A;  3VTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...