2OFSA

Crystal structure of human cd59
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
FLQCYNCPNPTADCKTAVQCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords CD59 glycoprotein
publication title Crystal structure of CD59: implications for molecular recognition of the complement proteins C8 and C9 in the membrane-attack complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2ofsA00
2QJBC 2MHYA 1NYUA 4BIKB 5IMYC 4AEAA 1M9ZA 2BHIA 2HLRA 1TXAA 1HC9A 1IDLA 2CCXA 2UWRA 2FD6U 4ZQYA 2PJYC 1L4WA 4UY2C 2L5SA 1CXNA 1IQ9A 1QKEA 3EVSC 1IKCA 2OFSA 3BT1U 2PJYB 1IK8A 1KTZB 1LJZA 1NYSA 2H7ZB 4RUDA 1NORA 1V6PA 1FASA 1REWC 2QJ9C 3ERAA 2GOOC 2CDXA 1NEAA 3U74U 1FSCA 1FFJA 5DZ5A 1CB9A 4DO8A 1CDRA 2JVEA 4EY8B 2MFAA 1S4YA 1CODA 1KXIA 1TFSA 1KBAA 1IDIA 4BDTB 1MR6A 1HAJA 1DRSA 1NTNA 4QTIU 1CREA 4XJJA 2ERAA 2LA1A 5EBXA 1BXPA 4OM5A 1MAHF 1UG4A 1F8UB 3QB4B 1ES7B 1COEA 2CRTA 1KBTA 5IMTD 1ERGA 1YWHA 2H7ZA 1KC4A 2MJYA 3FEVA 2MJ0A 4FAOC 2HLQA 1IDGA 2CTXA 1CHVS 1CDQA 6EBXA 1FSSB 1BTEA 1F94A 2NBTA 1LSIA 1CVOA 1IJCA 1KBSA 2I9BE 2LCRA 2H62C 1I02A 1CCQA 2GOOB 1QM7A 2X8BB 2BTXA 1CXOA 1CDSA 2JQPA 1B41B 1HAAA 1LXHA 3U73U 3BT2U 1RGJA 2H8UA 2MJ4A 4HQPF 1JGKA 1ABTA 2N99A 5DO6A 3NH7A 5DU1A 2VLWA 1LXGA 2H64C 1JE9A 2CRSA 3KFDE 1RL5A 1NTXA 4FAOE 1XT3A 2ABXA 1VB0A 1FRAA 1PLOA 1W6BA 4IYEA 1HOYA 1NXBA 1KU6B 4OM4A 2K3GA 4P7UA 3VTSA 1HC9B 3KFDI 4LFTA 2H62D 3LAQU 1JBDA 1QKDA 1TGXA 3EBXA 3PLCA 1G6MA 1KS6A 1FF4A 1ONJA 1ERAA 2H5FA 2QC1A 1IDHA 1H0JA 3NDSA 3NEQA 1KFHA 2MUOA 3HH7A 2QJAC 1CDTA 1KL8A 2L03A 2J8BA 1LX5B 1ZADA 1CTXA 1TXBA 2UX2A 1CRFA 2MUPA 2H64B
chains in the Genus database with same CATH superfamily
2QJBC 2MHYA 1NYUA 4BIKB 5IMYC 4AEAA 1M9ZA 2BHIA 2HLRA 1TXAA 1HC9A 1IDLA 2CCXA 2UWRA 2FD6U 4ZQYA 2PJYC 1L4WA 4UY2C 2L5SA 1CXNA 1IQ9A 1QKEA 3EVSC 1IKCA 2OFSA 3BT1U 2PJYB 1IK8A 1KTZB 1LJZA 1NYSA 2H7ZB 4RUDA 1NORA 1V6PA 1FASA 1REWC 2QJ9C 3ERAA 2GOOC 2CDXA 1NEAA 3U74U 1FSCA 1FFJA 5DZ5A 1CB9A 4DO8A 1CDRA 2JVEA 4EY8B 2MFAA 1S4YA 1CODA 1KXIA 1TFSA 1KBAA 1IDIA 4BDTB 1MR6A 1HAJA 4KSNA 1DRSA 1NTNA 4QTIU 1CREA 4XJJA 2ERAA 2LA1A 5EBXA 1BXPA 4OM5A 1MAHF 1UG4A 1F8UB 3QB4B 1ES7B 1COEA 2CRTA 1KBTA 5IMTD 1ERGA 1YWHA 2H7ZA 1KC4A 2MJYA 3FEVA 2MJ0A 4FAOC 2HLQA 1IDGA 2CTXA 1CHVS 1CDQA 6EBXA 1FSSB 1BTEA 1F94A 2NBTA 1LSIA 1CVOA 1IJCA 1KBSA 2I9BE 2LCRA 2H62C 1I02A 1CCQA 2GOOB 1QM7A 2X8BB 2BTXA 1CXOA 1CDSA 2JQPA 1B41B 1HAAA 1LXHA 3U73U 3BT2U 1RGJA 2H8UA 2MJ4A 4HQPF 1JGKA 1ABTA 2N99A 5DO6A 3NH7A 5DU1A 2VLWA 1LXGA 2H64C 1JE9A 2CRSA 3KFDE 1RL5A 1NTXA 4FAOE 1XT3A 2ABXA 1VB0A 1FRAA 1PLOA 1W6BA 4IYEA 1HOYA 1NXBA 1KU6B 4OM4A 2K3GA 4P7UA 3VTSA 1HC9B 3KFDI 4LFTA 2H62D 3LAQU 1JBDA 1QKDA 1TGXA 3EBXA 3PLCA 1G6MA 1KS6A 1FF4A 1ONJA 1ERAA 2H5FA 2QC1A 1IDHA 1H0JA 3NDSA 3NEQA 1KFHA 2MUOA 3HH7A 2QJAC 1CDTA 1KL8A 2L03A 2J8BA 1LX5B 1ZADA 1CTXA 1TXBA 2UX2A 1CRFA 2MUPA 2H64B
chains in the Genus database with same CATH topology
2QJBC 2MHYA 1NYUA 4BIKB 5IMYC 4AEAA 1M9ZA 2BHIA 2HLRA 1TXAA 1HC9A 1IDLA 2CCXA 2UWRA 2FD6U 4ZQYA 2PJYC 1L4WA 4UY2C 2L5SA 1CXNA 1IQ9A 1QKEA 3EVSC 1IKCA 2OFSA 3BT1U 2PJYB 1IK8A 1KTZB 1LJZA 1NYSA 2H7ZB 4RUDA 1NORA 1V6PA 1FASA 1REWC 2QJ9C 3ERAA 2GOOC 2CDXA 1NEAA 3U74U 1FSCA 1FFJA 5DZ5A 1CB9A 4DO8A 1CDRA 2JVEA 4EY8B 2MFAA 1S4YA 1CODA 1KXIA 1TFSA 1KBAA 1IDIA 4BDTB 1MR6A 1HAJA 4KSNA 1DRSA 1NTNA 4QTIU 1CREA 4XJJA 2ERAA 2LA1A 5EBXA 1BXPA 4OM5A 1MAHF 1UG4A 1F8UB 3QB4B 1ES7B 1COEA 2CRTA 1KBTA 5IMTD 1ERGA 1YWHA 2H7ZA 1KC4A 2MJYA 3FEVA 2MJ0A 4FAOC 2HLQA 1IDGA 2CTXA 1CHVS 1CDQA 6EBXA 1FSSB 1BTEA 1F94A 2NBTA 1LSIA 1CVOA 1IJCA 1KBSA 2I9BE 2LCRA 2H62C 1I02A 1CCQA 2GOOB 1QM7A 2X8BB 2BTXA 1CXOA 1CDSA 2JQPA 1B41B 1HAAA 1LXHA 3U73U 3BT2U 1RGJA 2H8UA 2MJ4A 4HQPF 1JGKA 1ABTA 2N99A 5DO6A 3NH7A 5DU1A 2VLWA 1LXGA 2H64C 1JE9A 2CRSA 3KFDE 1RL5A 1NTXA 4FAOE 1XT3A 2ABXA 1VB0A 1FRAA 1PLOA 1W6BA 4IYEA 1HOYA 1NXBA 1KU6B 4OM4A 2K3GA 4P7UA 3VTSA 1HC9B 3KFDI 4LFTA 2H62D 3LAQU 1JBDA 1QKDA 1TGXA 3EBXA 3PLCA 1G6MA 1KS6A 1FF4A 1ONJA 1ERAA 2H5FA 2QC1A 1IDHA 1H0JA 3NDSA 3NEQA 1KFHA 2MUOA 3HH7A 2QJAC 1CDTA 1KL8A 2L03A 2J8BA 1LX5B 1ZADA 1CTXA 1TXBA 2UX2A 1CRFA 2MUPA 2H64B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJB C;  2MHY A;  1NYU A;  4BIK B;  5IMY C;  4AEA A;  1M9Z A;  2BHI A;  2HLR A;  1TXA A;  1HC9 A;  1IDL A;  2CCX A;  2UWR A;  2FD6 U;  4ZQY A;  2PJY C;  1L4W A;  4UY2 C;  2L5S A;  1CXN A;  1IQ9 A;  1QKE A;  3EVS C;  1IKC A;  2OFS A;  3BT1 U;  2PJY B;  1IK8 A;  1KTZ B;  1LJZ A;  1NYS A;  2H7Z B;  4RUD A;  1NOR A;  1V6P A;  1FAS A;  1REW C;  2QJ9 C;  3ERA A;  2GOO C;  2CDX A;  1NEA A;  3U74 U;  1FSC A;  1FFJ A;  5DZ5 A;  1CB9 A;  4DO8 A;  1CDR A;  2JVE A;  4EY8 B;  2MFA A;  1S4Y A;  1COD A;  1KXI A;  1TFS A;  1KBA A;  1IDI A;  4BDT B;  1MR6 A;  1HAJ A;  1DRS A;  1NTN A;  4QTI U;  1CRE A;  4XJJ A;  2ERA A;  2LA1 A;  5EBX A;  1BXP A;  4OM5 A;  1MAH F;  1UG4 A;  1F8U B;  3QB4 B;  1ES7 B;  1COE A;  2CRT A;  1KBT A;  5IMT D;  1ERG A;  1YWH A;  2H7Z A;  1KC4 A;  2MJY A;  3FEV A;  2MJ0 A;  4FAO C;  2HLQ A;  1IDG A;  2CTX A;  1CHV S;  1CDQ A;  6EBX A;  1FSS B;  1BTE A;  1F94 A;  2NBT A;  1LSI A;  1CVO A;  1IJC A;  1KBS A;  2I9B E;  2LCR A;  2H62 C;  1I02 A;  1CCQ A;  2GOO B;  1QM7 A;  2X8B B;  2BTX A;  1CXO A;  1CDS A;  2JQP A;  1B41 B;  1HAA A;  1LXH A;  3U73 U;  3BT2 U;  1RGJ A;  2H8U A;  2MJ4 A;  4HQP F;  1JGK A;  1ABT A;  2N99 A;  5DO6 A;  3NH7 A;  5DU1 A;  2VLW A;  1LXG A;  2H64 C;  1JE9 A;  2CRS A;  3KFD E;  1RL5 A;  1NTX A;  4FAO E;  1XT3 A;  2ABX A;  1VB0 A;  1FRA A;  1PLO A;  1W6B A;  4IYE A;  1HOY A;  1NXB A;  1KU6 B;  4OM4 A;  2K3G A;  4P7U A;  3VTS A;  1HC9 B;  3KFD I;  4LFT A;  2H62 D;  3LAQ U;  1JBD A;  1QKD A;  1TGX A;  3EBX A;  3PLC A;  1G6M A;  1KS6 A;  1FF4 A;  1ONJ A;  1ERA A;  2H5F A;  2QC1 A;  1IDH A;  1H0J A;  3NDS A;  3NEQ A;  1KFH A;  2MUO A;  3HH7 A;  2QJA C;  1CDT A;  1KL8 A;  2L03 A;  2J8B A;  1LX5 B;  1ZAD A;  1CTX A;  1TXB A;  2UX2 A;  1CRF A;  2MUP A;  2H64 B; 
#chains in the Genus database with same CATH topology
 2QJB C;  2MHY A;  1NYU A;  4BIK B;  5IMY C;  4AEA A;  1M9Z A;  2BHI A;  2HLR A;  1TXA A;  1HC9 A;  1IDL A;  2CCX A;  2UWR A;  2FD6 U;  4ZQY A;  2PJY C;  1L4W A;  4UY2 C;  2L5S A;  1CXN A;  1IQ9 A;  1QKE A;  3EVS C;  1IKC A;  2OFS A;  3BT1 U;  2PJY B;  1IK8 A;  1KTZ B;  1LJZ A;  1NYS A;  2H7Z B;  4RUD A;  1NOR A;  1V6P A;  1FAS A;  1REW C;  2QJ9 C;  3ERA A;  2GOO C;  2CDX A;  1NEA A;  3U74 U;  1FSC A;  1FFJ A;  5DZ5 A;  1CB9 A;  4DO8 A;  1CDR A;  2JVE A;  4EY8 B;  2MFA A;  1S4Y A;  1COD A;  1KXI A;  1TFS A;  1KBA A;  1IDI A;  4BDT B;  1MR6 A;  1HAJ A;  4KSN A;  1DRS A;  1NTN A;  4QTI U;  1CRE A;  4XJJ A;  2ERA A;  2LA1 A;  5EBX A;  1BXP A;  4OM5 A;  1MAH F;  1UG4 A;  1F8U B;  3QB4 B;  1ES7 B;  1COE A;  2CRT A;  1KBT A;  5IMT D;  1ERG A;  1YWH A;  2H7Z A;  1KC4 A;  2MJY A;  3FEV A;  2MJ0 A;  4FAO C;  2HLQ A;  1IDG A;  2CTX A;  1CHV S;  1CDQ A;  6EBX A;  1FSS B;  1BTE A;  1F94 A;  2NBT A;  1LSI A;  1CVO A;  1IJC A;  1KBS A;  2I9B E;  2LCR A;  2H62 C;  1I02 A;  1CCQ A;  2GOO B;  1QM7 A;  2X8B B;  2BTX A;  1CXO A;  1CDS A;  2JQP A;  1B41 B;  1HAA A;  1LXH A;  3U73 U;  3BT2 U;  1RGJ A;  2H8U A;  2MJ4 A;  4HQP F;  1JGK A;  1ABT A;  2N99 A;  5DO6 A;  3NH7 A;  5DU1 A;  2VLW A;  1LXG A;  2H64 C;  1JE9 A;  2CRS A;  3KFD E;  1RL5 A;  1NTX A;  4FAO E;  1XT3 A;  2ABX A;  1VB0 A;  1FRA A;  1PLO A;  1W6B A;  4IYE A;  1HOY A;  1NXB A;  1KU6 B;  4OM4 A;  2K3G A;  4P7U A;  3VTS A;  1HC9 B;  3KFD I;  4LFT A;  2H62 D;  3LAQ U;  1JBD A;  1QKD A;  1TGX A;  3EBX A;  3PLC A;  1G6M A;  1KS6 A;  1FF4 A;  1ONJ A;  1ERA A;  2H5F A;  2QC1 A;  1IDH A;  1H0J A;  3NDS A;  3NEQ A;  1KFH A;  2MUO A;  3HH7 A;  2QJA C;  1CDT A;  1KL8 A;  2L03 A;  2J8B A;  1LX5 B;  1ZAD A;  1CTX A;  1TXB A;  2UX2 A;  1CRF A;  2MUP A;  2H64 B; 
#chains in the Genus database with same CATH homology
 2QJB C;  2MHY A;  1NYU A;  4BIK B;  5IMY C;  4AEA A;  1M9Z A;  2BHI A;  2HLR A;  1TXA A;  1HC9 A;  1IDL A;  2CCX A;  2UWR A;  2FD6 U;  4ZQY A;  2PJY C;  1L4W A;  4UY2 C;  2L5S A;  1CXN A;  1IQ9 A;  1QKE A;  3EVS C;  1IKC A;  2OFS A;  3BT1 U;  2PJY B;  1IK8 A;  1KTZ B;  1LJZ A;  1NYS A;  2H7Z B;  4RUD A;  1NOR A;  1V6P A;  1FAS A;  1REW C;  2QJ9 C;  3ERA A;  2GOO C;  2CDX A;  1NEA A;  3U74 U;  1FSC A;  1FFJ A;  5DZ5 A;  1CB9 A;  4DO8 A;  1CDR A;  2JVE A;  4EY8 B;  2MFA A;  1S4Y A;  1COD A;  1KXI A;  1TFS A;  1KBA A;  1IDI A;  4BDT B;  1MR6 A;  1HAJ A;  4KSN A;  1DRS A;  1NTN A;  4QTI U;  1CRE A;  4XJJ A;  2ERA A;  2LA1 A;  5EBX A;  1BXP A;  4OM5 A;  1MAH F;  1UG4 A;  1F8U B;  3QB4 B;  1ES7 B;  1COE A;  2CRT A;  1KBT A;  5IMT D;  1ERG A;  1YWH A;  2H7Z A;  1KC4 A;  2MJY A;  3FEV A;  2MJ0 A;  4FAO C;  2HLQ A;  1IDG A;  2CTX A;  1CHV S;  1CDQ A;  6EBX A;  1FSS B;  1BTE A;  1F94 A;  2NBT A;  1LSI A;  1CVO A;  1IJC A;  1KBS A;  2I9B E;  2LCR A;  2H62 C;  1I02 A;  1CCQ A;  2GOO B;  1QM7 A;  2X8B B;  2BTX A;  1CXO A;  1CDS A;  2JQP A;  1B41 B;  1HAA A;  1LXH A;  3U73 U;  3BT2 U;  1RGJ A;  2H8U A;  2MJ4 A;  4HQP F;  1JGK A;  1ABT A;  2N99 A;  5DO6 A;  3NH7 A;  5DU1 A;  2VLW A;  1LXG A;  2H64 C;  1JE9 A;  2CRS A;  3KFD E;  1RL5 A;  1NTX A;  4FAO E;  1XT3 A;  2ABX A;  1VB0 A;  1FRA A;  1PLO A;  1W6B A;  4IYE A;  1HOY A;  1NXB A;  1KU6 B;  4OM4 A;  2K3G A;  4P7U A;  3VTS A;  1HC9 B;  3KFD I;  4LFT A;  2H62 D;  3LAQ U;  1JBD A;  1QKD A;  1TGX A;  3EBX A;  3PLC A;  1G6M A;  1KS6 A;  1FF4 A;  1ONJ A;  1ERA A;  2H5F A;  2QC1 A;  1IDH A;  1H0J A;  3NDS A;  3NEQ A;  1KFH A;  2MUO A;  3HH7 A;  2QJA C;  1CDT A;  1KL8 A;  2L03 A;  2J8B A;  1LX5 B;  1ZAD A;  1CTX A;  1TXB A;  2UX2 A;  1CRF A;  2MUP A;  2H64 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...