2MUOA

Structure of the trans-(tyr39-pro40) form of the human secreted ly-6/upar related protein-1 (slurp-1)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
82
structure length
82
Chain Sequence
MLKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Neuropeptide
molecule keywords Secreted Ly-6/uPAR-related protein 1
publication title Structural and Functional Properties of Human Secreted Ly-6/uPAR Related Protein-1 (SLURP-1) Imply a Non-Canonical Mode of Interaction with 7 nAChR
rcsb
source organism Homo sapiens
total genus 5
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2muoA00
3U73U 1FFJA 2H64C 3KFDI 2FD6U 1FSSB 1COEA 1LXGA 1IDLA 1BXPA 1HAAA 4FAOC 3HH7A 3VTSA 1VB0A 1NXBA 2H5FA 1KBSA 4HQPF 2MUPA 4IYEA 1CTXA 2H7ZA 1NTNA 1XT3A 1MAHF 1CVOA 1IKCA 1CDSA 1CXNA 1MR6A 1QKDA 4LFTA 1YWHA 2H7ZB 1NTXA 2L03A 1BTEA 1ZADA 2H62D 1CDRA 1JE9A 1HC9A 2MHYA 2OFSA 2CCXA 1LSIA 2CTXA 6EBXA 1IJCA 2JVEA 2HLRA 1KS6A 1F8UB 2QC1A 2X8BB 5DZ5A 3NEQA 2H64B 3NH7A 1CCQA 1CDQA 1CXOA 3PLCA 2CDXA 1L4WA 1LX5B 2CRTA 1FRAA 1TXAA 1ERAA 1IDHA 1DRSA 2QJBC 2MJYA 1KFHA 1CHVS 1LJZA 1ES7B 1FSCA 1CB9A 1HAJA 1TFSA 1W6BA 5DU1A 1KC4A 1QM7A 1CDTA 1REWC 2VLWA 2UWRA 5EBXA 1FF4A 1KBAA 1KBTA 1NEAA 2UX2A 2K3GA 2J8BA 3LAQU 2MUOA 4OM5A 2ABXA 1KL8A 5DO6A 4BIKB 1CREA 1HC9B 1RGJA 1CRFA 2JQPA 2MFAA 2MJ0A 1V6PA 4RUDA 1JGKA 1IQ9A 2L5SA 3U74U 1KTZB 5IMTD 2NBTA 1NYSA 1I02A 2PJYC 1FASA 1NORA 1PLOA 3EVSC 4FAOE 4AEAA 2LCRA 4DO8A 1KU6B 2PJYB 4ZQYA 4QTIU 1QKEA 1G6MA 2I9BE 3BT1U 1RL5A 1CODA 3EBXA 1IDIA 2MJ4A 2N99A 1HOYA 1JBDA 3QB4B 2BTXA 1KXIA 1ABTA 4BDTB 3NDSA 1M9ZA 2LA1A 1ONJA 1B41B 1LXHA 3BT2U 1TXBA 4OM4A 2BHIA 2H8UA 3FEVA 1S4YA 2GOOC 5IMYC 1IDGA 2ERAA 2H62C 4XJJA 2QJ9C 1ERGA 4EY8B 1TGXA 2HLQA 1NYUA 2GOOB 1UG4A 1IK8A 2QJAC 3KFDE 3ERAA 1H0JA 1F94A 4UY2C 4P7UA 2CRSA
chains in the Genus database with same CATH superfamily
3U73U 1FFJA 2H64C 3KFDI 2FD6U 1FSSB 1COEA 1LXGA 1IDLA 1BXPA 1HAAA 4FAOC 3HH7A 3VTSA 1VB0A 1NXBA 2H5FA 1KBSA 4HQPF 2MUPA 4IYEA 1CTXA 2H7ZA 1NTNA 1XT3A 1MAHF 1CVOA 1IKCA 1CDSA 1CXNA 1MR6A 1QKDA 4LFTA 1YWHA 2H7ZB 1NTXA 2L03A 1BTEA 1ZADA 2H62D 1CDRA 1JE9A 1HC9A 2MHYA 2OFSA 2CCXA 1LSIA 2CTXA 6EBXA 1IJCA 2JVEA 2HLRA 1KS6A 1F8UB 2QC1A 2X8BB 5DZ5A 3NEQA 2H64B 3NH7A 1CCQA 1CDQA 1CXOA 3PLCA 2CDXA 1L4WA 1LX5B 2CRTA 1FRAA 1TXAA 1ERAA 1IDHA 1DRSA 2QJBC 2MJYA 1KFHA 1CHVS 1LJZA 1ES7B 1FSCA 1CB9A 1HAJA 1TFSA 1W6BA 5DU1A 1KC4A 1QM7A 1CDTA 1REWC 2VLWA 2UWRA 5EBXA 1FF4A 1KBAA 1KBTA 1NEAA 2UX2A 2K3GA 2J8BA 3LAQU 2MUOA 4OM5A 2ABXA 1KL8A 5DO6A 4BIKB 1CREA 1HC9B 1RGJA 1CRFA 2JQPA 2MFAA 2MJ0A 1V6PA 4RUDA 1JGKA 1IQ9A 2L5SA 3U74U 1KTZB 5IMTD 2NBTA 1NYSA 1I02A 2PJYC 1FASA 1NORA 1PLOA 3EVSC 4FAOE 4AEAA 2LCRA 4DO8A 1KU6B 2PJYB 4ZQYA 4QTIU 1QKEA 1G6MA 2I9BE 3BT1U 1RL5A 1CODA 3EBXA 1IDIA 2MJ4A 2N99A 1HOYA 1JBDA 3QB4B 2BTXA 1KXIA 1ABTA 4BDTB 3NDSA 1M9ZA 2LA1A 1ONJA 1B41B 1LXHA 3BT2U 1TXBA 4OM4A 2BHIA 2H8UA 3FEVA 1S4YA 2GOOC 5IMYC 1IDGA 2ERAA 2H62C 4XJJA 2QJ9C 1ERGA 4EY8B 1TGXA 2HLQA 1NYUA 2GOOB 4KSNA 1UG4A 1IK8A 2QJAC 3KFDE 3ERAA 1H0JA 1F94A 4UY2C 4P7UA 2CRSA
chains in the Genus database with same CATH topology
3U73U 1FFJA 2H64C 3KFDI 2FD6U 1FSSB 1COEA 1LXGA 1IDLA 1BXPA 1HAAA 4FAOC 3HH7A 3VTSA 1VB0A 1NXBA 2H5FA 1KBSA 4HQPF 2MUPA 4IYEA 1CTXA 2H7ZA 1NTNA 1XT3A 1MAHF 1CVOA 1IKCA 1CDSA 1CXNA 1MR6A 1QKDA 4LFTA 1YWHA 2H7ZB 1NTXA 2L03A 1BTEA 1ZADA 2H62D 1CDRA 1JE9A 1HC9A 2MHYA 2OFSA 2CCXA 1LSIA 2CTXA 6EBXA 1IJCA 2JVEA 2HLRA 1KS6A 1F8UB 2QC1A 2X8BB 5DZ5A 3NEQA 2H64B 3NH7A 1CCQA 1CDQA 1CXOA 3PLCA 2CDXA 1L4WA 1LX5B 2CRTA 1FRAA 1TXAA 1ERAA 1IDHA 1DRSA 2QJBC 2MJYA 1KFHA 1CHVS 1LJZA 1ES7B 1FSCA 1CB9A 1HAJA 1TFSA 1W6BA 5DU1A 1KC4A 1QM7A 1CDTA 1REWC 2VLWA 2UWRA 5EBXA 1FF4A 1KBAA 1KBTA 1NEAA 2UX2A 2K3GA 2J8BA 3LAQU 2MUOA 4OM5A 2ABXA 1KL8A 5DO6A 4BIKB 1CREA 1HC9B 1RGJA 1CRFA 2JQPA 2MFAA 2MJ0A 1V6PA 4RUDA 1JGKA 1IQ9A 2L5SA 3U74U 1KTZB 5IMTD 2NBTA 1NYSA 1I02A 2PJYC 1FASA 1NORA 1PLOA 3EVSC 4FAOE 4AEAA 2LCRA 4DO8A 1KU6B 2PJYB 4ZQYA 4QTIU 1QKEA 1G6MA 2I9BE 3BT1U 1RL5A 1CODA 3EBXA 1IDIA 2MJ4A 2N99A 1HOYA 1JBDA 3QB4B 2BTXA 1KXIA 1ABTA 4BDTB 3NDSA 1M9ZA 2LA1A 1ONJA 1B41B 1LXHA 3BT2U 1TXBA 4OM4A 2BHIA 2H8UA 3FEVA 1S4YA 2GOOC 5IMYC 1IDGA 2ERAA 2H62C 4XJJA 2QJ9C 1ERGA 4EY8B 1TGXA 2HLQA 1NYUA 2GOOB 4KSNA 1UG4A 1IK8A 2QJAC 3KFDE 3ERAA 1H0JA 1F94A 4UY2C 4P7UA 2CRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U73 U;  1FFJ A;  2H64 C;  3KFD I;  2FD6 U;  1FSS B;  1COE A;  1LXG A;  1IDL A;  1BXP A;  1HAA A;  4FAO C;  3HH7 A;  3VTS A;  1VB0 A;  1NXB A;  2H5F A;  1KBS A;  4HQP F;  2MUP A;  4IYE A;  1CTX A;  2H7Z A;  1NTN A;  1XT3 A;  1MAH F;  1CVO A;  1IKC A;  1CDS A;  1CXN A;  1MR6 A;  1QKD A;  4LFT A;  1YWH A;  2H7Z B;  1NTX A;  2L03 A;  1BTE A;  1ZAD A;  2H62 D;  1CDR A;  1JE9 A;  1HC9 A;  2MHY A;  2OFS A;  2CCX A;  1LSI A;  2CTX A;  6EBX A;  1IJC A;  2JVE A;  2HLR A;  1KS6 A;  1F8U B;  2QC1 A;  2X8B B;  5DZ5 A;  3NEQ A;  2H64 B;  3NH7 A;  1CCQ A;  1CDQ A;  1CXO A;  3PLC A;  2CDX A;  1L4W A;  1LX5 B;  2CRT A;  1FRA A;  1TXA A;  1ERA A;  1IDH A;  1DRS A;  2QJB C;  2MJY A;  1KFH A;  1CHV S;  1LJZ A;  1ES7 B;  1FSC A;  1CB9 A;  1HAJ A;  1TFS A;  1W6B A;  5DU1 A;  1KC4 A;  1QM7 A;  1CDT A;  1REW C;  2VLW A;  2UWR A;  5EBX A;  1FF4 A;  1KBA A;  1KBT A;  1NEA A;  2UX2 A;  2K3G A;  2J8B A;  3LAQ U;  2MUO A;  4OM5 A;  2ABX A;  1KL8 A;  5DO6 A;  4BIK B;  1CRE A;  1HC9 B;  1RGJ A;  1CRF A;  2JQP A;  2MFA A;  2MJ0 A;  1V6P A;  4RUD A;  1JGK A;  1IQ9 A;  2L5S A;  3U74 U;  1KTZ B;  5IMT D;  2NBT A;  1NYS A;  1I02 A;  2PJY C;  1FAS A;  1NOR A;  1PLO A;  3EVS C;  4FAO E;  4AEA A;  2LCR A;  4DO8 A;  1KU6 B;  2PJY B;  4ZQY A;  4QTI U;  1QKE A;  1G6M A;  2I9B E;  3BT1 U;  1RL5 A;  1COD A;  3EBX A;  1IDI A;  2MJ4 A;  2N99 A;  1HOY A;  1JBD A;  3QB4 B;  2BTX A;  1KXI A;  1ABT A;  4BDT B;  3NDS A;  1M9Z A;  2LA1 A;  1ONJ A;  1B41 B;  1LXH A;  3BT2 U;  1TXB A;  4OM4 A;  2BHI A;  2H8U A;  3FEV A;  1S4Y A;  2GOO C;  5IMY C;  1IDG A;  2ERA A;  2H62 C;  4XJJ A;  2QJ9 C;  1ERG A;  4EY8 B;  1TGX A;  2HLQ A;  1NYU A;  2GOO B;  1UG4 A;  1IK8 A;  2QJA C;  3KFD E;  3ERA A;  1H0J A;  1F94 A;  4UY2 C;  4P7U A;  2CRS A; 
#chains in the Genus database with same CATH topology
 3U73 U;  1FFJ A;  2H64 C;  3KFD I;  2FD6 U;  1FSS B;  1COE A;  1LXG A;  1IDL A;  1BXP A;  1HAA A;  4FAO C;  3HH7 A;  3VTS A;  1VB0 A;  1NXB A;  2H5F A;  1KBS A;  4HQP F;  2MUP A;  4IYE A;  1CTX A;  2H7Z A;  1NTN A;  1XT3 A;  1MAH F;  1CVO A;  1IKC A;  1CDS A;  1CXN A;  1MR6 A;  1QKD A;  4LFT A;  1YWH A;  2H7Z B;  1NTX A;  2L03 A;  1BTE A;  1ZAD A;  2H62 D;  1CDR A;  1JE9 A;  1HC9 A;  2MHY A;  2OFS A;  2CCX A;  1LSI A;  2CTX A;  6EBX A;  1IJC A;  2JVE A;  2HLR A;  1KS6 A;  1F8U B;  2QC1 A;  2X8B B;  5DZ5 A;  3NEQ A;  2H64 B;  3NH7 A;  1CCQ A;  1CDQ A;  1CXO A;  3PLC A;  2CDX A;  1L4W A;  1LX5 B;  2CRT A;  1FRA A;  1TXA A;  1ERA A;  1IDH A;  1DRS A;  2QJB C;  2MJY A;  1KFH A;  1CHV S;  1LJZ A;  1ES7 B;  1FSC A;  1CB9 A;  1HAJ A;  1TFS A;  1W6B A;  5DU1 A;  1KC4 A;  1QM7 A;  1CDT A;  1REW C;  2VLW A;  2UWR A;  5EBX A;  1FF4 A;  1KBA A;  1KBT A;  1NEA A;  2UX2 A;  2K3G A;  2J8B A;  3LAQ U;  2MUO A;  4OM5 A;  2ABX A;  1KL8 A;  5DO6 A;  4BIK B;  1CRE A;  1HC9 B;  1RGJ A;  1CRF A;  2JQP A;  2MFA A;  2MJ0 A;  1V6P A;  4RUD A;  1JGK A;  1IQ9 A;  2L5S A;  3U74 U;  1KTZ B;  5IMT D;  2NBT A;  1NYS A;  1I02 A;  2PJY C;  1FAS A;  1NOR A;  1PLO A;  3EVS C;  4FAO E;  4AEA A;  2LCR A;  4DO8 A;  1KU6 B;  2PJY B;  4ZQY A;  4QTI U;  1QKE A;  1G6M A;  2I9B E;  3BT1 U;  1RL5 A;  1COD A;  3EBX A;  1IDI A;  2MJ4 A;  2N99 A;  1HOY A;  1JBD A;  3QB4 B;  2BTX A;  1KXI A;  1ABT A;  4BDT B;  3NDS A;  1M9Z A;  2LA1 A;  1ONJ A;  1B41 B;  1LXH A;  3BT2 U;  1TXB A;  4OM4 A;  2BHI A;  2H8U A;  3FEV A;  1S4Y A;  2GOO C;  5IMY C;  1IDG A;  2ERA A;  2H62 C;  4XJJ A;  2QJ9 C;  1ERG A;  4EY8 B;  1TGX A;  2HLQ A;  1NYU A;  2GOO B;  4KSN A;  1UG4 A;  1IK8 A;  2QJA C;  3KFD E;  3ERA A;  1H0J A;  1F94 A;  4UY2 C;  4P7U A;  2CRS A; 
#chains in the Genus database with same CATH homology
 3U73 U;  1FFJ A;  2H64 C;  3KFD I;  2FD6 U;  1FSS B;  1COE A;  1LXG A;  1IDL A;  1BXP A;  1HAA A;  4FAO C;  3HH7 A;  3VTS A;  1VB0 A;  1NXB A;  2H5F A;  1KBS A;  4HQP F;  2MUP A;  4IYE A;  1CTX A;  2H7Z A;  1NTN A;  1XT3 A;  1MAH F;  1CVO A;  1IKC A;  1CDS A;  1CXN A;  1MR6 A;  1QKD A;  4LFT A;  1YWH A;  2H7Z B;  1NTX A;  2L03 A;  1BTE A;  1ZAD A;  2H62 D;  1CDR A;  1JE9 A;  1HC9 A;  2MHY A;  2OFS A;  2CCX A;  1LSI A;  2CTX A;  6EBX A;  1IJC A;  2JVE A;  2HLR A;  1KS6 A;  1F8U B;  2QC1 A;  2X8B B;  5DZ5 A;  3NEQ A;  2H64 B;  3NH7 A;  1CCQ A;  1CDQ A;  1CXO A;  3PLC A;  2CDX A;  1L4W A;  1LX5 B;  2CRT A;  1FRA A;  1TXA A;  1ERA A;  1IDH A;  1DRS A;  2QJB C;  2MJY A;  1KFH A;  1CHV S;  1LJZ A;  1ES7 B;  1FSC A;  1CB9 A;  1HAJ A;  1TFS A;  1W6B A;  5DU1 A;  1KC4 A;  1QM7 A;  1CDT A;  1REW C;  2VLW A;  2UWR A;  5EBX A;  1FF4 A;  1KBA A;  1KBT A;  1NEA A;  2UX2 A;  2K3G A;  2J8B A;  3LAQ U;  2MUO A;  4OM5 A;  2ABX A;  1KL8 A;  5DO6 A;  4BIK B;  1CRE A;  1HC9 B;  1RGJ A;  1CRF A;  2JQP A;  2MFA A;  2MJ0 A;  1V6P A;  4RUD A;  1JGK A;  1IQ9 A;  2L5S A;  3U74 U;  1KTZ B;  5IMT D;  2NBT A;  1NYS A;  1I02 A;  2PJY C;  1FAS A;  1NOR A;  1PLO A;  3EVS C;  4FAO E;  4AEA A;  2LCR A;  4DO8 A;  1KU6 B;  2PJY B;  4ZQY A;  4QTI U;  1QKE A;  1G6M A;  2I9B E;  3BT1 U;  1RL5 A;  1COD A;  3EBX A;  1IDI A;  2MJ4 A;  2N99 A;  1HOY A;  1JBD A;  3QB4 B;  2BTX A;  1KXI A;  1ABT A;  4BDT B;  3NDS A;  1M9Z A;  2LA1 A;  1ONJ A;  1B41 B;  1LXH A;  3BT2 U;  1TXB A;  4OM4 A;  2BHI A;  2H8U A;  3FEV A;  1S4Y A;  2GOO C;  5IMY C;  1IDG A;  2ERA A;  2H62 C;  4XJJ A;  2QJ9 C;  1ERG A;  4EY8 B;  1TGX A;  2HLQ A;  1NYU A;  2GOO B;  4KSN A;  1UG4 A;  1IK8 A;  2QJA C;  3KFD E;  3ERA A;  1H0J A;  1F94 A;  4UY2 C;  4P7U A;  2CRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...