2OFSA

Crystal structure of human cd59
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
FLQCYNCPNPTADCKTAVQCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD59 glycoprotein
publication title Crystal structure of CD59: implications for molecular recognition of the complement proteins C8 and C9 in the membrane-attack complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2ofsA00
3HH7A 2HLRA 2L5SA 2H7ZA 5IMYC 1ONJA 1CHVS 2JVEA 2QC1A 1XT3A 3U73U 1F8UB 1JE9A 2MHYA 1TXBA 2MUPA 2PJYB 3VTSA 1HAJA 1NTXA 5EBXA 1FSSB 2MUOA 3EVSC 2HLQA 1ZADA 1IDGA 4DO8A 4FAOE 1CODA 2QJ9C 1IJCA 2N99A 1ABTA 1W6BA 1L4WA 1KBAA 2BTXA 1ERGA 1RGJA 2JQPA 1IK8A 1M9ZA 1VB0A 2CRTA 1KXIA 1TGXA 1HC9B 1ERAA 1IDHA 1TFSA 1NEAA 2FD6U 5IMTD 1NORA 1JGKA 4OM4A 3PLCA 1IDLA 1CB9A 1CDTA 1QKDA 2CTXA 2K3GA 2UWRA 1CTXA 2MJYA 3ERAA 4FAOC 2H62C 1KBSA 1KTZB 2H64B 1CDSA 4OM5A 1V6PA 1CDQA 2CRSA 1KFHA 1CREA 2NBTA 2CDXA 1NYSA 3NH7A 2BHIA 1REWC 1BTEA 1FASA 1CVOA 1LXGA 1HC9A 4RUDA 4EY8B 4BIKB 2LCRA 1NXBA 3QB4B 2PJYC 1KC4A 2H64C 5DU1A 1FSCA 2UX2A 1CRFA 1S4YA 2MFAA 1YWHA 1LX5B 1DRSA 2LA1A 2OFSA 1TXAA 1UG4A 4LFTA 4HQPF 2MJ4A 1FRAA 2X8BB 2GOOB 2QJBC 1QKEA 1IDIA 2ERAA 1KU6B 1MR6A 2CCXA 3LAQU 1HOYA 2L03A 3EBXA 3U74U 1KBTA 6EBXA 1LXHA 5DO6A 2J8BA 1B41B 4BDTB 2ABXA 1BXPA 1RL5A 4QTIU 1KL8A 4ZQYA 1COEA 3BT1U 2GOOC 1ES7B 2H5FA 1IKCA 3KFDE 1NYUA 1HAAA 1QM7A 2H7ZB 1MAHF 2H62D 1FFJA 1G6MA 1JBDA 2H8UA 4IYEA 1CDRA 4UY2C 1CXOA 1F94A 1NTNA 1LSIA 1FF4A 1CXNA 1PLOA 3KFDI 3NEQA 1IQ9A 1KS6A 4XJJA 1H0JA 2QJAC 2VLWA 3NDSA 2I9BE 2MJ0A 5DZ5A 1LJZA 4P7UA 4AEAA 1CCQA 3FEVA 3BT2U 1I02A
chains in the Genus database with same CATH superfamily
3HH7A 2HLRA 2L5SA 2H7ZA 5IMYC 1ONJA 1CHVS 2JVEA 2QC1A 1XT3A 3U73U 1F8UB 4KSNA 2MHYA 1JE9A 1TXBA 2MUPA 2PJYB 3VTSA 1HAJA 1NTXA 5EBXA 1FSSB 2MUOA 3EVSC 2HLQA 1ZADA 1IDGA 4DO8A 4FAOE 1CODA 2QJ9C 1IJCA 2N99A 1ABTA 1W6BA 1L4WA 1KBAA 2BTXA 1ERGA 1RGJA 2JQPA 1IK8A 1M9ZA 1VB0A 2CRTA 1KXIA 1TGXA 1HC9B 1ERAA 1IDHA 1TFSA 1NEAA 2FD6U 5IMTD 1NORA 1JGKA 4OM4A 3PLCA 1IDLA 1CB9A 1CDTA 1QKDA 2CTXA 2K3GA 2UWRA 1CTXA 2MJYA 3ERAA 4FAOC 2H62C 1KBSA 1KTZB 2H64B 1CDSA 4OM5A 1V6PA 1CDQA 2CRSA 1KFHA 1CREA 2NBTA 2CDXA 1NYSA 3NH7A 2BHIA 1REWC 1BTEA 1FASA 1CVOA 1LXGA 1HC9A 4RUDA 4EY8B 4BIKB 2LCRA 1NXBA 3QB4B 2PJYC 1KC4A 2H64C 5DU1A 1FSCA 2UX2A 1CRFA 1S4YA 2MFAA 1YWHA 1LX5B 1DRSA 2LA1A 2OFSA 1TXAA 1UG4A 4LFTA 4HQPF 2MJ4A 1FRAA 2X8BB 2GOOB 2QJBC 1QKEA 1IDIA 2ERAA 1KU6B 1MR6A 2CCXA 3LAQU 1HOYA 2L03A 3EBXA 3U74U 1KBTA 6EBXA 1LXHA 5DO6A 2J8BA 1B41B 4BDTB 2ABXA 1BXPA 1RL5A 4QTIU 1KL8A 4ZQYA 1COEA 3BT1U 2GOOC 1ES7B 2H5FA 1IKCA 3KFDE 1NYUA 1HAAA 1QM7A 2H7ZB 1MAHF 2H62D 1FFJA 1G6MA 1JBDA 2H8UA 4IYEA 1CDRA 4UY2C 1CXOA 1F94A 1NTNA 1LSIA 1FF4A 1CXNA 1PLOA 3KFDI 3NEQA 1IQ9A 1KS6A 4XJJA 1H0JA 2QJAC 2VLWA 3NDSA 2I9BE 2MJ0A 5DZ5A 1LJZA 4P7UA 4AEAA 1CCQA 3FEVA 3BT2U 1I02A
chains in the Genus database with same CATH topology
3HH7A 2HLRA 2L5SA 2H7ZA 5IMYC 1ONJA 1CHVS 2JVEA 2QC1A 1XT3A 3U73U 1F8UB 4KSNA 2MHYA 1JE9A 1TXBA 2MUPA 2PJYB 3VTSA 1HAJA 1NTXA 5EBXA 1FSSB 2MUOA 3EVSC 2HLQA 1ZADA 1IDGA 4DO8A 4FAOE 1CODA 2QJ9C 1IJCA 2N99A 1ABTA 1W6BA 1L4WA 1KBAA 2BTXA 1ERGA 1RGJA 2JQPA 1IK8A 1M9ZA 1VB0A 2CRTA 1KXIA 1TGXA 1HC9B 1ERAA 1IDHA 1TFSA 1NEAA 2FD6U 5IMTD 1NORA 1JGKA 4OM4A 3PLCA 1IDLA 1CB9A 1CDTA 1QKDA 2CTXA 2K3GA 2UWRA 1CTXA 2MJYA 3ERAA 4FAOC 2H62C 1KBSA 1KTZB 2H64B 1CDSA 4OM5A 1V6PA 1CDQA 2CRSA 1KFHA 1CREA 2NBTA 2CDXA 1NYSA 3NH7A 2BHIA 1REWC 1BTEA 1FASA 1CVOA 1LXGA 1HC9A 4RUDA 4EY8B 4BIKB 2LCRA 1NXBA 3QB4B 2PJYC 1KC4A 2H64C 5DU1A 1FSCA 2UX2A 1CRFA 1S4YA 2MFAA 1YWHA 1LX5B 1DRSA 2LA1A 2OFSA 1TXAA 1UG4A 4LFTA 4HQPF 2MJ4A 1FRAA 2X8BB 2GOOB 2QJBC 1QKEA 1IDIA 2ERAA 1KU6B 1MR6A 2CCXA 3LAQU 1HOYA 2L03A 3EBXA 3U74U 1KBTA 6EBXA 1LXHA 5DO6A 2J8BA 1B41B 4BDTB 2ABXA 1BXPA 1RL5A 4QTIU 1KL8A 4ZQYA 1COEA 3BT1U 2GOOC 1ES7B 2H5FA 1IKCA 3KFDE 1NYUA 1HAAA 1QM7A 2H7ZB 1MAHF 2H62D 1FFJA 1G6MA 1JBDA 2H8UA 4IYEA 1CDRA 4UY2C 1CXOA 1F94A 1NTNA 1LSIA 1FF4A 1CXNA 1PLOA 3KFDI 3NEQA 1IQ9A 1KS6A 4XJJA 1H0JA 2QJAC 2VLWA 3NDSA 2I9BE 2MJ0A 5DZ5A 1LJZA 4P7UA 4AEAA 1CCQA 3FEVA 3BT2U 1I02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HH7 A;  2HLR A;  2L5S A;  2H7Z A;  5IMY C;  1ONJ A;  1CHV S;  2JVE A;  2QC1 A;  1XT3 A;  3U73 U;  1F8U B;  1JE9 A;  2MHY A;  1TXB A;  2MUP A;  2PJY B;  3VTS A;  1HAJ A;  1NTX A;  5EBX A;  1FSS B;  2MUO A;  3EVS C;  2HLQ A;  1ZAD A;  1IDG A;  4DO8 A;  4FAO E;  1COD A;  2QJ9 C;  1IJC A;  2N99 A;  1ABT A;  1W6B A;  1L4W A;  1KBA A;  2BTX A;  1ERG A;  1RGJ A;  2JQP A;  1IK8 A;  1M9Z A;  1VB0 A;  2CRT A;  1KXI A;  1TGX A;  1HC9 B;  1ERA A;  1IDH A;  1TFS A;  1NEA A;  2FD6 U;  5IMT D;  1NOR A;  1JGK A;  4OM4 A;  3PLC A;  1IDL A;  1CB9 A;  1CDT A;  1QKD A;  2CTX A;  2K3G A;  2UWR A;  1CTX A;  2MJY A;  3ERA A;  4FAO C;  2H62 C;  1KBS A;  1KTZ B;  2H64 B;  1CDS A;  4OM5 A;  1V6P A;  1CDQ A;  2CRS A;  1KFH A;  1CRE A;  2NBT A;  2CDX A;  1NYS A;  3NH7 A;  2BHI A;  1REW C;  1BTE A;  1FAS A;  1CVO A;  1LXG A;  1HC9 A;  4RUD A;  4EY8 B;  4BIK B;  2LCR A;  1NXB A;  3QB4 B;  2PJY C;  1KC4 A;  2H64 C;  5DU1 A;  1FSC A;  2UX2 A;  1CRF A;  1S4Y A;  2MFA A;  1YWH A;  1LX5 B;  1DRS A;  2LA1 A;  2OFS A;  1TXA A;  1UG4 A;  4LFT A;  4HQP F;  2MJ4 A;  1FRA A;  2X8B B;  2GOO B;  2QJB C;  1QKE A;  1IDI A;  2ERA A;  1KU6 B;  1MR6 A;  2CCX A;  3LAQ U;  1HOY A;  2L03 A;  3EBX A;  3U74 U;  1KBT A;  6EBX A;  1LXH A;  5DO6 A;  2J8B A;  1B41 B;  4BDT B;  2ABX A;  1BXP A;  1RL5 A;  4QTI U;  1KL8 A;  4ZQY A;  1COE A;  3BT1 U;  2GOO C;  1ES7 B;  2H5F A;  1IKC A;  3KFD E;  1NYU A;  1HAA A;  1QM7 A;  2H7Z B;  1MAH F;  2H62 D;  1FFJ A;  1G6M A;  1JBD A;  2H8U A;  4IYE A;  1CDR A;  4UY2 C;  1CXO A;  1F94 A;  1NTN A;  1LSI A;  1FF4 A;  1CXN A;  1PLO A;  3KFD I;  3NEQ A;  1IQ9 A;  1KS6 A;  4XJJ A;  1H0J A;  2QJA C;  2VLW A;  3NDS A;  2I9B E;  2MJ0 A;  5DZ5 A;  1LJZ A;  4P7U A;  4AEA A;  1CCQ A;  3FEV A;  3BT2 U;  1I02 A; 
#chains in the Genus database with same CATH topology
 3HH7 A;  2HLR A;  2L5S A;  2H7Z A;  5IMY C;  1ONJ A;  1CHV S;  2JVE A;  2QC1 A;  1XT3 A;  3U73 U;  1F8U B;  4KSN A;  2MHY A;  1JE9 A;  1TXB A;  2MUP A;  2PJY B;  3VTS A;  1HAJ A;  1NTX A;  5EBX A;  1FSS B;  2MUO A;  3EVS C;  2HLQ A;  1ZAD A;  1IDG A;  4DO8 A;  4FAO E;  1COD A;  2QJ9 C;  1IJC A;  2N99 A;  1ABT A;  1W6B A;  1L4W A;  1KBA A;  2BTX A;  1ERG A;  1RGJ A;  2JQP A;  1IK8 A;  1M9Z A;  1VB0 A;  2CRT A;  1KXI A;  1TGX A;  1HC9 B;  1ERA A;  1IDH A;  1TFS A;  1NEA A;  2FD6 U;  5IMT D;  1NOR A;  1JGK A;  4OM4 A;  3PLC A;  1IDL A;  1CB9 A;  1CDT A;  1QKD A;  2CTX A;  2K3G A;  2UWR A;  1CTX A;  2MJY A;  3ERA A;  4FAO C;  2H62 C;  1KBS A;  1KTZ B;  2H64 B;  1CDS A;  4OM5 A;  1V6P A;  1CDQ A;  2CRS A;  1KFH A;  1CRE A;  2NBT A;  2CDX A;  1NYS A;  3NH7 A;  2BHI A;  1REW C;  1BTE A;  1FAS A;  1CVO A;  1LXG A;  1HC9 A;  4RUD A;  4EY8 B;  4BIK B;  2LCR A;  1NXB A;  3QB4 B;  2PJY C;  1KC4 A;  2H64 C;  5DU1 A;  1FSC A;  2UX2 A;  1CRF A;  1S4Y A;  2MFA A;  1YWH A;  1LX5 B;  1DRS A;  2LA1 A;  2OFS A;  1TXA A;  1UG4 A;  4LFT A;  4HQP F;  2MJ4 A;  1FRA A;  2X8B B;  2GOO B;  2QJB C;  1QKE A;  1IDI A;  2ERA A;  1KU6 B;  1MR6 A;  2CCX A;  3LAQ U;  1HOY A;  2L03 A;  3EBX A;  3U74 U;  1KBT A;  6EBX A;  1LXH A;  5DO6 A;  2J8B A;  1B41 B;  4BDT B;  2ABX A;  1BXP A;  1RL5 A;  4QTI U;  1KL8 A;  4ZQY A;  1COE A;  3BT1 U;  2GOO C;  1ES7 B;  2H5F A;  1IKC A;  3KFD E;  1NYU A;  1HAA A;  1QM7 A;  2H7Z B;  1MAH F;  2H62 D;  1FFJ A;  1G6M A;  1JBD A;  2H8U A;  4IYE A;  1CDR A;  4UY2 C;  1CXO A;  1F94 A;  1NTN A;  1LSI A;  1FF4 A;  1CXN A;  1PLO A;  3KFD I;  3NEQ A;  1IQ9 A;  1KS6 A;  4XJJ A;  1H0J A;  2QJA C;  2VLW A;  3NDS A;  2I9B E;  2MJ0 A;  5DZ5 A;  1LJZ A;  4P7U A;  4AEA A;  1CCQ A;  3FEV A;  3BT2 U;  1I02 A; 
#chains in the Genus database with same CATH homology
 3HH7 A;  2HLR A;  2L5S A;  2H7Z A;  5IMY C;  1ONJ A;  1CHV S;  2JVE A;  2QC1 A;  1XT3 A;  3U73 U;  1F8U B;  4KSN A;  2MHY A;  1JE9 A;  1TXB A;  2MUP A;  2PJY B;  3VTS A;  1HAJ A;  1NTX A;  5EBX A;  1FSS B;  2MUO A;  3EVS C;  2HLQ A;  1ZAD A;  1IDG A;  4DO8 A;  4FAO E;  1COD A;  2QJ9 C;  1IJC A;  2N99 A;  1ABT A;  1W6B A;  1L4W A;  1KBA A;  2BTX A;  1ERG A;  1RGJ A;  2JQP A;  1IK8 A;  1M9Z A;  1VB0 A;  2CRT A;  1KXI A;  1TGX A;  1HC9 B;  1ERA A;  1IDH A;  1TFS A;  1NEA A;  2FD6 U;  5IMT D;  1NOR A;  1JGK A;  4OM4 A;  3PLC A;  1IDL A;  1CB9 A;  1CDT A;  1QKD A;  2CTX A;  2K3G A;  2UWR A;  1CTX A;  2MJY A;  3ERA A;  4FAO C;  2H62 C;  1KBS A;  1KTZ B;  2H64 B;  1CDS A;  4OM5 A;  1V6P A;  1CDQ A;  2CRS A;  1KFH A;  1CRE A;  2NBT A;  2CDX A;  1NYS A;  3NH7 A;  2BHI A;  1REW C;  1BTE A;  1FAS A;  1CVO A;  1LXG A;  1HC9 A;  4RUD A;  4EY8 B;  4BIK B;  2LCR A;  1NXB A;  3QB4 B;  2PJY C;  1KC4 A;  2H64 C;  5DU1 A;  1FSC A;  2UX2 A;  1CRF A;  1S4Y A;  2MFA A;  1YWH A;  1LX5 B;  1DRS A;  2LA1 A;  2OFS A;  1TXA A;  1UG4 A;  4LFT A;  4HQP F;  2MJ4 A;  1FRA A;  2X8B B;  2GOO B;  2QJB C;  1QKE A;  1IDI A;  2ERA A;  1KU6 B;  1MR6 A;  2CCX A;  3LAQ U;  1HOY A;  2L03 A;  3EBX A;  3U74 U;  1KBT A;  6EBX A;  1LXH A;  5DO6 A;  2J8B A;  1B41 B;  4BDT B;  2ABX A;  1BXP A;  1RL5 A;  4QTI U;  1KL8 A;  4ZQY A;  1COE A;  3BT1 U;  2GOO C;  1ES7 B;  2H5F A;  1IKC A;  3KFD E;  1NYU A;  1HAA A;  1QM7 A;  2H7Z B;  1MAH F;  2H62 D;  1FFJ A;  1G6M A;  1JBD A;  2H8U A;  4IYE A;  1CDR A;  4UY2 C;  1CXO A;  1F94 A;  1NTN A;  1LSI A;  1FF4 A;  1CXN A;  1PLO A;  3KFD I;  3NEQ A;  1IQ9 A;  1KS6 A;  4XJJ A;  1H0J A;  2QJA C;  2VLW A;  3NDS A;  2I9B E;  2MJ0 A;  5DZ5 A;  1LJZ A;  4P7U A;  4AEA A;  1CCQ A;  3FEV A;  3BT2 U;  1I02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...