1TXAA

Solution nmr structure of toxin b, a long neurotoxin from the venom of the king cobra, minimized average structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
73
structure length
73
Chain Sequence
TKCYVTPDATSQTCPDGQDICYTKTWCDGFCSSRGKRIDLGCAATCPKVKPGVDIKCCSTDNCNPFPTWKRKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Neurotoxin
molecule keywords TOXIN B
publication title Solution structure of toxin b, a long neurotoxin from the venom of the king cobra (Ophiophagus hannah).
pubmed doi rcsb
total genus 4
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1996-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1txaA00
4XJJA 4ZQYA 2CRTA 1KXIA 2H7ZA 2MHYA 1IDIA 1CHVS 1CDSA 1KC4A 1NYSA 1QKEA 3LAQU 2HLRA 1TGXA 2GOOC 5DU1A 4EY8B 1KL8A 1F8UB 2BHIA 1FF4A 2QC1A 2H64C 1HOYA 1ERAA 1BTEA 2UWRA 1NTNA 1TFSA 2FD6U 1REWC 1CCQA 3U74U 2K3GA 2MUOA 1NYUA 1KFHA 1NXBA 5DO6A 1H0JA 1HC9A 3PLCA 2PJYC 1V6PA 2X8BB 1CXOA 1JE9A 1IK8A 4OM4A 1CDRA 2OFSA 1YWHA 4OM5A 3U73U 2LCRA 1FASA 1LJZA 2CRSA 1CRFA 1ONJA 2MUPA 2MJ0A 4IYEA 1TXBA 1MR6A 1W6BA 2CCXA 2I9BE 3ERAA 6EBXA 4FAOE 2BTXA 2HLQA 3NH7A 2QJAC 1QM7A 2MJYA 1IDLA 1DRSA 2LA1A 1MAHF 2CDXA 4DO8A 2GOOB 1FSCA 1L4WA 1XT3A 3QB4B 1IDHA 3EBXA 1G6MA 1CVOA 2H64B 3BT2U 1CODA 2UX2A 1KBSA 2ABXA 2H8UA 1LX5B 4P7UA 4BDTB 2QJBC 1PLOA 2J8BA 1CXNA 1LSIA 2PJYB 2CTXA 3FEVA 3BT1U 1KBTA 1F94A 3KFDI 2NBTA 1KBAA 1FSSB 2N99A 4HQPF 2QJ9C 2L5SA 1RGJA 1BXPA 1CDQA 1LXHA 1NTXA 3NDSA 1CDTA 2L03A 1LXGA 1ABTA 3KFDE 1KU6B 1IKCA 3EVSC 1FFJA 1VB0A 1HC9B 1UG4A 3HH7A 1S4YA 1IJCA 1QKDA 1ES7B 4LFTA 5IMYC 3NEQA 1NORA 1CTXA 5IMTD 2JVEA 2JQPA 3VTSA 1I02A 1COEA 1TXAA 4RUDA 1NEAA 1FRAA 1KS6A 2H7ZB 5EBXA 1CB9A 1ERGA 1IDGA 1IQ9A 4BIKB 2MJ4A 2VLWA 2MFAA 2H5FA 1B41B 4UY2C 5DZ5A 4QTIU 1CREA 1ZADA 1JGKA 1M9ZA 1RL5A 1JBDA 1HAJA 2H62D 2ERAA 4FAOC 1KTZB 1HAAA 4AEAA 2H62C
chains in the Genus database with same CATH superfamily
4XJJA 4ZQYA 2CRTA 1KXIA 2H7ZA 2MHYA 1IDIA 1CHVS 1CDSA 1KC4A 1NYSA 1QKEA 3LAQU 2HLRA 1TGXA 2GOOC 5DU1A 4EY8B 1KL8A 1F8UB 2BHIA 1FF4A 2QC1A 2H64C 1HOYA 1ERAA 1BTEA 2UWRA 1NTNA 1TFSA 2FD6U 1REWC 1CCQA 3U74U 2K3GA 2MUOA 1NYUA 1KFHA 1NXBA 5DO6A 1H0JA 1HC9A 3PLCA 2PJYC 1V6PA 2X8BB 1CXOA 1JE9A 1IK8A 4OM4A 1CDRA 2OFSA 1YWHA 4OM5A 3U73U 2LCRA 1FASA 1LJZA 2CRSA 1CRFA 1ONJA 2MUPA 2MJ0A 4IYEA 1TXBA 1MR6A 1W6BA 2CCXA 2I9BE 3ERAA 6EBXA 4FAOE 2BTXA 2HLQA 3NH7A 2QJAC 1QM7A 2MJYA 1IDLA 1DRSA 2LA1A 1MAHF 2CDXA 4DO8A 2GOOB 1FSCA 1L4WA 1XT3A 3QB4B 1IDHA 3EBXA 1G6MA 1CVOA 4KSNA 2H64B 3BT2U 1CODA 2UX2A 1KBSA 2ABXA 2H8UA 1LX5B 4P7UA 4BDTB 2QJBC 1PLOA 2J8BA 1CXNA 1LSIA 2PJYB 2CTXA 3FEVA 3BT1U 1KBTA 1F94A 3KFDI 2NBTA 1KBAA 1FSSB 2N99A 4HQPF 2QJ9C 2L5SA 1RGJA 1BXPA 1CDQA 1LXHA 1NTXA 3NDSA 1CDTA 2L03A 1LXGA 1ABTA 3KFDE 1KU6B 1IKCA 3EVSC 1FFJA 1VB0A 1HC9B 1UG4A 3HH7A 1S4YA 1IJCA 1QKDA 1ES7B 4LFTA 5IMYC 3NEQA 1NORA 1CTXA 5IMTD 2JVEA 2JQPA 3VTSA 1I02A 1COEA 1TXAA 4RUDA 1NEAA 1FRAA 1KS6A 2H7ZB 5EBXA 1CB9A 1ERGA 1IDGA 1IQ9A 4BIKB 2MJ4A 2VLWA 2MFAA 2H5FA 1B41B 4UY2C 5DZ5A 4QTIU 1CREA 1ZADA 1JGKA 1M9ZA 1RL5A 1JBDA 1HAJA 2H62D 2ERAA 4FAOC 1KTZB 1HAAA 4AEAA 2H62C
chains in the Genus database with same CATH topology
4XJJA 4ZQYA 2CRTA 1KXIA 2H7ZA 2MHYA 1IDIA 1CHVS 1CDSA 1KC4A 1NYSA 1QKEA 3LAQU 2HLRA 1TGXA 2GOOC 5DU1A 4EY8B 1KL8A 1F8UB 2BHIA 1FF4A 2QC1A 2H64C 1HOYA 1ERAA 1BTEA 2UWRA 1NTNA 1TFSA 2FD6U 1REWC 1CCQA 3U74U 2K3GA 2MUOA 1NYUA 1KFHA 1NXBA 5DO6A 1H0JA 1HC9A 3PLCA 2PJYC 1V6PA 2X8BB 1CXOA 1JE9A 1IK8A 4OM4A 1CDRA 2OFSA 1YWHA 4OM5A 3U73U 2LCRA 1FASA 1LJZA 2CRSA 1CRFA 1ONJA 2MUPA 2MJ0A 4IYEA 1TXBA 1MR6A 1W6BA 2CCXA 2I9BE 3ERAA 6EBXA 4FAOE 2BTXA 2HLQA 3NH7A 2QJAC 1QM7A 2MJYA 1IDLA 1DRSA 2LA1A 1MAHF 2CDXA 4DO8A 2GOOB 1FSCA 1L4WA 1XT3A 3QB4B 1IDHA 3EBXA 1G6MA 1CVOA 4KSNA 2H64B 3BT2U 1CODA 2UX2A 1KBSA 2ABXA 2H8UA 1LX5B 4P7UA 4BDTB 2QJBC 1PLOA 2J8BA 1CXNA 1LSIA 2PJYB 2CTXA 3FEVA 3BT1U 1KBTA 1F94A 3KFDI 2NBTA 1KBAA 1FSSB 2N99A 4HQPF 2QJ9C 2L5SA 1RGJA 1BXPA 1CDQA 1LXHA 1NTXA 3NDSA 1CDTA 2L03A 1LXGA 1ABTA 3KFDE 1KU6B 1IKCA 3EVSC 1FFJA 1VB0A 1HC9B 1UG4A 3HH7A 1S4YA 1IJCA 1QKDA 1ES7B 4LFTA 5IMYC 3NEQA 1NORA 1CTXA 5IMTD 2JVEA 2JQPA 3VTSA 1I02A 1COEA 1TXAA 4RUDA 1NEAA 1FRAA 1KS6A 2H7ZB 5EBXA 1CB9A 1ERGA 1IDGA 1IQ9A 4BIKB 2MJ4A 2VLWA 2MFAA 2H5FA 1B41B 4UY2C 5DZ5A 4QTIU 1CREA 1ZADA 1JGKA 1M9ZA 1RL5A 1JBDA 1HAJA 2H62D 2ERAA 4FAOC 1KTZB 1HAAA 4AEAA 2H62C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XJJ A;  4ZQY A;  2CRT A;  1KXI A;  2H7Z A;  2MHY A;  1IDI A;  1CHV S;  1CDS A;  1KC4 A;  1NYS A;  1QKE A;  3LAQ U;  2HLR A;  1TGX A;  2GOO C;  5DU1 A;  4EY8 B;  1KL8 A;  1F8U B;  2BHI A;  1FF4 A;  2QC1 A;  2H64 C;  1HOY A;  1ERA A;  1BTE A;  2UWR A;  1NTN A;  1TFS A;  2FD6 U;  1REW C;  1CCQ A;  3U74 U;  2K3G A;  2MUO A;  1NYU A;  1KFH A;  1NXB A;  5DO6 A;  1H0J A;  1HC9 A;  3PLC A;  2PJY C;  1V6P A;  2X8B B;  1CXO A;  1JE9 A;  1IK8 A;  4OM4 A;  1CDR A;  2OFS A;  1YWH A;  4OM5 A;  3U73 U;  2LCR A;  1FAS A;  1LJZ A;  2CRS A;  1CRF A;  1ONJ A;  2MUP A;  2MJ0 A;  4IYE A;  1TXB A;  1MR6 A;  1W6B A;  2CCX A;  2I9B E;  3ERA A;  6EBX A;  4FAO E;  2BTX A;  2HLQ A;  3NH7 A;  2QJA C;  1QM7 A;  2MJY A;  1IDL A;  1DRS A;  2LA1 A;  1MAH F;  2CDX A;  4DO8 A;  2GOO B;  1FSC A;  1L4W A;  1XT3 A;  3QB4 B;  1IDH A;  3EBX A;  1G6M A;  1CVO A;  2H64 B;  3BT2 U;  1COD A;  2UX2 A;  1KBS A;  2ABX A;  2H8U A;  1LX5 B;  4P7U A;  4BDT B;  2QJB C;  1PLO A;  2J8B A;  1CXN A;  1LSI A;  2PJY B;  2CTX A;  3FEV A;  3BT1 U;  1KBT A;  1F94 A;  3KFD I;  2NBT A;  1KBA A;  1FSS B;  2N99 A;  4HQP F;  2QJ9 C;  2L5S A;  1RGJ A;  1BXP A;  1CDQ A;  1LXH A;  1NTX A;  3NDS A;  1CDT A;  2L03 A;  1LXG A;  1ABT A;  3KFD E;  1KU6 B;  1IKC A;  3EVS C;  1FFJ A;  1VB0 A;  1HC9 B;  1UG4 A;  3HH7 A;  1S4Y A;  1IJC A;  1QKD A;  1ES7 B;  4LFT A;  5IMY C;  3NEQ A;  1NOR A;  1CTX A;  5IMT D;  2JVE A;  2JQP A;  3VTS A;  1I02 A;  1COE A;  1TXA A;  4RUD A;  1NEA A;  1FRA A;  1KS6 A;  2H7Z B;  5EBX A;  1CB9 A;  1ERG A;  1IDG A;  1IQ9 A;  4BIK B;  2MJ4 A;  2VLW A;  2MFA A;  2H5F A;  1B41 B;  4UY2 C;  5DZ5 A;  4QTI U;  1CRE A;  1ZAD A;  1JGK A;  1M9Z A;  1RL5 A;  1JBD A;  1HAJ A;  2H62 D;  2ERA A;  4FAO C;  1KTZ B;  1HAA A;  4AEA A;  2H62 C; 
#chains in the Genus database with same CATH topology
 4XJJ A;  4ZQY A;  2CRT A;  1KXI A;  2H7Z A;  2MHY A;  1IDI A;  1CHV S;  1CDS A;  1KC4 A;  1NYS A;  1QKE A;  3LAQ U;  2HLR A;  1TGX A;  2GOO C;  5DU1 A;  4EY8 B;  1KL8 A;  1F8U B;  2BHI A;  1FF4 A;  2QC1 A;  2H64 C;  1HOY A;  1ERA A;  1BTE A;  2UWR A;  1NTN A;  1TFS A;  2FD6 U;  1REW C;  1CCQ A;  3U74 U;  2K3G A;  2MUO A;  1NYU A;  1KFH A;  1NXB A;  5DO6 A;  1H0J A;  1HC9 A;  3PLC A;  2PJY C;  1V6P A;  2X8B B;  1CXO A;  1JE9 A;  1IK8 A;  4OM4 A;  1CDR A;  2OFS A;  1YWH A;  4OM5 A;  3U73 U;  2LCR A;  1FAS A;  1LJZ A;  2CRS A;  1CRF A;  1ONJ A;  2MUP A;  2MJ0 A;  4IYE A;  1TXB A;  1MR6 A;  1W6B A;  2CCX A;  2I9B E;  3ERA A;  6EBX A;  4FAO E;  2BTX A;  2HLQ A;  3NH7 A;  2QJA C;  1QM7 A;  2MJY A;  1IDL A;  1DRS A;  2LA1 A;  1MAH F;  2CDX A;  4DO8 A;  2GOO B;  1FSC A;  1L4W A;  1XT3 A;  3QB4 B;  1IDH A;  3EBX A;  1G6M A;  1CVO A;  4KSN A;  2H64 B;  3BT2 U;  1COD A;  2UX2 A;  1KBS A;  2ABX A;  2H8U A;  1LX5 B;  4P7U A;  4BDT B;  2QJB C;  1PLO A;  2J8B A;  1CXN A;  1LSI A;  2PJY B;  2CTX A;  3FEV A;  3BT1 U;  1KBT A;  1F94 A;  3KFD I;  2NBT A;  1KBA A;  1FSS B;  2N99 A;  4HQP F;  2QJ9 C;  2L5S A;  1RGJ A;  1BXP A;  1CDQ A;  1LXH A;  1NTX A;  3NDS A;  1CDT A;  2L03 A;  1LXG A;  1ABT A;  3KFD E;  1KU6 B;  1IKC A;  3EVS C;  1FFJ A;  1VB0 A;  1HC9 B;  1UG4 A;  3HH7 A;  1S4Y A;  1IJC A;  1QKD A;  1ES7 B;  4LFT A;  5IMY C;  3NEQ A;  1NOR A;  1CTX A;  5IMT D;  2JVE A;  2JQP A;  3VTS A;  1I02 A;  1COE A;  1TXA A;  4RUD A;  1NEA A;  1FRA A;  1KS6 A;  2H7Z B;  5EBX A;  1CB9 A;  1ERG A;  1IDG A;  1IQ9 A;  4BIK B;  2MJ4 A;  2VLW A;  2MFA A;  2H5F A;  1B41 B;  4UY2 C;  5DZ5 A;  4QTI U;  1CRE A;  1ZAD A;  1JGK A;  1M9Z A;  1RL5 A;  1JBD A;  1HAJ A;  2H62 D;  2ERA A;  4FAO C;  1KTZ B;  1HAA A;  4AEA A;  2H62 C; 
#chains in the Genus database with same CATH homology
 4XJJ A;  4ZQY A;  2CRT A;  1KXI A;  2H7Z A;  2MHY A;  1IDI A;  1CHV S;  1CDS A;  1KC4 A;  1NYS A;  1QKE A;  3LAQ U;  2HLR A;  1TGX A;  2GOO C;  5DU1 A;  4EY8 B;  1KL8 A;  1F8U B;  2BHI A;  1FF4 A;  2QC1 A;  2H64 C;  1HOY A;  1ERA A;  1BTE A;  2UWR A;  1NTN A;  1TFS A;  2FD6 U;  1REW C;  1CCQ A;  3U74 U;  2K3G A;  2MUO A;  1NYU A;  1KFH A;  1NXB A;  5DO6 A;  1H0J A;  1HC9 A;  3PLC A;  2PJY C;  1V6P A;  2X8B B;  1CXO A;  1JE9 A;  1IK8 A;  4OM4 A;  1CDR A;  2OFS A;  1YWH A;  4OM5 A;  3U73 U;  2LCR A;  1FAS A;  1LJZ A;  2CRS A;  1CRF A;  1ONJ A;  2MUP A;  2MJ0 A;  4IYE A;  1TXB A;  1MR6 A;  1W6B A;  2CCX A;  2I9B E;  3ERA A;  6EBX A;  4FAO E;  2BTX A;  2HLQ A;  3NH7 A;  2QJA C;  1QM7 A;  2MJY A;  1IDL A;  1DRS A;  2LA1 A;  1MAH F;  2CDX A;  4DO8 A;  2GOO B;  1FSC A;  1L4W A;  1XT3 A;  3QB4 B;  1IDH A;  3EBX A;  1G6M A;  1CVO A;  4KSN A;  2H64 B;  3BT2 U;  1COD A;  2UX2 A;  1KBS A;  2ABX A;  2H8U A;  1LX5 B;  4P7U A;  4BDT B;  2QJB C;  1PLO A;  2J8B A;  1CXN A;  1LSI A;  2PJY B;  2CTX A;  3FEV A;  3BT1 U;  1KBT A;  1F94 A;  3KFD I;  2NBT A;  1KBA A;  1FSS B;  2N99 A;  4HQP F;  2QJ9 C;  2L5S A;  1RGJ A;  1BXP A;  1CDQ A;  1LXH A;  1NTX A;  3NDS A;  1CDT A;  2L03 A;  1LXG A;  1ABT A;  3KFD E;  1KU6 B;  1IKC A;  3EVS C;  1FFJ A;  1VB0 A;  1HC9 B;  1UG4 A;  3HH7 A;  1S4Y A;  1IJC A;  1QKD A;  1ES7 B;  4LFT A;  5IMY C;  3NEQ A;  1NOR A;  1CTX A;  5IMT D;  2JVE A;  2JQP A;  3VTS A;  1I02 A;  1COE A;  1TXA A;  4RUD A;  1NEA A;  1FRA A;  1KS6 A;  2H7Z B;  5EBX A;  1CB9 A;  1ERG A;  1IDG A;  1IQ9 A;  4BIK B;  2MJ4 A;  2VLW A;  2MFA A;  2H5F A;  1B41 B;  4UY2 C;  5DZ5 A;  4QTI U;  1CRE A;  1ZAD A;  1JGK A;  1M9Z A;  1RL5 A;  1JBD A;  1HAJ A;  2H62 D;  2ERA A;  4FAO C;  1KTZ B;  1HAA A;  4AEA A;  2H62 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...