1S4YA

Crystal structure of the activin/actriib extracellular domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
91
Chain Sequence
RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activin receptor type IIB precursor
publication title A Flexible Activin Explains the Membrane-Dependent Cooperative Assembly of TGF-beta Family Receptors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 22
structure length 91
sequence length 91
chains with identical sequence C
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2004-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1s4yA00
1YWHA 1B41B 1G6MA 2H64C 1M9ZA 1FSCA 1JBDA 2CTXA 2MFAA 3NH7A 1KS6A 2L03A 1FF4A 1HAJA 1H0JA 2GOOC 1KBAA 2H62C 1ZADA 2MUOA 1QKEA 1KTZB 1NTXA 2H64B 5DO6A 1TXAA 1LXHA 6EBXA 2FD6U 1NYSA 2H62D 1ERGA 1CODA 1CHVS 2QJBC 4EY8B 1JGKA 4AEAA 2QJAC 1HC9A 1TFSA 1KU6B 2MHYA 4OM5A 4FAOC 1JE9A 1IQ9A 1NORA 1CDSA 2VLWA 2H7ZB 3EBXA 1CDQA 1IDIA 1F8UB 2I9BE 1KXIA 2UX2A 2J8BA 2MJYA 4IYEA 2L5SA 1LJZA 4HQPF 1W6BA 1CREA 1FFJA 5EBXA 3BT1U 1F94A 1KBSA 2N99A 2LCRA 1IDLA 2X8BB 4ZQYA 1L4WA 1CXOA 1CTXA 4LFTA 1LX5B 2PJYC 3KFDI 1KC4A 3ERAA 1CDRA 1QKDA 1ES7B 4DO8A 2UWRA 1CRFA 2MJ0A 2K3GA 2LA1A 1BXPA 1I02A 1CCQA 2CCXA 2QC1A 3HH7A 1HAAA 2PJYB 1KBTA 1RL5A 2JQPA 1TGXA 1CVOA 1V6PA 1NYUA 2ERAA 2JVEA 2HLRA 4P7UA 1MAHF 2QJ9C 1REWC 3KFDE 1PLOA 4QTIU 4XJJA 2NBTA 3U74U 3VTSA 2CRSA 2ABXA 1HOYA 2H8UA 1NEAA 1CDTA 1CXNA 3PLCA 1BTEA 3QB4B 1DRSA 1ABTA 1COEA 1TXBA 4BDTB 4OM4A 2CRTA 1RGJA 1CB9A 1HC9B 1IDGA 3EVSC 1QM7A 5DU1A 1FSSB 3BT2U 1IKCA 2BTXA 1FRAA 3NEQA 2H7ZA 2MUPA 5DZ5A 4RUDA 1NXBA 2CDXA 1NTNA 3FEVA 1S4YA 5IMTD 3U73U 1XT3A 4FAOE 3NDSA 1IDHA 1FASA 1IK8A 2OFSA 2BHIA 1KFHA 2HLQA 1ONJA 1ERAA 4UY2C 1LXGA 1LSIA 1KL8A 2GOOB 3LAQU 2H5FA 1IJCA 1MR6A 5IMYC 2MJ4A 1UG4A 4BIKB 1VB0A
chains in the Genus database with same CATH superfamily
1YWHA 1B41B 1G6MA 2H64C 1M9ZA 1FSCA 1JBDA 2CTXA 2MFAA 3NH7A 1KS6A 2L03A 1FF4A 1HAJA 1H0JA 2GOOC 1KBAA 2H62C 1ZADA 2MUOA 1QKEA 1KTZB 1NTXA 2H64B 5DO6A 1TXAA 1LXHA 6EBXA 2FD6U 1NYSA 2H62D 1ERGA 1CODA 1CHVS 2QJBC 4EY8B 1JGKA 4AEAA 2QJAC 1HC9A 1TFSA 1KU6B 2MHYA 4OM5A 4FAOC 1JE9A 1IQ9A 1NORA 1CDSA 2VLWA 2H7ZB 3EBXA 1CDQA 1IDIA 1F8UB 2I9BE 1KXIA 2UX2A 2J8BA 2MJYA 4IYEA 2L5SA 1LJZA 4HQPF 1W6BA 1CREA 1FFJA 5EBXA 3BT1U 1F94A 1KBSA 2N99A 2LCRA 1IDLA 2X8BB 4ZQYA 1L4WA 1CXOA 1CTXA 4LFTA 1LX5B 4KSNA 2PJYC 3KFDI 1KC4A 3ERAA 1CDRA 1QKDA 1ES7B 4DO8A 2UWRA 1CRFA 2MJ0A 2K3GA 2LA1A 1BXPA 1I02A 1CCQA 2CCXA 2QC1A 3HH7A 1HAAA 2PJYB 1KBTA 1RL5A 2JQPA 1TGXA 1CVOA 1V6PA 1NYUA 2ERAA 2JVEA 2HLRA 4P7UA 1MAHF 2QJ9C 1REWC 3KFDE 1PLOA 4QTIU 4XJJA 2NBTA 3U74U 3VTSA 2CRSA 2ABXA 1HOYA 2H8UA 1NEAA 1CDTA 1CXNA 3PLCA 1BTEA 3QB4B 1DRSA 1ABTA 1COEA 1TXBA 4BDTB 4OM4A 2CRTA 1RGJA 1CB9A 1HC9B 1IDGA 3EVSC 1QM7A 5DU1A 1FSSB 3BT2U 1IKCA 2BTXA 1FRAA 3NEQA 2H7ZA 2MUPA 5DZ5A 4RUDA 1NXBA 2CDXA 1NTNA 3FEVA 1S4YA 5IMTD 3U73U 1XT3A 4FAOE 3NDSA 1IDHA 1FASA 1IK8A 2OFSA 2BHIA 1KFHA 2HLQA 1ONJA 1ERAA 4UY2C 1LXGA 1LSIA 1KL8A 2GOOB 3LAQU 2H5FA 1IJCA 1MR6A 5IMYC 2MJ4A 1UG4A 4BIKB 1VB0A
chains in the Genus database with same CATH topology
1YWHA 1B41B 1G6MA 2H64C 1M9ZA 1FSCA 1JBDA 2CTXA 2MFAA 3NH7A 1KS6A 2L03A 1FF4A 1HAJA 1H0JA 2GOOC 1KBAA 2H62C 1ZADA 2MUOA 1QKEA 1KTZB 1NTXA 2H64B 5DO6A 1TXAA 1LXHA 6EBXA 2FD6U 1NYSA 2H62D 1ERGA 1CODA 1CHVS 2QJBC 4EY8B 1JGKA 4AEAA 2QJAC 1HC9A 1TFSA 1KU6B 2MHYA 4OM5A 4FAOC 1JE9A 1IQ9A 1NORA 1CDSA 2VLWA 2H7ZB 3EBXA 1CDQA 1IDIA 1F8UB 2I9BE 1KXIA 2UX2A 2J8BA 2MJYA 4IYEA 2L5SA 1LJZA 4HQPF 1W6BA 1CREA 1FFJA 5EBXA 3BT1U 1F94A 1KBSA 2N99A 2LCRA 1IDLA 2X8BB 4ZQYA 1L4WA 1CXOA 1CTXA 4LFTA 1LX5B 4KSNA 2PJYC 3KFDI 1KC4A 3ERAA 1CDRA 1QKDA 1ES7B 4DO8A 2UWRA 1CRFA 2MJ0A 2K3GA 2LA1A 1BXPA 1I02A 1CCQA 2CCXA 2QC1A 3HH7A 1HAAA 2PJYB 1KBTA 1RL5A 2JQPA 1TGXA 1CVOA 1V6PA 1NYUA 2ERAA 2JVEA 2HLRA 4P7UA 1MAHF 2QJ9C 1REWC 3KFDE 1PLOA 4QTIU 4XJJA 2NBTA 3U74U 3VTSA 2CRSA 2ABXA 1HOYA 2H8UA 1NEAA 1CDTA 1CXNA 3PLCA 1BTEA 3QB4B 1DRSA 1ABTA 1COEA 1TXBA 4BDTB 4OM4A 2CRTA 1RGJA 1CB9A 1HC9B 1IDGA 3EVSC 1QM7A 5DU1A 1FSSB 3BT2U 1IKCA 2BTXA 1FRAA 3NEQA 2H7ZA 2MUPA 5DZ5A 4RUDA 1NXBA 2CDXA 1NTNA 3FEVA 1S4YA 5IMTD 3U73U 1XT3A 4FAOE 3NDSA 1IDHA 1FASA 1IK8A 2OFSA 2BHIA 1KFHA 2HLQA 1ONJA 1ERAA 4UY2C 1LXGA 1LSIA 1KL8A 2GOOB 3LAQU 2H5FA 1IJCA 1MR6A 5IMYC 2MJ4A 1UG4A 4BIKB 1VB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YWH A;  1B41 B;  1G6M A;  2H64 C;  1M9Z A;  1FSC A;  1JBD A;  2CTX A;  2MFA A;  3NH7 A;  1KS6 A;  2L03 A;  1FF4 A;  1HAJ A;  1H0J A;  2GOO C;  1KBA A;  2H62 C;  1ZAD A;  2MUO A;  1QKE A;  1KTZ B;  1NTX A;  2H64 B;  5DO6 A;  1TXA A;  1LXH A;  6EBX A;  2FD6 U;  1NYS A;  2H62 D;  1ERG A;  1COD A;  1CHV S;  2QJB C;  4EY8 B;  1JGK A;  4AEA A;  2QJA C;  1HC9 A;  1TFS A;  1KU6 B;  2MHY A;  4OM5 A;  4FAO C;  1JE9 A;  1IQ9 A;  1NOR A;  1CDS A;  2VLW A;  2H7Z B;  3EBX A;  1CDQ A;  1IDI A;  1F8U B;  2I9B E;  1KXI A;  2UX2 A;  2J8B A;  2MJY A;  4IYE A;  2L5S A;  1LJZ A;  4HQP F;  1W6B A;  1CRE A;  1FFJ A;  5EBX A;  3BT1 U;  1F94 A;  1KBS A;  2N99 A;  2LCR A;  1IDL A;  2X8B B;  4ZQY A;  1L4W A;  1CXO A;  1CTX A;  4LFT A;  1LX5 B;  2PJY C;  3KFD I;  1KC4 A;  3ERA A;  1CDR A;  1QKD A;  1ES7 B;  4DO8 A;  2UWR A;  1CRF A;  2MJ0 A;  2K3G A;  2LA1 A;  1BXP A;  1I02 A;  1CCQ A;  2CCX A;  2QC1 A;  3HH7 A;  1HAA A;  2PJY B;  1KBT A;  1RL5 A;  2JQP A;  1TGX A;  1CVO A;  1V6P A;  1NYU A;  2ERA A;  2JVE A;  2HLR A;  4P7U A;  1MAH F;  2QJ9 C;  1REW C;  3KFD E;  1PLO A;  4QTI U;  4XJJ A;  2NBT A;  3U74 U;  3VTS A;  2CRS A;  2ABX A;  1HOY A;  2H8U A;  1NEA A;  1CDT A;  1CXN A;  3PLC A;  1BTE A;  3QB4 B;  1DRS A;  1ABT A;  1COE A;  1TXB A;  4BDT B;  4OM4 A;  2CRT A;  1RGJ A;  1CB9 A;  1HC9 B;  1IDG A;  3EVS C;  1QM7 A;  5DU1 A;  1FSS B;  3BT2 U;  1IKC A;  2BTX A;  1FRA A;  3NEQ A;  2H7Z A;  2MUP A;  5DZ5 A;  4RUD A;  1NXB A;  2CDX A;  1NTN A;  3FEV A;  1S4Y A;  5IMT D;  3U73 U;  1XT3 A;  4FAO E;  3NDS A;  1IDH A;  1FAS A;  1IK8 A;  2OFS A;  2BHI A;  1KFH A;  2HLQ A;  1ONJ A;  1ERA A;  4UY2 C;  1LXG A;  1LSI A;  1KL8 A;  2GOO B;  3LAQ U;  2H5F A;  1IJC A;  1MR6 A;  5IMY C;  2MJ4 A;  1UG4 A;  4BIK B;  1VB0 A; 
#chains in the Genus database with same CATH topology
 1YWH A;  1B41 B;  1G6M A;  2H64 C;  1M9Z A;  1FSC A;  1JBD A;  2CTX A;  2MFA A;  3NH7 A;  1KS6 A;  2L03 A;  1FF4 A;  1HAJ A;  1H0J A;  2GOO C;  1KBA A;  2H62 C;  1ZAD A;  2MUO A;  1QKE A;  1KTZ B;  1NTX A;  2H64 B;  5DO6 A;  1TXA A;  1LXH A;  6EBX A;  2FD6 U;  1NYS A;  2H62 D;  1ERG A;  1COD A;  1CHV S;  2QJB C;  4EY8 B;  1JGK A;  4AEA A;  2QJA C;  1HC9 A;  1TFS A;  1KU6 B;  2MHY A;  4OM5 A;  4FAO C;  1JE9 A;  1IQ9 A;  1NOR A;  1CDS A;  2VLW A;  2H7Z B;  3EBX A;  1CDQ A;  1IDI A;  1F8U B;  2I9B E;  1KXI A;  2UX2 A;  2J8B A;  2MJY A;  4IYE A;  2L5S A;  1LJZ A;  4HQP F;  1W6B A;  1CRE A;  1FFJ A;  5EBX A;  3BT1 U;  1F94 A;  1KBS A;  2N99 A;  2LCR A;  1IDL A;  2X8B B;  4ZQY A;  1L4W A;  1CXO A;  1CTX A;  4LFT A;  1LX5 B;  4KSN A;  2PJY C;  3KFD I;  1KC4 A;  3ERA A;  1CDR A;  1QKD A;  1ES7 B;  4DO8 A;  2UWR A;  1CRF A;  2MJ0 A;  2K3G A;  2LA1 A;  1BXP A;  1I02 A;  1CCQ A;  2CCX A;  2QC1 A;  3HH7 A;  1HAA A;  2PJY B;  1KBT A;  1RL5 A;  2JQP A;  1TGX A;  1CVO A;  1V6P A;  1NYU A;  2ERA A;  2JVE A;  2HLR A;  4P7U A;  1MAH F;  2QJ9 C;  1REW C;  3KFD E;  1PLO A;  4QTI U;  4XJJ A;  2NBT A;  3U74 U;  3VTS A;  2CRS A;  2ABX A;  1HOY A;  2H8U A;  1NEA A;  1CDT A;  1CXN A;  3PLC A;  1BTE A;  3QB4 B;  1DRS A;  1ABT A;  1COE A;  1TXB A;  4BDT B;  4OM4 A;  2CRT A;  1RGJ A;  1CB9 A;  1HC9 B;  1IDG A;  3EVS C;  1QM7 A;  5DU1 A;  1FSS B;  3BT2 U;  1IKC A;  2BTX A;  1FRA A;  3NEQ A;  2H7Z A;  2MUP A;  5DZ5 A;  4RUD A;  1NXB A;  2CDX A;  1NTN A;  3FEV A;  1S4Y A;  5IMT D;  3U73 U;  1XT3 A;  4FAO E;  3NDS A;  1IDH A;  1FAS A;  1IK8 A;  2OFS A;  2BHI A;  1KFH A;  2HLQ A;  1ONJ A;  1ERA A;  4UY2 C;  1LXG A;  1LSI A;  1KL8 A;  2GOO B;  3LAQ U;  2H5F A;  1IJC A;  1MR6 A;  5IMY C;  2MJ4 A;  1UG4 A;  4BIK B;  1VB0 A; 
#chains in the Genus database with same CATH homology
 1YWH A;  1B41 B;  1G6M A;  2H64 C;  1M9Z A;  1FSC A;  1JBD A;  2CTX A;  2MFA A;  3NH7 A;  1KS6 A;  2L03 A;  1FF4 A;  1HAJ A;  1H0J A;  2GOO C;  1KBA A;  2H62 C;  1ZAD A;  2MUO A;  1QKE A;  1KTZ B;  1NTX A;  2H64 B;  5DO6 A;  1TXA A;  1LXH A;  6EBX A;  2FD6 U;  1NYS A;  2H62 D;  1ERG A;  1COD A;  1CHV S;  2QJB C;  4EY8 B;  1JGK A;  4AEA A;  2QJA C;  1HC9 A;  1TFS A;  1KU6 B;  2MHY A;  4OM5 A;  4FAO C;  1JE9 A;  1IQ9 A;  1NOR A;  1CDS A;  2VLW A;  2H7Z B;  3EBX A;  1CDQ A;  1IDI A;  1F8U B;  2I9B E;  1KXI A;  2UX2 A;  2J8B A;  2MJY A;  4IYE A;  2L5S A;  1LJZ A;  4HQP F;  1W6B A;  1CRE A;  1FFJ A;  5EBX A;  3BT1 U;  1F94 A;  1KBS A;  2N99 A;  2LCR A;  1IDL A;  2X8B B;  4ZQY A;  1L4W A;  1CXO A;  1CTX A;  4LFT A;  1LX5 B;  4KSN A;  2PJY C;  3KFD I;  1KC4 A;  3ERA A;  1CDR A;  1QKD A;  1ES7 B;  4DO8 A;  2UWR A;  1CRF A;  2MJ0 A;  2K3G A;  2LA1 A;  1BXP A;  1I02 A;  1CCQ A;  2CCX A;  2QC1 A;  3HH7 A;  1HAA A;  2PJY B;  1KBT A;  1RL5 A;  2JQP A;  1TGX A;  1CVO A;  1V6P A;  1NYU A;  2ERA A;  2JVE A;  2HLR A;  4P7U A;  1MAH F;  2QJ9 C;  1REW C;  3KFD E;  1PLO A;  4QTI U;  4XJJ A;  2NBT A;  3U74 U;  3VTS A;  2CRS A;  2ABX A;  1HOY A;  2H8U A;  1NEA A;  1CDT A;  1CXN A;  3PLC A;  1BTE A;  3QB4 B;  1DRS A;  1ABT A;  1COE A;  1TXB A;  4BDT B;  4OM4 A;  2CRT A;  1RGJ A;  1CB9 A;  1HC9 B;  1IDG A;  3EVS C;  1QM7 A;  5DU1 A;  1FSS B;  3BT2 U;  1IKC A;  2BTX A;  1FRA A;  3NEQ A;  2H7Z A;  2MUP A;  5DZ5 A;  4RUD A;  1NXB A;  2CDX A;  1NTN A;  3FEV A;  1S4Y A;  5IMT D;  3U73 U;  1XT3 A;  4FAO E;  3NDS A;  1IDH A;  1FAS A;  1IK8 A;  2OFS A;  2BHI A;  1KFH A;  2HLQ A;  1ONJ A;  1ERA A;  4UY2 C;  1LXG A;  1LSI A;  1KL8 A;  2GOO B;  3LAQ U;  2H5F A;  1IJC A;  1MR6 A;  5IMY C;  2MJ4 A;  1UG4 A;  4BIK B;  1VB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...