2OFSA

Crystal structure of human cd59
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
FLQCYNCPNPTADCKTAVQCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CD59: implications for molecular recognition of the complement proteins C8 and C9 in the membrane-attack complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords CD59 glycoprotein
total genus 19
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2ofsA00
1UG4A 2HLRA 3PLCA 2I9BE 4LFTA 4AEAA 1RL5A 4HQPF 1B41B 2HLQA 1FSCA 2X8BB 1YWHA 1IQ9A 3BT1U 2LA1A 2VLWA 3EBXA 1L4WA 1ONJA 4UY2C 2CRSA 2UWRA 4P7UA 1KS6A 2MJYA 1CREA 1REWC 1LXHA 1HAJA 2FD6U 1ABTA 1FSSB 1FRAA 1LX5B 3FEVA 1CXOA 2MJ0A 3LAQU 2CRTA 2H62D 1XT3A 2ERAA 2N99A 6EBXA 5DO6A 2CTXA 1FASA 3EVSC 5DU1A 1QM7A 1ZADA 1NTNA 3QB4B 3VTSA 1JE9A 1KBAA 1MR6A 4ZQYA 3U74U 1CTXA 3NEQA 2QJBC 2H64C 4DO8A 5IMYC 3NH7A 1I02A 1KC4A 4IYEA 4FAOE 2L03A 1V6PA 1S4YA 4FAOC 1QKDA 1F94A 2OFSA 1IK8A 1KL8A 1NXBA 1IJCA 1KU6B 1TGXA 1COEA 1H0JA 1CDRA 1M9ZA 1KTZB 1TXAA 1CDSA 1TFSA 1CHVS 1CDQA 2JVEA 2UX2A 1CCQA 1BXPA 4QTIU 1KBTA 1F8UB 2H64B 1LXGA 2QJ9C 1HAAA 2MUOA 4BIKB 1HOYA 1FFJA 2H7ZA 1KXIA 1RGJA 1IDHA 1NYUA 2L5SA 4RUDA 1BTEA 1NTXA 3NDSA 1IDLA 1CB9A 1KFHA 1CDTA 1FF4A 1ES7B 3U73U 4OM4A 3HH7A 4EY8B 1ERAA 2NBTA 1G6MA 2JQPA 5DZ5A 1W6BA 1JBDA 2PJYB 1TXBA 3BT2U 1JGKA 1KBSA 2LCRA 4OM5A 2MJ4A 1ERGA 1IDIA 2GOOC 1CVOA 2MUPA 5IMTD 1CXNA 1IKCA 1NYSA 2CCXA 3KFDI 1CRFA 1QKEA 5EBXA 2H8UA 1LSIA 1PLOA 3KFDE 2H62C 2K3GA 3ERAA 4XJJA 1HC9A 2QC1A 1MAHF 2BTXA 2CDXA 2MFAA 2J8BA 1DRSA 2H5FA 1NORA 2MHYA 1VB0A 2QJAC 2GOOB 1IDGA 4BDTB 2BHIA 2H7ZB 1LJZA 1CODA 1HC9B 2PJYC 1NEAA 2ABXA
chains in the Genus database with same CATH superfamily
1UG4A 2HLRA 3PLCA 2I9BE 4LFTA 4AEAA 1RL5A 4HQPF 1B41B 2HLQA 1FSCA 2X8BB 1YWHA 1IQ9A 3BT1U 4KSNA 2LA1A 2VLWA 3EBXA 1L4WA 1ONJA 4UY2C 2CRSA 2UWRA 4P7UA 1KS6A 2MJYA 1CREA 1REWC 1LXHA 1HAJA 2FD6U 1ABTA 1FSSB 1FRAA 1LX5B 3FEVA 1CXOA 2MJ0A 3LAQU 2CRTA 2H62D 1XT3A 2ERAA 2N99A 6EBXA 5DO6A 2CTXA 1FASA 3EVSC 5DU1A 1QM7A 1ZADA 1NTNA 3QB4B 3VTSA 1JE9A 1KBAA 1MR6A 4ZQYA 3U74U 1CTXA 3NEQA 2QJBC 2H64C 4DO8A 5IMYC 3NH7A 1I02A 1KC4A 4IYEA 4FAOE 2L03A 1V6PA 1S4YA 4FAOC 1QKDA 1F94A 2OFSA 1IK8A 1KL8A 1NXBA 1IJCA 1KU6B 1TGXA 1COEA 1H0JA 1CDRA 1M9ZA 1KTZB 1TXAA 1CDSA 1TFSA 1CHVS 1CDQA 2JVEA 2UX2A 1CCQA 1BXPA 4QTIU 1KBTA 1F8UB 2H64B 1LXGA 2QJ9C 1HAAA 2MUOA 4BIKB 1HOYA 1FFJA 2H7ZA 1KXIA 1RGJA 1IDHA 1NYUA 2L5SA 4RUDA 1BTEA 1NTXA 3NDSA 1IDLA 1CB9A 1KFHA 1CDTA 1FF4A 1ES7B 3U73U 4OM4A 3HH7A 4EY8B 1ERAA 2NBTA 1G6MA 2JQPA 5DZ5A 1W6BA 1JBDA 2PJYB 1TXBA 3BT2U 1JGKA 1KBSA 2LCRA 4OM5A 2MJ4A 1ERGA 1IDIA 2GOOC 1CVOA 2MUPA 5IMTD 1CXNA 1IKCA 1NYSA 2CCXA 3KFDI 1CRFA 1QKEA 5EBXA 2H8UA 1LSIA 1PLOA 3KFDE 2H62C 2K3GA 3ERAA 4XJJA 1HC9A 2QC1A 1MAHF 2BTXA 2CDXA 2MFAA 2J8BA 1DRSA 2H5FA 1NORA 2MHYA 1VB0A 2QJAC 2GOOB 1IDGA 4BDTB 2BHIA 2H7ZB 1LJZA 1CODA 1HC9B 2PJYC 1NEAA 2ABXA
chains in the Genus database with same CATH topology
1UG4A 2HLRA 3PLCA 2I9BE 4LFTA 4AEAA 1RL5A 4HQPF 1B41B 2HLQA 1FSCA 2X8BB 1YWHA 1IQ9A 3BT1U 4KSNA 2LA1A 2VLWA 3EBXA 1L4WA 1ONJA 4UY2C 2CRSA 2UWRA 4P7UA 1KS6A 2MJYA 1CREA 1REWC 1LXHA 1HAJA 2FD6U 1ABTA 1FSSB 1FRAA 1LX5B 3FEVA 1CXOA 2MJ0A 3LAQU 2CRTA 2H62D 1XT3A 2ERAA 2N99A 6EBXA 5DO6A 2CTXA 1FASA 3EVSC 5DU1A 1QM7A 1ZADA 1NTNA 3QB4B 3VTSA 1JE9A 1KBAA 1MR6A 4ZQYA 3U74U 1CTXA 3NEQA 2QJBC 2H64C 4DO8A 5IMYC 3NH7A 1I02A 1KC4A 4IYEA 4FAOE 2L03A 1V6PA 1S4YA 4FAOC 1QKDA 1F94A 2OFSA 1IK8A 1KL8A 1NXBA 1IJCA 1KU6B 1TGXA 1COEA 1H0JA 1CDRA 1M9ZA 1KTZB 1TXAA 1CDSA 1TFSA 1CHVS 1CDQA 2JVEA 2UX2A 1CCQA 1BXPA 4QTIU 1KBTA 1F8UB 2H64B 1LXGA 2QJ9C 1HAAA 2MUOA 4BIKB 1HOYA 1FFJA 2H7ZA 1KXIA 1RGJA 1IDHA 1NYUA 2L5SA 4RUDA 1BTEA 1NTXA 3NDSA 1IDLA 1CB9A 1KFHA 1CDTA 1FF4A 1ES7B 3U73U 4OM4A 3HH7A 4EY8B 1ERAA 2NBTA 1G6MA 2JQPA 5DZ5A 1W6BA 1JBDA 2PJYB 1TXBA 3BT2U 1JGKA 1KBSA 2LCRA 4OM5A 2MJ4A 1ERGA 1IDIA 2GOOC 1CVOA 2MUPA 5IMTD 1CXNA 1IKCA 1NYSA 2CCXA 3KFDI 1CRFA 1QKEA 5EBXA 2H8UA 1LSIA 1PLOA 3KFDE 2H62C 2K3GA 3ERAA 4XJJA 1HC9A 2QC1A 1MAHF 2BTXA 2CDXA 2MFAA 2J8BA 1DRSA 2H5FA 1NORA 2MHYA 1VB0A 2QJAC 2GOOB 1IDGA 4BDTB 2BHIA 2H7ZB 1LJZA 1CODA 1HC9B 2PJYC 1NEAA 2ABXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG4 A;  2HLR A;  3PLC A;  2I9B E;  4LFT A;  4AEA A;  1RL5 A;  4HQP F;  1B41 B;  2HLQ A;  1FSC A;  2X8B B;  1YWH A;  1IQ9 A;  3BT1 U;  2LA1 A;  2VLW A;  3EBX A;  1L4W A;  1ONJ A;  4UY2 C;  2CRS A;  2UWR A;  4P7U A;  1KS6 A;  2MJY A;  1CRE A;  1REW C;  1LXH A;  1HAJ A;  2FD6 U;  1ABT A;  1FSS B;  1FRA A;  1LX5 B;  3FEV A;  1CXO A;  2MJ0 A;  3LAQ U;  2CRT A;  2H62 D;  1XT3 A;  2ERA A;  2N99 A;  6EBX A;  5DO6 A;  2CTX A;  1FAS A;  3EVS C;  5DU1 A;  1QM7 A;  1ZAD A;  1NTN A;  3QB4 B;  3VTS A;  1JE9 A;  1KBA A;  1MR6 A;  4ZQY A;  3U74 U;  1CTX A;  3NEQ A;  2QJB C;  2H64 C;  4DO8 A;  5IMY C;  3NH7 A;  1I02 A;  1KC4 A;  4IYE A;  4FAO E;  2L03 A;  1V6P A;  1S4Y A;  4FAO C;  1QKD A;  1F94 A;  2OFS A;  1IK8 A;  1KL8 A;  1NXB A;  1IJC A;  1KU6 B;  1TGX A;  1COE A;  1H0J A;  1CDR A;  1M9Z A;  1KTZ B;  1TXA A;  1CDS A;  1TFS A;  1CHV S;  1CDQ A;  2JVE A;  2UX2 A;  1CCQ A;  1BXP A;  4QTI U;  1KBT A;  1F8U B;  2H64 B;  1LXG A;  2QJ9 C;  1HAA A;  2MUO A;  4BIK B;  1HOY A;  1FFJ A;  2H7Z A;  1KXI A;  1RGJ A;  1IDH A;  1NYU A;  2L5S A;  4RUD A;  1BTE A;  1NTX A;  3NDS A;  1IDL A;  1CB9 A;  1KFH A;  1CDT A;  1FF4 A;  1ES7 B;  3U73 U;  4OM4 A;  3HH7 A;  4EY8 B;  1ERA A;  2NBT A;  1G6M A;  2JQP A;  5DZ5 A;  1W6B A;  1JBD A;  2PJY B;  1TXB A;  3BT2 U;  1JGK A;  1KBS A;  2LCR A;  4OM5 A;  2MJ4 A;  1ERG A;  1IDI A;  2GOO C;  1CVO A;  2MUP A;  5IMT D;  1CXN A;  1IKC A;  1NYS A;  2CCX A;  3KFD I;  1CRF A;  1QKE A;  5EBX A;  2H8U A;  1LSI A;  1PLO A;  3KFD E;  2H62 C;  2K3G A;  3ERA A;  4XJJ A;  1HC9 A;  2QC1 A;  1MAH F;  2BTX A;  2CDX A;  2MFA A;  2J8B A;  1DRS A;  2H5F A;  1NOR A;  2MHY A;  1VB0 A;  2QJA C;  2GOO B;  1IDG A;  4BDT B;  2BHI A;  2H7Z B;  1LJZ A;  1COD A;  1HC9 B;  2PJY C;  1NEA A;  2ABX A; 
#chains in the Genus database with same CATH topology
 1UG4 A;  2HLR A;  3PLC A;  2I9B E;  4LFT A;  4AEA A;  1RL5 A;  4HQP F;  1B41 B;  2HLQ A;  1FSC A;  2X8B B;  1YWH A;  1IQ9 A;  3BT1 U;  4KSN A;  2LA1 A;  2VLW A;  3EBX A;  1L4W A;  1ONJ A;  4UY2 C;  2CRS A;  2UWR A;  4P7U A;  1KS6 A;  2MJY A;  1CRE A;  1REW C;  1LXH A;  1HAJ A;  2FD6 U;  1ABT A;  1FSS B;  1FRA A;  1LX5 B;  3FEV A;  1CXO A;  2MJ0 A;  3LAQ U;  2CRT A;  2H62 D;  1XT3 A;  2ERA A;  2N99 A;  6EBX A;  5DO6 A;  2CTX A;  1FAS A;  3EVS C;  5DU1 A;  1QM7 A;  1ZAD A;  1NTN A;  3QB4 B;  3VTS A;  1JE9 A;  1KBA A;  1MR6 A;  4ZQY A;  3U74 U;  1CTX A;  3NEQ A;  2QJB C;  2H64 C;  4DO8 A;  5IMY C;  3NH7 A;  1I02 A;  1KC4 A;  4IYE A;  4FAO E;  2L03 A;  1V6P A;  1S4Y A;  4FAO C;  1QKD A;  1F94 A;  2OFS A;  1IK8 A;  1KL8 A;  1NXB A;  1IJC A;  1KU6 B;  1TGX A;  1COE A;  1H0J A;  1CDR A;  1M9Z A;  1KTZ B;  1TXA A;  1CDS A;  1TFS A;  1CHV S;  1CDQ A;  2JVE A;  2UX2 A;  1CCQ A;  1BXP A;  4QTI U;  1KBT A;  1F8U B;  2H64 B;  1LXG A;  2QJ9 C;  1HAA A;  2MUO A;  4BIK B;  1HOY A;  1FFJ A;  2H7Z A;  1KXI A;  1RGJ A;  1IDH A;  1NYU A;  2L5S A;  4RUD A;  1BTE A;  1NTX A;  3NDS A;  1IDL A;  1CB9 A;  1KFH A;  1CDT A;  1FF4 A;  1ES7 B;  3U73 U;  4OM4 A;  3HH7 A;  4EY8 B;  1ERA A;  2NBT A;  1G6M A;  2JQP A;  5DZ5 A;  1W6B A;  1JBD A;  2PJY B;  1TXB A;  3BT2 U;  1JGK A;  1KBS A;  2LCR A;  4OM5 A;  2MJ4 A;  1ERG A;  1IDI A;  2GOO C;  1CVO A;  2MUP A;  5IMT D;  1CXN A;  1IKC A;  1NYS A;  2CCX A;  3KFD I;  1CRF A;  1QKE A;  5EBX A;  2H8U A;  1LSI A;  1PLO A;  3KFD E;  2H62 C;  2K3G A;  3ERA A;  4XJJ A;  1HC9 A;  2QC1 A;  1MAH F;  2BTX A;  2CDX A;  2MFA A;  2J8B A;  1DRS A;  2H5F A;  1NOR A;  2MHY A;  1VB0 A;  2QJA C;  2GOO B;  1IDG A;  4BDT B;  2BHI A;  2H7Z B;  1LJZ A;  1COD A;  1HC9 B;  2PJY C;  1NEA A;  2ABX A; 
#chains in the Genus database with same CATH homology
 1UG4 A;  2HLR A;  3PLC A;  2I9B E;  4LFT A;  4AEA A;  1RL5 A;  4HQP F;  1B41 B;  2HLQ A;  1FSC A;  2X8B B;  1YWH A;  1IQ9 A;  3BT1 U;  4KSN A;  2LA1 A;  2VLW A;  3EBX A;  1L4W A;  1ONJ A;  4UY2 C;  2CRS A;  2UWR A;  4P7U A;  1KS6 A;  2MJY A;  1CRE A;  1REW C;  1LXH A;  1HAJ A;  2FD6 U;  1ABT A;  1FSS B;  1FRA A;  1LX5 B;  3FEV A;  1CXO A;  2MJ0 A;  3LAQ U;  2CRT A;  2H62 D;  1XT3 A;  2ERA A;  2N99 A;  6EBX A;  5DO6 A;  2CTX A;  1FAS A;  3EVS C;  5DU1 A;  1QM7 A;  1ZAD A;  1NTN A;  3QB4 B;  3VTS A;  1JE9 A;  1KBA A;  1MR6 A;  4ZQY A;  3U74 U;  1CTX A;  3NEQ A;  2QJB C;  2H64 C;  4DO8 A;  5IMY C;  3NH7 A;  1I02 A;  1KC4 A;  4IYE A;  4FAO E;  2L03 A;  1V6P A;  1S4Y A;  4FAO C;  1QKD A;  1F94 A;  2OFS A;  1IK8 A;  1KL8 A;  1NXB A;  1IJC A;  1KU6 B;  1TGX A;  1COE A;  1H0J A;  1CDR A;  1M9Z A;  1KTZ B;  1TXA A;  1CDS A;  1TFS A;  1CHV S;  1CDQ A;  2JVE A;  2UX2 A;  1CCQ A;  1BXP A;  4QTI U;  1KBT A;  1F8U B;  2H64 B;  1LXG A;  2QJ9 C;  1HAA A;  2MUO A;  4BIK B;  1HOY A;  1FFJ A;  2H7Z A;  1KXI A;  1RGJ A;  1IDH A;  1NYU A;  2L5S A;  4RUD A;  1BTE A;  1NTX A;  3NDS A;  1IDL A;  1CB9 A;  1KFH A;  1CDT A;  1FF4 A;  1ES7 B;  3U73 U;  4OM4 A;  3HH7 A;  4EY8 B;  1ERA A;  2NBT A;  1G6M A;  2JQP A;  5DZ5 A;  1W6B A;  1JBD A;  2PJY B;  1TXB A;  3BT2 U;  1JGK A;  1KBS A;  2LCR A;  4OM5 A;  2MJ4 A;  1ERG A;  1IDI A;  2GOO C;  1CVO A;  2MUP A;  5IMT D;  1CXN A;  1IKC A;  1NYS A;  2CCX A;  3KFD I;  1CRF A;  1QKE A;  5EBX A;  2H8U A;  1LSI A;  1PLO A;  3KFD E;  2H62 C;  2K3G A;  3ERA A;  4XJJ A;  1HC9 A;  2QC1 A;  1MAH F;  2BTX A;  2CDX A;  2MFA A;  2J8B A;  1DRS A;  2H5F A;  1NOR A;  2MHY A;  1VB0 A;  2QJA C;  2GOO B;  1IDG A;  4BDT B;  2BHI A;  2H7Z B;  1LJZ A;  1COD A;  1HC9 B;  2PJY C;  1NEA A;  2ABX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...