1S4YA

Crystal structure of the activin/actriib extracellular domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
91
Chain Sequence
RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Activin receptor type IIB precursor
publication title A Flexible Activin Explains the Membrane-Dependent Cooperative Assembly of TGF-beta Family Receptors.
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 91
sequence length 91
chains with identical sequence C
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2004-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1s4yA00
3FEVA 1IQ9A 1NYUA 4IYEA 5DZ5A 1TFSA 1CDTA 2ERAA 1IDIA 3EVSC 1UG4A 6EBXA 1IK8A 1HC9B 2H5FA 2BHIA 4XJJA 1MAHF 2QJBC 3LAQU 1FASA 1VB0A 5EBXA 1CXOA 2LA1A 1KBSA 3BT2U 1IKCA 1LX5B 1COEA 2MFAA 1CDSA 1LSIA 2H7ZA 1CVOA 1DRSA 1NORA 4QTIU 1F94A 4RUDA 1KTZB 2JVEA 1QKEA 3KFDI 2CDXA 5DO6A 2HLQA 1QKDA 2H8UA 1CB9A 2H64C 1FRAA 1CTXA 1QM7A 4ZQYA 1HC9A 2BTXA 2JQPA 2MJ0A 4OM4A 2H62D 1BTEA 1REWC 1IDGA 1F8UB 1NEAA 2CTXA 2MHYA 2QC1A 1JBDA 1G6MA 3U74U 3KFDE 1TGXA 4LFTA 1B41B 3VTSA 4OM5A 1KC4A 1TXAA 2MJ4A 2CRSA 5IMYC 2J8BA 1CRFA 1LJZA 1ABTA 1FSCA 1ERAA 1NTNA 2CRTA 2MUOA 2ABXA 2CCXA 4HQPF 4P7UA 3PLCA 1BXPA 1ES7B 1FF4A 1H0JA 1S4YA 1M9ZA 1YWHA 1JGKA 1KL8A 1RGJA 1TXBA 3NDSA 2L5SA 5DU1A 3BT1U 1HAAA 4DO8A 2X8BB 2H62C 2MUPA 1IDHA 1KXIA 1V6PA 1NTXA 3NH7A 4AEAA 1CDRA 3HH7A 2PJYB 4BDTB 4UY2C 1KBTA 2QJ9C 2FD6U 1FFJA 1ZADA 1IDLA 2GOOB 1KS6A 1NYSA 3U73U 2LCRA 4EY8B 1LXGA 1CDQA 1W6BA 1I02A 5IMTD 1KBAA 4FAOE 3ERAA 1FSSB 2NBTA 1ONJA 2MJYA 1XT3A 1CXNA 1CODA 1HAJA 1IJCA 2PJYC 1L4WA 1NXBA 2I9BE 1PLOA 1CHVS 2UWRA 3QB4B 1KU6B 1MR6A 2K3GA 2GOOC 2N99A 1RL5A 2HLRA 1ERGA 2L03A 2OFSA 2VLWA 3NEQA 3EBXA 1LXHA 2QJAC 1KFHA 2H7ZB 4BIKB 1JE9A 2H64B 1CREA 2UX2A 1CCQA 4FAOC 1HOYA
chains in the Genus database with same CATH superfamily
3FEVA 1IQ9A 1NYUA 4IYEA 5DZ5A 1TFSA 1CDTA 2ERAA 1IDIA 3EVSC 1UG4A 6EBXA 1IK8A 1HC9B 2H5FA 2BHIA 4XJJA 1MAHF 2QJBC 3LAQU 1FASA 1VB0A 5EBXA 1CXOA 2LA1A 1KBSA 3BT2U 1IKCA 1LX5B 1COEA 2MFAA 1CDSA 1LSIA 2H7ZA 1CVOA 1DRSA 1NORA 4QTIU 1F94A 4RUDA 1KTZB 2JVEA 1QKEA 3KFDI 2CDXA 5DO6A 2HLQA 1QKDA 2H8UA 1CB9A 2H64C 1FRAA 1CTXA 1QM7A 4ZQYA 1HC9A 2BTXA 2JQPA 2MJ0A 4OM4A 2H62D 1BTEA 1REWC 1IDGA 1F8UB 1NEAA 2CTXA 2MHYA 2QC1A 1JBDA 1G6MA 3U74U 3KFDE 1TGXA 4LFTA 1B41B 3VTSA 4OM5A 1KC4A 1TXAA 2MJ4A 2CRSA 5IMYC 2J8BA 1CRFA 1LJZA 1ABTA 1FSCA 1ERAA 1NTNA 2CRTA 2MUOA 2ABXA 2CCXA 4HQPF 4P7UA 3PLCA 1BXPA 1ES7B 1FF4A 1H0JA 1S4YA 1M9ZA 1YWHA 1JGKA 1KL8A 1RGJA 1TXBA 3NDSA 2L5SA 5DU1A 3BT1U 1HAAA 4DO8A 2X8BB 2H62C 2MUPA 1IDHA 1KXIA 1V6PA 1NTXA 3NH7A 4AEAA 1CDRA 3HH7A 2PJYB 4BDTB 4UY2C 1KBTA 2QJ9C 2FD6U 1FFJA 1ZADA 1IDLA 2GOOB 1KS6A 1NYSA 3U73U 2LCRA 4EY8B 1LXGA 1CDQA 1W6BA 1I02A 5IMTD 1KBAA 4FAOE 3ERAA 1FSSB 2NBTA 1ONJA 2MJYA 1XT3A 1CXNA 4KSNA 1CODA 1HAJA 1IJCA 2PJYC 1L4WA 1NXBA 2I9BE 1PLOA 1CHVS 2UWRA 3QB4B 1KU6B 1MR6A 2K3GA 2GOOC 2N99A 1RL5A 2HLRA 1ERGA 2L03A 2OFSA 2VLWA 3NEQA 3EBXA 1LXHA 2QJAC 1KFHA 2H7ZB 4BIKB 1JE9A 2H64B 1CREA 2UX2A 1CCQA 4FAOC 1HOYA
chains in the Genus database with same CATH topology
3FEVA 1IQ9A 1NYUA 4IYEA 5DZ5A 1TFSA 1CDTA 2ERAA 1IDIA 3EVSC 1UG4A 6EBXA 1IK8A 1HC9B 2H5FA 2BHIA 4XJJA 1MAHF 2QJBC 3LAQU 1FASA 1VB0A 5EBXA 1CXOA 2LA1A 1KBSA 3BT2U 1IKCA 1LX5B 1COEA 2MFAA 1CDSA 1LSIA 2H7ZA 1CVOA 1DRSA 1NORA 4QTIU 1F94A 4RUDA 1KTZB 2JVEA 1QKEA 3KFDI 2CDXA 5DO6A 2HLQA 1QKDA 2H8UA 1CB9A 2H64C 1FRAA 1CTXA 1QM7A 4ZQYA 1HC9A 2BTXA 2JQPA 2MJ0A 4OM4A 2H62D 1BTEA 1REWC 1IDGA 1F8UB 1NEAA 2CTXA 2MHYA 2QC1A 1JBDA 1G6MA 3U74U 3KFDE 1TGXA 4LFTA 1B41B 3VTSA 4OM5A 1KC4A 1TXAA 2MJ4A 2CRSA 5IMYC 2J8BA 1CRFA 1LJZA 1ABTA 1FSCA 1ERAA 1NTNA 2CRTA 2MUOA 2ABXA 2CCXA 4HQPF 4P7UA 3PLCA 1BXPA 1ES7B 1FF4A 1H0JA 1S4YA 1M9ZA 1YWHA 1JGKA 1KL8A 1RGJA 1TXBA 3NDSA 2L5SA 5DU1A 3BT1U 1HAAA 4DO8A 2X8BB 2H62C 2MUPA 1IDHA 1KXIA 1V6PA 1NTXA 3NH7A 4AEAA 1CDRA 3HH7A 2PJYB 4BDTB 4UY2C 1KBTA 2QJ9C 2FD6U 1FFJA 1ZADA 1IDLA 2GOOB 1KS6A 1NYSA 3U73U 2LCRA 4EY8B 1LXGA 1CDQA 1W6BA 1I02A 5IMTD 1KBAA 4FAOE 3ERAA 1FSSB 2NBTA 1ONJA 2MJYA 1XT3A 1CXNA 4KSNA 1CODA 1HAJA 1IJCA 2PJYC 1L4WA 1NXBA 2I9BE 1PLOA 1CHVS 2UWRA 3QB4B 1KU6B 1MR6A 2K3GA 2GOOC 2N99A 1RL5A 2HLRA 1ERGA 2L03A 2OFSA 2VLWA 3NEQA 3EBXA 1LXHA 2QJAC 1KFHA 2H7ZB 4BIKB 1JE9A 2H64B 1CREA 2UX2A 1CCQA 4FAOC 1HOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEV A;  1IQ9 A;  1NYU A;  4IYE A;  5DZ5 A;  1TFS A;  1CDT A;  2ERA A;  1IDI A;  3EVS C;  1UG4 A;  6EBX A;  1IK8 A;  1HC9 B;  2H5F A;  2BHI A;  4XJJ A;  1MAH F;  2QJB C;  3LAQ U;  1FAS A;  1VB0 A;  5EBX A;  1CXO A;  2LA1 A;  1KBS A;  3BT2 U;  1IKC A;  1LX5 B;  1COE A;  2MFA A;  1CDS A;  1LSI A;  2H7Z A;  1CVO A;  1DRS A;  1NOR A;  4QTI U;  1F94 A;  4RUD A;  1KTZ B;  2JVE A;  1QKE A;  3KFD I;  2CDX A;  5DO6 A;  2HLQ A;  1QKD A;  2H8U A;  1CB9 A;  2H64 C;  1FRA A;  1CTX A;  1QM7 A;  4ZQY A;  1HC9 A;  2BTX A;  2JQP A;  2MJ0 A;  4OM4 A;  2H62 D;  1BTE A;  1REW C;  1IDG A;  1F8U B;  1NEA A;  2CTX A;  2MHY A;  2QC1 A;  1JBD A;  1G6M A;  3U74 U;  3KFD E;  1TGX A;  4LFT A;  1B41 B;  3VTS A;  4OM5 A;  1KC4 A;  1TXA A;  2MJ4 A;  2CRS A;  5IMY C;  2J8B A;  1CRF A;  1LJZ A;  1ABT A;  1FSC A;  1ERA A;  1NTN A;  2CRT A;  2MUO A;  2ABX A;  2CCX A;  4HQP F;  4P7U A;  3PLC A;  1BXP A;  1ES7 B;  1FF4 A;  1H0J A;  1S4Y A;  1M9Z A;  1YWH A;  1JGK A;  1KL8 A;  1RGJ A;  1TXB A;  3NDS A;  2L5S A;  5DU1 A;  3BT1 U;  1HAA A;  4DO8 A;  2X8B B;  2H62 C;  2MUP A;  1IDH A;  1KXI A;  1V6P A;  1NTX A;  3NH7 A;  4AEA A;  1CDR A;  3HH7 A;  2PJY B;  4BDT B;  4UY2 C;  1KBT A;  2QJ9 C;  2FD6 U;  1FFJ A;  1ZAD A;  1IDL A;  2GOO B;  1KS6 A;  1NYS A;  3U73 U;  2LCR A;  4EY8 B;  1LXG A;  1CDQ A;  1W6B A;  1I02 A;  5IMT D;  1KBA A;  4FAO E;  3ERA A;  1FSS B;  2NBT A;  1ONJ A;  2MJY A;  1XT3 A;  1CXN A;  1COD A;  1HAJ A;  1IJC A;  2PJY C;  1L4W A;  1NXB A;  2I9B E;  1PLO A;  1CHV S;  2UWR A;  3QB4 B;  1KU6 B;  1MR6 A;  2K3G A;  2GOO C;  2N99 A;  1RL5 A;  2HLR A;  1ERG A;  2L03 A;  2OFS A;  2VLW A;  3NEQ A;  3EBX A;  1LXH A;  2QJA C;  1KFH A;  2H7Z B;  4BIK B;  1JE9 A;  2H64 B;  1CRE A;  2UX2 A;  1CCQ A;  4FAO C;  1HOY A; 
#chains in the Genus database with same CATH topology
 3FEV A;  1IQ9 A;  1NYU A;  4IYE A;  5DZ5 A;  1TFS A;  1CDT A;  2ERA A;  1IDI A;  3EVS C;  1UG4 A;  6EBX A;  1IK8 A;  1HC9 B;  2H5F A;  2BHI A;  4XJJ A;  1MAH F;  2QJB C;  3LAQ U;  1FAS A;  1VB0 A;  5EBX A;  1CXO A;  2LA1 A;  1KBS A;  3BT2 U;  1IKC A;  1LX5 B;  1COE A;  2MFA A;  1CDS A;  1LSI A;  2H7Z A;  1CVO A;  1DRS A;  1NOR A;  4QTI U;  1F94 A;  4RUD A;  1KTZ B;  2JVE A;  1QKE A;  3KFD I;  2CDX A;  5DO6 A;  2HLQ A;  1QKD A;  2H8U A;  1CB9 A;  2H64 C;  1FRA A;  1CTX A;  1QM7 A;  4ZQY A;  1HC9 A;  2BTX A;  2JQP A;  2MJ0 A;  4OM4 A;  2H62 D;  1BTE A;  1REW C;  1IDG A;  1F8U B;  1NEA A;  2CTX A;  2MHY A;  2QC1 A;  1JBD A;  1G6M A;  3U74 U;  3KFD E;  1TGX A;  4LFT A;  1B41 B;  3VTS A;  4OM5 A;  1KC4 A;  1TXA A;  2MJ4 A;  2CRS A;  5IMY C;  2J8B A;  1CRF A;  1LJZ A;  1ABT A;  1FSC A;  1ERA A;  1NTN A;  2CRT A;  2MUO A;  2ABX A;  2CCX A;  4HQP F;  4P7U A;  3PLC A;  1BXP A;  1ES7 B;  1FF4 A;  1H0J A;  1S4Y A;  1M9Z A;  1YWH A;  1JGK A;  1KL8 A;  1RGJ A;  1TXB A;  3NDS A;  2L5S A;  5DU1 A;  3BT1 U;  1HAA A;  4DO8 A;  2X8B B;  2H62 C;  2MUP A;  1IDH A;  1KXI A;  1V6P A;  1NTX A;  3NH7 A;  4AEA A;  1CDR A;  3HH7 A;  2PJY B;  4BDT B;  4UY2 C;  1KBT A;  2QJ9 C;  2FD6 U;  1FFJ A;  1ZAD A;  1IDL A;  2GOO B;  1KS6 A;  1NYS A;  3U73 U;  2LCR A;  4EY8 B;  1LXG A;  1CDQ A;  1W6B A;  1I02 A;  5IMT D;  1KBA A;  4FAO E;  3ERA A;  1FSS B;  2NBT A;  1ONJ A;  2MJY A;  1XT3 A;  1CXN A;  4KSN A;  1COD A;  1HAJ A;  1IJC A;  2PJY C;  1L4W A;  1NXB A;  2I9B E;  1PLO A;  1CHV S;  2UWR A;  3QB4 B;  1KU6 B;  1MR6 A;  2K3G A;  2GOO C;  2N99 A;  1RL5 A;  2HLR A;  1ERG A;  2L03 A;  2OFS A;  2VLW A;  3NEQ A;  3EBX A;  1LXH A;  2QJA C;  1KFH A;  2H7Z B;  4BIK B;  1JE9 A;  2H64 B;  1CRE A;  2UX2 A;  1CCQ A;  4FAO C;  1HOY A; 
#chains in the Genus database with same CATH homology
 3FEV A;  1IQ9 A;  1NYU A;  4IYE A;  5DZ5 A;  1TFS A;  1CDT A;  2ERA A;  1IDI A;  3EVS C;  1UG4 A;  6EBX A;  1IK8 A;  1HC9 B;  2H5F A;  2BHI A;  4XJJ A;  1MAH F;  2QJB C;  3LAQ U;  1FAS A;  1VB0 A;  5EBX A;  1CXO A;  2LA1 A;  1KBS A;  3BT2 U;  1IKC A;  1LX5 B;  1COE A;  2MFA A;  1CDS A;  1LSI A;  2H7Z A;  1CVO A;  1DRS A;  1NOR A;  4QTI U;  1F94 A;  4RUD A;  1KTZ B;  2JVE A;  1QKE A;  3KFD I;  2CDX A;  5DO6 A;  2HLQ A;  1QKD A;  2H8U A;  1CB9 A;  2H64 C;  1FRA A;  1CTX A;  1QM7 A;  4ZQY A;  1HC9 A;  2BTX A;  2JQP A;  2MJ0 A;  4OM4 A;  2H62 D;  1BTE A;  1REW C;  1IDG A;  1F8U B;  1NEA A;  2CTX A;  2MHY A;  2QC1 A;  1JBD A;  1G6M A;  3U74 U;  3KFD E;  1TGX A;  4LFT A;  1B41 B;  3VTS A;  4OM5 A;  1KC4 A;  1TXA A;  2MJ4 A;  2CRS A;  5IMY C;  2J8B A;  1CRF A;  1LJZ A;  1ABT A;  1FSC A;  1ERA A;  1NTN A;  2CRT A;  2MUO A;  2ABX A;  2CCX A;  4HQP F;  4P7U A;  3PLC A;  1BXP A;  1ES7 B;  1FF4 A;  1H0J A;  1S4Y A;  1M9Z A;  1YWH A;  1JGK A;  1KL8 A;  1RGJ A;  1TXB A;  3NDS A;  2L5S A;  5DU1 A;  3BT1 U;  1HAA A;  4DO8 A;  2X8B B;  2H62 C;  2MUP A;  1IDH A;  1KXI A;  1V6P A;  1NTX A;  3NH7 A;  4AEA A;  1CDR A;  3HH7 A;  2PJY B;  4BDT B;  4UY2 C;  1KBT A;  2QJ9 C;  2FD6 U;  1FFJ A;  1ZAD A;  1IDL A;  2GOO B;  1KS6 A;  1NYS A;  3U73 U;  2LCR A;  4EY8 B;  1LXG A;  1CDQ A;  1W6B A;  1I02 A;  5IMT D;  1KBA A;  4FAO E;  3ERA A;  1FSS B;  2NBT A;  1ONJ A;  2MJY A;  1XT3 A;  1CXN A;  4KSN A;  1COD A;  1HAJ A;  1IJC A;  2PJY C;  1L4W A;  1NXB A;  2I9B E;  1PLO A;  1CHV S;  2UWR A;  3QB4 B;  1KU6 B;  1MR6 A;  2K3G A;  2GOO C;  2N99 A;  1RL5 A;  2HLR A;  1ERG A;  2L03 A;  2OFS A;  2VLW A;  3NEQ A;  3EBX A;  1LXH A;  2QJA C;  1KFH A;  2H7Z B;  4BIK B;  1JE9 A;  2H64 B;  1CRE A;  2UX2 A;  1CCQ A;  4FAO C;  1HOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...