2MUOA

Structure of the trans-(tyr39-pro40) form of the human secreted ly-6/upar related protein-1 (slurp-1)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
82
structure length
82
Chain Sequence
MLKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Secreted Ly-6/uPAR-related protein 1
publication title Structural and Functional Properties of Human Secreted Ly-6/uPAR Related Protein-1 (SLURP-1) Imply a Non-Canonical Mode of Interaction with 7 nAChR
rcsb
source organism Homo sapiens
molecule tags Neuropeptide
total genus 5
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2muoA00
1BTEA 2NBTA 3KFDI 4RUDA 3U73U 2MUOA 3HH7A 4BIKB 1FRAA 1JE9A 1CRFA 1FASA 2H62C 1HAAA 2UWRA 1VB0A 4ZQYA 1LSIA 1KTZB 2H7ZA 1RL5A 1NYUA 2QJAC 1ES7B 3NH7A 2CDXA 1H0JA 1FF4A 5IMTD 1FSCA 1MAHF 3VTSA 1LJZA 1NORA 1KBTA 3NEQA 4QTIU 2FD6U 1YWHA 1JBDA 2HLQA 1BXPA 1F94A 1RGJA 1IDHA 1FSSB 3QB4B 1CB9A 1CXNA 4OM4A 2MFAA 2MJYA 2HLRA 2N99A 1ABTA 1NXBA 1TXAA 2OFSA 2QC1A 4UY2C 1ZADA 1IQ9A 1CDQA 1CODA 1IDGA 2VLWA 2BHIA 2CTXA 1IK8A 3ERAA 1NTXA 2H7ZB 6EBXA 2BTXA 1CTXA 4P7UA 1CVOA 1KBAA 3NDSA 4XJJA 5IMYC 1MR6A 1ERGA 1KL8A 3LAQU 3U74U 1F8UB 2CCXA 4DO8A 1L4WA 3BT2U 4BDTB 2J8BA 1B41B 1ERAA 2JVEA 1HC9A 2H64B 1LXGA 3KFDE 5DZ5A 1CXOA 2L03A 3EBXA 1IDLA 1KS6A 1I02A 2ABXA 2H62D 4IYEA 1KC4A 2X8BB 1CDTA 4FAOE 1HAJA 5DO6A 2ERAA 4LFTA 3BT1U 2CRSA 3FEVA 4HQPF 2H64C 2MJ0A 1G6MA 1HOYA 4EY8B 1M9ZA 1REWC 1KXIA 2MHYA 1KU6B 1IJCA 1COEA 1FFJA 2I9BE 1CDRA 1JGKA 4FAOC 1NTNA 1HC9B 1S4YA 1CDSA 1W6BA 2MUPA 1PLOA 1UG4A 1CHVS 2GOOB 1CCQA 1CREA 2MJ4A 2LA1A 1IDIA 1QM7A 2PJYB 2QJ9C 3PLCA 1NEAA 2L5SA 2JQPA 1XT3A 1NYSA 2H8UA 2LCRA 3EVSC 1KBSA 2GOOC 1TXBA 2UX2A 4OM5A 2K3GA 2H5FA 1QKDA 2PJYC 1ONJA 5EBXA 1TGXA 1DRSA 1KFHA 1IKCA 1QKEA 1LX5B 2CRTA 2QJBC 4AEAA 1TFSA 1LXHA 5DU1A 1V6PA
chains in the Genus database with same CATH superfamily
1BTEA 2NBTA 3KFDI 4RUDA 3U73U 2MUOA 3HH7A 4BIKB 1FRAA 1JE9A 1CRFA 1FASA 2H62C 1HAAA 2UWRA 1VB0A 4ZQYA 1LSIA 1KTZB 2H7ZA 1RL5A 1NYUA 2QJAC 1ES7B 3NH7A 2CDXA 1H0JA 1FF4A 5IMTD 1FSCA 1MAHF 3VTSA 1LJZA 1NORA 1KBTA 3NEQA 4QTIU 2FD6U 1YWHA 1JBDA 2HLQA 1BXPA 1F94A 1RGJA 1IDHA 1FSSB 3QB4B 1CB9A 1CXNA 4OM4A 2MFAA 2MJYA 2HLRA 2N99A 1ABTA 1NXBA 1TXAA 2OFSA 2QC1A 4UY2C 1ZADA 1IQ9A 1CDQA 1CODA 1IDGA 2VLWA 2BHIA 2CTXA 1IK8A 3ERAA 1NTXA 2H7ZB 6EBXA 2BTXA 1CTXA 4P7UA 1CVOA 1KBAA 3NDSA 4XJJA 5IMYC 1MR6A 1ERGA 1KL8A 3LAQU 3U74U 1F8UB 2CCXA 4DO8A 1L4WA 3BT2U 4BDTB 2J8BA 1B41B 1ERAA 2JVEA 1HC9A 2H64B 1LXGA 3KFDE 5DZ5A 1CXOA 2L03A 3EBXA 1IDLA 1KS6A 1I02A 2ABXA 2H62D 4IYEA 1KC4A 2X8BB 1CDTA 4FAOE 1HAJA 5DO6A 2ERAA 4LFTA 3BT1U 2CRSA 3FEVA 4HQPF 2H64C 2MJ0A 1G6MA 1HOYA 4EY8B 1M9ZA 1REWC 1KXIA 2MHYA 1KU6B 1IJCA 1COEA 1FFJA 2I9BE 1CDRA 1JGKA 4FAOC 1NTNA 1HC9B 1S4YA 1CDSA 1W6BA 2MUPA 1PLOA 1UG4A 1CHVS 2GOOB 1CCQA 1CREA 2MJ4A 2LA1A 1IDIA 1QM7A 2PJYB 2QJ9C 3PLCA 1NEAA 2L5SA 2JQPA 1XT3A 1NYSA 2H8UA 2LCRA 3EVSC 1KBSA 2GOOC 1TXBA 2UX2A 4OM5A 2K3GA 2H5FA 1QKDA 2PJYC 1ONJA 5EBXA 1TGXA 1DRSA 4KSNA 1KFHA 1IKCA 1QKEA 1LX5B 2CRTA 2QJBC 4AEAA 1TFSA 1LXHA 5DU1A 1V6PA
chains in the Genus database with same CATH topology
1BTEA 2NBTA 3KFDI 4RUDA 3U73U 2MUOA 3HH7A 4BIKB 1FRAA 1JE9A 1CRFA 1FASA 2H62C 1HAAA 2UWRA 1VB0A 4ZQYA 1LSIA 1KTZB 2H7ZA 1RL5A 1NYUA 2QJAC 1ES7B 3NH7A 2CDXA 1H0JA 1FF4A 5IMTD 1FSCA 1MAHF 3VTSA 1LJZA 1NORA 1KBTA 3NEQA 4QTIU 2FD6U 1YWHA 1JBDA 2HLQA 1BXPA 1F94A 1RGJA 1IDHA 1FSSB 3QB4B 1CB9A 1CXNA 4OM4A 2MFAA 2MJYA 2HLRA 2N99A 1ABTA 1NXBA 1TXAA 2OFSA 2QC1A 4UY2C 1ZADA 1IQ9A 1CDQA 1CODA 1IDGA 2VLWA 2BHIA 2CTXA 1IK8A 3ERAA 1NTXA 2H7ZB 6EBXA 2BTXA 1CTXA 4P7UA 1CVOA 1KBAA 3NDSA 4XJJA 5IMYC 1MR6A 1ERGA 1KL8A 3LAQU 3U74U 1F8UB 2CCXA 4DO8A 1L4WA 3BT2U 4BDTB 2J8BA 1B41B 1ERAA 2JVEA 1HC9A 2H64B 1LXGA 3KFDE 5DZ5A 1CXOA 2L03A 3EBXA 1IDLA 1KS6A 1I02A 2ABXA 2H62D 4IYEA 1KC4A 2X8BB 1CDTA 4FAOE 1HAJA 5DO6A 2ERAA 4LFTA 3BT1U 2CRSA 3FEVA 4HQPF 2H64C 2MJ0A 1G6MA 1HOYA 4EY8B 1M9ZA 1REWC 1KXIA 2MHYA 1KU6B 1IJCA 1COEA 1FFJA 2I9BE 1CDRA 1JGKA 4FAOC 1NTNA 1HC9B 1S4YA 1CDSA 1W6BA 2MUPA 1PLOA 1UG4A 1CHVS 2GOOB 1CCQA 1CREA 2MJ4A 2LA1A 1IDIA 1QM7A 2PJYB 2QJ9C 3PLCA 1NEAA 2L5SA 2JQPA 1XT3A 1NYSA 2H8UA 2LCRA 3EVSC 1KBSA 2GOOC 1TXBA 2UX2A 4OM5A 2K3GA 2H5FA 1QKDA 2PJYC 1ONJA 5EBXA 1TGXA 1DRSA 4KSNA 1KFHA 1IKCA 1QKEA 1LX5B 2CRTA 2QJBC 4AEAA 1TFSA 1LXHA 5DU1A 1V6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BTE A;  2NBT A;  3KFD I;  4RUD A;  3U73 U;  2MUO A;  3HH7 A;  4BIK B;  1FRA A;  1JE9 A;  1CRF A;  1FAS A;  2H62 C;  1HAA A;  2UWR A;  1VB0 A;  4ZQY A;  1LSI A;  1KTZ B;  2H7Z A;  1RL5 A;  1NYU A;  2QJA C;  1ES7 B;  3NH7 A;  2CDX A;  1H0J A;  1FF4 A;  5IMT D;  1FSC A;  1MAH F;  3VTS A;  1LJZ A;  1NOR A;  1KBT A;  3NEQ A;  4QTI U;  2FD6 U;  1YWH A;  1JBD A;  2HLQ A;  1BXP A;  1F94 A;  1RGJ A;  1IDH A;  1FSS B;  3QB4 B;  1CB9 A;  1CXN A;  4OM4 A;  2MFA A;  2MJY A;  2HLR A;  2N99 A;  1ABT A;  1NXB A;  1TXA A;  2OFS A;  2QC1 A;  4UY2 C;  1ZAD A;  1IQ9 A;  1CDQ A;  1COD A;  1IDG A;  2VLW A;  2BHI A;  2CTX A;  1IK8 A;  3ERA A;  1NTX A;  2H7Z B;  6EBX A;  2BTX A;  1CTX A;  4P7U A;  1CVO A;  1KBA A;  3NDS A;  4XJJ A;  5IMY C;  1MR6 A;  1ERG A;  1KL8 A;  3LAQ U;  3U74 U;  1F8U B;  2CCX A;  4DO8 A;  1L4W A;  3BT2 U;  4BDT B;  2J8B A;  1B41 B;  1ERA A;  2JVE A;  1HC9 A;  2H64 B;  1LXG A;  3KFD E;  5DZ5 A;  1CXO A;  2L03 A;  3EBX A;  1IDL A;  1KS6 A;  1I02 A;  2ABX A;  2H62 D;  4IYE A;  1KC4 A;  2X8B B;  1CDT A;  4FAO E;  1HAJ A;  5DO6 A;  2ERA A;  4LFT A;  3BT1 U;  2CRS A;  3FEV A;  4HQP F;  2H64 C;  2MJ0 A;  1G6M A;  1HOY A;  4EY8 B;  1M9Z A;  1REW C;  1KXI A;  2MHY A;  1KU6 B;  1IJC A;  1COE A;  1FFJ A;  2I9B E;  1CDR A;  1JGK A;  4FAO C;  1NTN A;  1HC9 B;  1S4Y A;  1CDS A;  1W6B A;  2MUP A;  1PLO A;  1UG4 A;  1CHV S;  2GOO B;  1CCQ A;  1CRE A;  2MJ4 A;  2LA1 A;  1IDI A;  1QM7 A;  2PJY B;  2QJ9 C;  3PLC A;  1NEA A;  2L5S A;  2JQP A;  1XT3 A;  1NYS A;  2H8U A;  2LCR A;  3EVS C;  1KBS A;  2GOO C;  1TXB A;  2UX2 A;  4OM5 A;  2K3G A;  2H5F A;  1QKD A;  2PJY C;  1ONJ A;  5EBX A;  1TGX A;  1DRS A;  1KFH A;  1IKC A;  1QKE A;  1LX5 B;  2CRT A;  2QJB C;  4AEA A;  1TFS A;  1LXH A;  5DU1 A;  1V6P A; 
#chains in the Genus database with same CATH topology
 1BTE A;  2NBT A;  3KFD I;  4RUD A;  3U73 U;  2MUO A;  3HH7 A;  4BIK B;  1FRA A;  1JE9 A;  1CRF A;  1FAS A;  2H62 C;  1HAA A;  2UWR A;  1VB0 A;  4ZQY A;  1LSI A;  1KTZ B;  2H7Z A;  1RL5 A;  1NYU A;  2QJA C;  1ES7 B;  3NH7 A;  2CDX A;  1H0J A;  1FF4 A;  5IMT D;  1FSC A;  1MAH F;  3VTS A;  1LJZ A;  1NOR A;  1KBT A;  3NEQ A;  4QTI U;  2FD6 U;  1YWH A;  1JBD A;  2HLQ A;  1BXP A;  1F94 A;  1RGJ A;  1IDH A;  1FSS B;  3QB4 B;  1CB9 A;  1CXN A;  4OM4 A;  2MFA A;  2MJY A;  2HLR A;  2N99 A;  1ABT A;  1NXB A;  1TXA A;  2OFS A;  2QC1 A;  4UY2 C;  1ZAD A;  1IQ9 A;  1CDQ A;  1COD A;  1IDG A;  2VLW A;  2BHI A;  2CTX A;  1IK8 A;  3ERA A;  1NTX A;  2H7Z B;  6EBX A;  2BTX A;  1CTX A;  4P7U A;  1CVO A;  1KBA A;  3NDS A;  4XJJ A;  5IMY C;  1MR6 A;  1ERG A;  1KL8 A;  3LAQ U;  3U74 U;  1F8U B;  2CCX A;  4DO8 A;  1L4W A;  3BT2 U;  4BDT B;  2J8B A;  1B41 B;  1ERA A;  2JVE A;  1HC9 A;  2H64 B;  1LXG A;  3KFD E;  5DZ5 A;  1CXO A;  2L03 A;  3EBX A;  1IDL A;  1KS6 A;  1I02 A;  2ABX A;  2H62 D;  4IYE A;  1KC4 A;  2X8B B;  1CDT A;  4FAO E;  1HAJ A;  5DO6 A;  2ERA A;  4LFT A;  3BT1 U;  2CRS A;  3FEV A;  4HQP F;  2H64 C;  2MJ0 A;  1G6M A;  1HOY A;  4EY8 B;  1M9Z A;  1REW C;  1KXI A;  2MHY A;  1KU6 B;  1IJC A;  1COE A;  1FFJ A;  2I9B E;  1CDR A;  1JGK A;  4FAO C;  1NTN A;  1HC9 B;  1S4Y A;  1CDS A;  1W6B A;  2MUP A;  1PLO A;  1UG4 A;  1CHV S;  2GOO B;  1CCQ A;  1CRE A;  2MJ4 A;  2LA1 A;  1IDI A;  1QM7 A;  2PJY B;  2QJ9 C;  3PLC A;  1NEA A;  2L5S A;  2JQP A;  1XT3 A;  1NYS A;  2H8U A;  2LCR A;  3EVS C;  1KBS A;  2GOO C;  1TXB A;  2UX2 A;  4OM5 A;  2K3G A;  2H5F A;  1QKD A;  2PJY C;  1ONJ A;  5EBX A;  1TGX A;  1DRS A;  4KSN A;  1KFH A;  1IKC A;  1QKE A;  1LX5 B;  2CRT A;  2QJB C;  4AEA A;  1TFS A;  1LXH A;  5DU1 A;  1V6P A; 
#chains in the Genus database with same CATH homology
 1BTE A;  2NBT A;  3KFD I;  4RUD A;  3U73 U;  2MUO A;  3HH7 A;  4BIK B;  1FRA A;  1JE9 A;  1CRF A;  1FAS A;  2H62 C;  1HAA A;  2UWR A;  1VB0 A;  4ZQY A;  1LSI A;  1KTZ B;  2H7Z A;  1RL5 A;  1NYU A;  2QJA C;  1ES7 B;  3NH7 A;  2CDX A;  1H0J A;  1FF4 A;  5IMT D;  1FSC A;  1MAH F;  3VTS A;  1LJZ A;  1NOR A;  1KBT A;  3NEQ A;  4QTI U;  2FD6 U;  1YWH A;  1JBD A;  2HLQ A;  1BXP A;  1F94 A;  1RGJ A;  1IDH A;  1FSS B;  3QB4 B;  1CB9 A;  1CXN A;  4OM4 A;  2MFA A;  2MJY A;  2HLR A;  2N99 A;  1ABT A;  1NXB A;  1TXA A;  2OFS A;  2QC1 A;  4UY2 C;  1ZAD A;  1IQ9 A;  1CDQ A;  1COD A;  1IDG A;  2VLW A;  2BHI A;  2CTX A;  1IK8 A;  3ERA A;  1NTX A;  2H7Z B;  6EBX A;  2BTX A;  1CTX A;  4P7U A;  1CVO A;  1KBA A;  3NDS A;  4XJJ A;  5IMY C;  1MR6 A;  1ERG A;  1KL8 A;  3LAQ U;  3U74 U;  1F8U B;  2CCX A;  4DO8 A;  1L4W A;  3BT2 U;  4BDT B;  2J8B A;  1B41 B;  1ERA A;  2JVE A;  1HC9 A;  2H64 B;  1LXG A;  3KFD E;  5DZ5 A;  1CXO A;  2L03 A;  3EBX A;  1IDL A;  1KS6 A;  1I02 A;  2ABX A;  2H62 D;  4IYE A;  1KC4 A;  2X8B B;  1CDT A;  4FAO E;  1HAJ A;  5DO6 A;  2ERA A;  4LFT A;  3BT1 U;  2CRS A;  3FEV A;  4HQP F;  2H64 C;  2MJ0 A;  1G6M A;  1HOY A;  4EY8 B;  1M9Z A;  1REW C;  1KXI A;  2MHY A;  1KU6 B;  1IJC A;  1COE A;  1FFJ A;  2I9B E;  1CDR A;  1JGK A;  4FAO C;  1NTN A;  1HC9 B;  1S4Y A;  1CDS A;  1W6B A;  2MUP A;  1PLO A;  1UG4 A;  1CHV S;  2GOO B;  1CCQ A;  1CRE A;  2MJ4 A;  2LA1 A;  1IDI A;  1QM7 A;  2PJY B;  2QJ9 C;  3PLC A;  1NEA A;  2L5S A;  2JQP A;  1XT3 A;  1NYS A;  2H8U A;  2LCR A;  3EVS C;  1KBS A;  2GOO C;  1TXB A;  2UX2 A;  4OM5 A;  2K3G A;  2H5F A;  1QKD A;  2PJY C;  1ONJ A;  5EBX A;  1TGX A;  1DRS A;  4KSN A;  1KFH A;  1IKC A;  1QKE A;  1LX5 B;  2CRT A;  2QJB C;  4AEA A;  1TFS A;  1LXH A;  5DU1 A;  1V6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...