2MUOA

Structure of the trans-(tyr39-pro40) form of the human secreted ly-6/upar related protein-1 (slurp-1)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
82
structure length
82
Chain Sequence
MLKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Properties of Human Secreted Ly-6/uPAR Related Protein-1 (SLURP-1) Imply a Non-Canonical Mode of Interaction with 7 nAChR
rcsb
source organism Homo sapiens
molecule tags Neuropeptide
molecule keywords Secreted Ly-6/uPAR-related protein 1
total genus 5
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2muoA00
3U73U 2HLQA 1QM7A 2MJYA 1FF4A 2K3GA 1FASA 2X8BB 1ONJA 4RUDA 1NTNA 1M9ZA 2MUOA 1CDSA 2ERAA 4EY8B 1LX5B 1ERGA 1F8UB 4OM5A 2CTXA 4QTIU 3HH7A 2CRTA 1CODA 1TGXA 2BHIA 1CREA 1LXHA 1CDRA 5DZ5A 3QB4B 3EVSC 1CB9A 1CRFA 1FFJA 1KC4A 1NEAA 2JVEA 1COEA 2UX2A 1NYUA 1KS6A 3ERAA 1CDQA 2H64B 2VLWA 1CTXA 1IK8A 1JGKA 2UWRA 1CXNA 2QJBC 4AEAA 3BT1U 1IDHA 2CDXA 1FSSB 1MR6A 1IJCA 4BDTB 1TFSA 1IDIA 1HAJA 2H8UA 1ES7B 2PJYB 3BT2U 2LCRA 1JE9A 1I02A 1DRSA 1RL5A 1QKEA 1S4YA 6EBXA 1KBSA 1F94A 1IDGA 1REWC 2LA1A 2QC1A 1CVOA 2PJYC 1ERAA 1RGJA 1HC9A 4FAOE 1B41B 4HQPF 1PLOA 1HC9B 1G6MA 2ABXA 1IKCA 1HAAA 1TXBA 2QJ9C 1BTEA 3NH7A 1BXPA 3FEVA 1CCQA 2H7ZB 3VTSA 4FAOC 2H7ZA 2H64C 4P7UA 1LSIA 1MAHF 1NORA 2I9BE 3PLCA 1L4WA 1VB0A 2MFAA 4OM4A 2MHYA 1KL8A 2OFSA 2QJAC 3EBXA 2J8BA 5DO6A 3LAQU 2GOOB 1KBAA 2MJ0A 1YWHA 2BTXA 3U74U 1NYSA 1IDLA 1H0JA 4DO8A 1NTXA 1FRAA 1ABTA 5EBXA 4LFTA 1JBDA 1QKDA 2H5FA 1LXGA 2L5SA 5DU1A 3KFDI 1UG4A 4BIKB 2H62C 2GOOC 2MUPA 2MJ4A 1CDTA 1KTZB 1KFHA 4IYEA 4ZQYA 2NBTA 5IMTD 3NEQA 3KFDE 2JQPA 1TXAA 2CCXA 2H62D 1CHVS 2HLRA 1HOYA 1FSCA 1KU6B 1KXIA 1ZADA 1V6PA 1KBTA 2CRSA 1CXOA 4XJJA 1LJZA 4UY2C 1NXBA 1IQ9A 3NDSA 5IMYC 1W6BA 2L03A 2N99A 1XT3A 2FD6U
chains in the Genus database with same CATH superfamily
3U73U 2HLQA 1QM7A 2MJYA 1FF4A 2K3GA 1FASA 2X8BB 1ONJA 4RUDA 1NTNA 1M9ZA 2MUOA 1CDSA 2ERAA 4EY8B 1LX5B 1ERGA 1F8UB 4OM5A 2CTXA 4QTIU 3HH7A 2CRTA 1CODA 1TGXA 2BHIA 1CREA 1LXHA 1CDRA 5DZ5A 3QB4B 3EVSC 1CB9A 1CRFA 1FFJA 1KC4A 1NEAA 2JVEA 1COEA 2UX2A 1NYUA 1KS6A 3ERAA 1CDQA 2H64B 2VLWA 1CTXA 1IK8A 1JGKA 2UWRA 1CXNA 2QJBC 4AEAA 3BT1U 1IDHA 2CDXA 1FSSB 1MR6A 1IJCA 4BDTB 1TFSA 1IDIA 1HAJA 2H8UA 1ES7B 2PJYB 3BT2U 2LCRA 1JE9A 1I02A 1DRSA 1RL5A 1QKEA 1S4YA 6EBXA 1KBSA 1F94A 1IDGA 1REWC 2LA1A 2QC1A 1CVOA 2PJYC 1ERAA 1RGJA 1HC9A 4FAOE 1B41B 4HQPF 1PLOA 1HC9B 1G6MA 2ABXA 1IKCA 1HAAA 1TXBA 2QJ9C 1BTEA 3NH7A 1BXPA 3FEVA 1CCQA 2H7ZB 3VTSA 4FAOC 2H7ZA 2H64C 4P7UA 1LSIA 1MAHF 1NORA 2I9BE 3PLCA 1L4WA 1VB0A 2MFAA 4OM4A 2MHYA 1KL8A 2OFSA 2QJAC 3EBXA 2J8BA 5DO6A 3LAQU 2GOOB 1KBAA 2MJ0A 1YWHA 2BTXA 3U74U 1NYSA 1IDLA 1H0JA 4DO8A 1NTXA 1FRAA 1ABTA 5EBXA 4LFTA 1JBDA 1QKDA 2H5FA 1LXGA 2L5SA 5DU1A 3KFDI 1UG4A 4BIKB 2H62C 2GOOC 2MUPA 2MJ4A 1CDTA 1KTZB 1KFHA 4IYEA 4ZQYA 2NBTA 5IMTD 3NEQA 3KFDE 2JQPA 1TXAA 2CCXA 2H62D 4KSNA 1CHVS 2HLRA 1HOYA 1FSCA 1KU6B 1KXIA 1ZADA 1V6PA 1KBTA 2CRSA 1CXOA 4XJJA 1LJZA 4UY2C 1NXBA 1IQ9A 3NDSA 5IMYC 1W6BA 2L03A 2N99A 1XT3A 2FD6U
chains in the Genus database with same CATH topology
3U73U 2HLQA 1QM7A 2MJYA 1FF4A 2K3GA 1FASA 2X8BB 1ONJA 4RUDA 1NTNA 1M9ZA 2MUOA 1CDSA 2ERAA 4EY8B 1LX5B 1ERGA 1F8UB 4OM5A 2CTXA 4QTIU 3HH7A 2CRTA 1CODA 1TGXA 2BHIA 1CREA 1LXHA 1CDRA 5DZ5A 3QB4B 3EVSC 1CB9A 1CRFA 1FFJA 1KC4A 1NEAA 2JVEA 1COEA 2UX2A 1NYUA 1KS6A 3ERAA 1CDQA 2H64B 2VLWA 1CTXA 1IK8A 1JGKA 2UWRA 1CXNA 2QJBC 4AEAA 3BT1U 1IDHA 2CDXA 1FSSB 1MR6A 1IJCA 4BDTB 1TFSA 1IDIA 1HAJA 2H8UA 1ES7B 2PJYB 3BT2U 2LCRA 1JE9A 1I02A 1DRSA 1RL5A 1QKEA 1S4YA 6EBXA 1KBSA 1F94A 1IDGA 1REWC 2LA1A 2QC1A 1CVOA 2PJYC 1ERAA 1RGJA 1HC9A 4FAOE 1B41B 4HQPF 1PLOA 1HC9B 1G6MA 2ABXA 1IKCA 1HAAA 1TXBA 2QJ9C 1BTEA 3NH7A 1BXPA 3FEVA 1CCQA 2H7ZB 3VTSA 4FAOC 2H7ZA 2H64C 4P7UA 1LSIA 1MAHF 1NORA 2I9BE 3PLCA 1L4WA 1VB0A 2MFAA 4OM4A 2MHYA 1KL8A 2OFSA 2QJAC 3EBXA 2J8BA 5DO6A 3LAQU 2GOOB 1KBAA 2MJ0A 1YWHA 2BTXA 3U74U 1NYSA 1IDLA 1H0JA 4DO8A 1NTXA 1FRAA 1ABTA 5EBXA 4LFTA 1JBDA 1QKDA 2H5FA 1LXGA 2L5SA 5DU1A 3KFDI 1UG4A 4BIKB 2H62C 2GOOC 2MUPA 2MJ4A 1CDTA 1KTZB 1KFHA 4IYEA 4ZQYA 2NBTA 5IMTD 3NEQA 3KFDE 2JQPA 1TXAA 2CCXA 2H62D 4KSNA 1CHVS 2HLRA 1HOYA 1FSCA 1KU6B 1KXIA 1ZADA 1V6PA 1KBTA 2CRSA 1CXOA 4XJJA 1LJZA 4UY2C 1NXBA 1IQ9A 3NDSA 5IMYC 1W6BA 2L03A 2N99A 1XT3A 2FD6U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U73 U;  2HLQ A;  1QM7 A;  2MJY A;  1FF4 A;  2K3G A;  1FAS A;  2X8B B;  1ONJ A;  4RUD A;  1NTN A;  1M9Z A;  2MUO A;  1CDS A;  2ERA A;  4EY8 B;  1LX5 B;  1ERG A;  1F8U B;  4OM5 A;  2CTX A;  4QTI U;  3HH7 A;  2CRT A;  1COD A;  1TGX A;  2BHI A;  1CRE A;  1LXH A;  1CDR A;  5DZ5 A;  3QB4 B;  3EVS C;  1CB9 A;  1CRF A;  1FFJ A;  1KC4 A;  1NEA A;  2JVE A;  1COE A;  2UX2 A;  1NYU A;  1KS6 A;  3ERA A;  1CDQ A;  2H64 B;  2VLW A;  1CTX A;  1IK8 A;  1JGK A;  2UWR A;  1CXN A;  2QJB C;  4AEA A;  3BT1 U;  1IDH A;  2CDX A;  1FSS B;  1MR6 A;  1IJC A;  4BDT B;  1TFS A;  1IDI A;  1HAJ A;  2H8U A;  1ES7 B;  2PJY B;  3BT2 U;  2LCR A;  1JE9 A;  1I02 A;  1DRS A;  1RL5 A;  1QKE A;  1S4Y A;  6EBX A;  1KBS A;  1F94 A;  1IDG A;  1REW C;  2LA1 A;  2QC1 A;  1CVO A;  2PJY C;  1ERA A;  1RGJ A;  1HC9 A;  4FAO E;  1B41 B;  4HQP F;  1PLO A;  1HC9 B;  1G6M A;  2ABX A;  1IKC A;  1HAA A;  1TXB A;  2QJ9 C;  1BTE A;  3NH7 A;  1BXP A;  3FEV A;  1CCQ A;  2H7Z B;  3VTS A;  4FAO C;  2H7Z A;  2H64 C;  4P7U A;  1LSI A;  1MAH F;  1NOR A;  2I9B E;  3PLC A;  1L4W A;  1VB0 A;  2MFA A;  4OM4 A;  2MHY A;  1KL8 A;  2OFS A;  2QJA C;  3EBX A;  2J8B A;  5DO6 A;  3LAQ U;  2GOO B;  1KBA A;  2MJ0 A;  1YWH A;  2BTX A;  3U74 U;  1NYS A;  1IDL A;  1H0J A;  4DO8 A;  1NTX A;  1FRA A;  1ABT A;  5EBX A;  4LFT A;  1JBD A;  1QKD A;  2H5F A;  1LXG A;  2L5S A;  5DU1 A;  3KFD I;  1UG4 A;  4BIK B;  2H62 C;  2GOO C;  2MUP A;  2MJ4 A;  1CDT A;  1KTZ B;  1KFH A;  4IYE A;  4ZQY A;  2NBT A;  5IMT D;  3NEQ A;  3KFD E;  2JQP A;  1TXA A;  2CCX A;  2H62 D;  1CHV S;  2HLR A;  1HOY A;  1FSC A;  1KU6 B;  1KXI A;  1ZAD A;  1V6P A;  1KBT A;  2CRS A;  1CXO A;  4XJJ A;  1LJZ A;  4UY2 C;  1NXB A;  1IQ9 A;  3NDS A;  5IMY C;  1W6B A;  2L03 A;  2N99 A;  1XT3 A;  2FD6 U; 
#chains in the Genus database with same CATH topology
 3U73 U;  2HLQ A;  1QM7 A;  2MJY A;  1FF4 A;  2K3G A;  1FAS A;  2X8B B;  1ONJ A;  4RUD A;  1NTN A;  1M9Z A;  2MUO A;  1CDS A;  2ERA A;  4EY8 B;  1LX5 B;  1ERG A;  1F8U B;  4OM5 A;  2CTX A;  4QTI U;  3HH7 A;  2CRT A;  1COD A;  1TGX A;  2BHI A;  1CRE A;  1LXH A;  1CDR A;  5DZ5 A;  3QB4 B;  3EVS C;  1CB9 A;  1CRF A;  1FFJ A;  1KC4 A;  1NEA A;  2JVE A;  1COE A;  2UX2 A;  1NYU A;  1KS6 A;  3ERA A;  1CDQ A;  2H64 B;  2VLW A;  1CTX A;  1IK8 A;  1JGK A;  2UWR A;  1CXN A;  2QJB C;  4AEA A;  3BT1 U;  1IDH A;  2CDX A;  1FSS B;  1MR6 A;  1IJC A;  4BDT B;  1TFS A;  1IDI A;  1HAJ A;  2H8U A;  1ES7 B;  2PJY B;  3BT2 U;  2LCR A;  1JE9 A;  1I02 A;  1DRS A;  1RL5 A;  1QKE A;  1S4Y A;  6EBX A;  1KBS A;  1F94 A;  1IDG A;  1REW C;  2LA1 A;  2QC1 A;  1CVO A;  2PJY C;  1ERA A;  1RGJ A;  1HC9 A;  4FAO E;  1B41 B;  4HQP F;  1PLO A;  1HC9 B;  1G6M A;  2ABX A;  1IKC A;  1HAA A;  1TXB A;  2QJ9 C;  1BTE A;  3NH7 A;  1BXP A;  3FEV A;  1CCQ A;  2H7Z B;  3VTS A;  4FAO C;  2H7Z A;  2H64 C;  4P7U A;  1LSI A;  1MAH F;  1NOR A;  2I9B E;  3PLC A;  1L4W A;  1VB0 A;  2MFA A;  4OM4 A;  2MHY A;  1KL8 A;  2OFS A;  2QJA C;  3EBX A;  2J8B A;  5DO6 A;  3LAQ U;  2GOO B;  1KBA A;  2MJ0 A;  1YWH A;  2BTX A;  3U74 U;  1NYS A;  1IDL A;  1H0J A;  4DO8 A;  1NTX A;  1FRA A;  1ABT A;  5EBX A;  4LFT A;  1JBD A;  1QKD A;  2H5F A;  1LXG A;  2L5S A;  5DU1 A;  3KFD I;  1UG4 A;  4BIK B;  2H62 C;  2GOO C;  2MUP A;  2MJ4 A;  1CDT A;  1KTZ B;  1KFH A;  4IYE A;  4ZQY A;  2NBT A;  5IMT D;  3NEQ A;  3KFD E;  2JQP A;  1TXA A;  2CCX A;  2H62 D;  4KSN A;  1CHV S;  2HLR A;  1HOY A;  1FSC A;  1KU6 B;  1KXI A;  1ZAD A;  1V6P A;  1KBT A;  2CRS A;  1CXO A;  4XJJ A;  1LJZ A;  4UY2 C;  1NXB A;  1IQ9 A;  3NDS A;  5IMY C;  1W6B A;  2L03 A;  2N99 A;  1XT3 A;  2FD6 U; 
#chains in the Genus database with same CATH homology
 3U73 U;  2HLQ A;  1QM7 A;  2MJY A;  1FF4 A;  2K3G A;  1FAS A;  2X8B B;  1ONJ A;  4RUD A;  1NTN A;  1M9Z A;  2MUO A;  1CDS A;  2ERA A;  4EY8 B;  1LX5 B;  1ERG A;  1F8U B;  4OM5 A;  2CTX A;  4QTI U;  3HH7 A;  2CRT A;  1COD A;  1TGX A;  2BHI A;  1CRE A;  1LXH A;  1CDR A;  5DZ5 A;  3QB4 B;  3EVS C;  1CB9 A;  1CRF A;  1FFJ A;  1KC4 A;  1NEA A;  2JVE A;  1COE A;  2UX2 A;  1NYU A;  1KS6 A;  3ERA A;  1CDQ A;  2H64 B;  2VLW A;  1CTX A;  1IK8 A;  1JGK A;  2UWR A;  1CXN A;  2QJB C;  4AEA A;  3BT1 U;  1IDH A;  2CDX A;  1FSS B;  1MR6 A;  1IJC A;  4BDT B;  1TFS A;  1IDI A;  1HAJ A;  2H8U A;  1ES7 B;  2PJY B;  3BT2 U;  2LCR A;  1JE9 A;  1I02 A;  1DRS A;  1RL5 A;  1QKE A;  1S4Y A;  6EBX A;  1KBS A;  1F94 A;  1IDG A;  1REW C;  2LA1 A;  2QC1 A;  1CVO A;  2PJY C;  1ERA A;  1RGJ A;  1HC9 A;  4FAO E;  1B41 B;  4HQP F;  1PLO A;  1HC9 B;  1G6M A;  2ABX A;  1IKC A;  1HAA A;  1TXB A;  2QJ9 C;  1BTE A;  3NH7 A;  1BXP A;  3FEV A;  1CCQ A;  2H7Z B;  3VTS A;  4FAO C;  2H7Z A;  2H64 C;  4P7U A;  1LSI A;  1MAH F;  1NOR A;  2I9B E;  3PLC A;  1L4W A;  1VB0 A;  2MFA A;  4OM4 A;  2MHY A;  1KL8 A;  2OFS A;  2QJA C;  3EBX A;  2J8B A;  5DO6 A;  3LAQ U;  2GOO B;  1KBA A;  2MJ0 A;  1YWH A;  2BTX A;  3U74 U;  1NYS A;  1IDL A;  1H0J A;  4DO8 A;  1NTX A;  1FRA A;  1ABT A;  5EBX A;  4LFT A;  1JBD A;  1QKD A;  2H5F A;  1LXG A;  2L5S A;  5DU1 A;  3KFD I;  1UG4 A;  4BIK B;  2H62 C;  2GOO C;  2MUP A;  2MJ4 A;  1CDT A;  1KTZ B;  1KFH A;  4IYE A;  4ZQY A;  2NBT A;  5IMT D;  3NEQ A;  3KFD E;  2JQP A;  1TXA A;  2CCX A;  2H62 D;  4KSN A;  1CHV S;  2HLR A;  1HOY A;  1FSC A;  1KU6 B;  1KXI A;  1ZAD A;  1V6P A;  1KBT A;  2CRS A;  1CXO A;  4XJJ A;  1LJZ A;  4UY2 C;  1NXB A;  1IQ9 A;  3NDS A;  5IMY C;  1W6B A;  2L03 A;  2N99 A;  1XT3 A;  2FD6 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...