1TXBA

Solution nmr structure of toxin b, a long neurotoxin from the venom of the king cobra, 10 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
73
structure length
73
Chain Sequence
TKCYVTPDATSQTCPDGQDICYTKTWCDGFCSSRGKRIDLGCAATCPKVKPGVDIKCCSTDNCNPFPTWKRKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of toxin b, a long neurotoxin from the venom of the king cobra (Ophiophagus hannah).
pubmed doi rcsb
molecule tags Neurotoxin
molecule keywords TOXIN B
total genus 4
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1996-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1txbA00
3HH7A 1KBSA 2ERAA 3EVSC 5IMYC 2LA1A 1TXBA 3NDSA 1NORA 1KS6A 1FF4A 1TGXA 1H0JA 1KTZB 1KBTA 3NEQA 2CDXA 1CRFA 4UY2C 4BDTB 3BT2U 1CHVS 2UX2A 1MAHF 5IMTD 5DU1A 1ONJA 2H62D 1CREA 2QJBC 3VTSA 2QC1A 2OFSA 3KFDI 4OM4A 3LAQU 3FEVA 5DZ5A 1NTXA 1KBAA 1COEA 1NEAA 1ES7B 1W6BA 1L4WA 1IK8A 1NYSA 1ERGA 1NYUA 1ZADA 1F94A 1FSCA 2HLQA 2PJYC 1HOYA 6EBXA 2H5FA 3U73U 4HQPF 1YWHA 2J8BA 3EBXA 2CTXA 1RL5A 1TFSA 2MJ4A 1KL8A 2MJYA 2QJAC 1FSSB 2HLRA 2CRTA 1IDIA 1KXIA 1G6MA 1V6PA 1JBDA 2JQPA 2MFAA 1LSIA 3PLCA 2H64C 2K3GA 2L5SA 1CVOA 1CXOA 1ABTA 2LCRA 1MR6A 2MHYA 1F8UB 2H62C 1S4YA 2GOOC 2X8BB 2PJYB 1KC4A 1TXAA 1NTNA 2I9BE 1QKDA 2H8UA 1KFHA 2BHIA 4XJJA 4FAOE 5DO6A 2JVEA 2L03A 2BTXA 2MJ0A 4QTIU 2ABXA 2FD6U 1FRAA 1CDQA 1CODA 1HAJA 3QB4B 1IDLA 2QJ9C 3BT1U 1JGKA 4ZQYA 5EBXA 4BIKB 2H64B 1IQ9A 2CRSA 2H7ZB 1I02A 4AEAA 1IDHA 1UG4A 2NBTA 4FAOC 4DO8A 1IKCA 4LFTA 1DRSA 1M9ZA 1NXBA 2MUPA 3U74U 1CTXA 1LJZA 1BXPA 4P7UA 1CDTA 1HC9B 1CXNA 2MUOA 2N99A 2UWRA 4EY8B 1CB9A 1IJCA 2H7ZA 1RGJA 3ERAA 1QKEA 4OM5A 1CDRA 1CDSA 1XT3A 1VB0A 1REWC 3KFDE 1FFJA 1KU6B 3NH7A 1ERAA 2CCXA 1BTEA 2GOOB 1LX5B 1LXGA 1HAAA 2VLWA 1IDGA 1QM7A 1LXHA 1PLOA 1HC9A 1B41B 1JE9A 4IYEA 1CCQA 1FASA 4RUDA
chains in the Genus database with same CATH superfamily
3HH7A 1KBSA 2ERAA 3EVSC 5IMYC 2LA1A 1TXBA 3NDSA 1NORA 1KS6A 1FF4A 1TGXA 1H0JA 1KTZB 1KBTA 3NEQA 2CDXA 1CRFA 4UY2C 4BDTB 3BT2U 1CHVS 2UX2A 1MAHF 5IMTD 5DU1A 1ONJA 2H62D 1CREA 2QJBC 3VTSA 2QC1A 2OFSA 3KFDI 4OM4A 3LAQU 3FEVA 5DZ5A 1NTXA 1KBAA 1COEA 1NEAA 1ES7B 1W6BA 1L4WA 1IK8A 1NYSA 1ERGA 1NYUA 1ZADA 1F94A 1FSCA 2HLQA 2PJYC 1HOYA 6EBXA 2H5FA 3U73U 4HQPF 1YWHA 2J8BA 3EBXA 2CTXA 1RL5A 1TFSA 4KSNA 2MJ4A 1KL8A 2MJYA 2QJAC 1FSSB 2HLRA 2CRTA 1IDIA 1KXIA 1G6MA 1V6PA 1JBDA 2JQPA 2MFAA 1LSIA 3PLCA 2H64C 2K3GA 2L5SA 1CVOA 1CXOA 1ABTA 2LCRA 1MR6A 2MHYA 1F8UB 2H62C 1S4YA 2GOOC 2X8BB 2PJYB 1KC4A 1TXAA 1NTNA 2I9BE 1QKDA 2H8UA 1KFHA 2BHIA 4XJJA 4FAOE 5DO6A 2JVEA 2L03A 2BTXA 2MJ0A 4QTIU 2ABXA 2FD6U 1FRAA 1CDQA 1CODA 1HAJA 3QB4B 1IDLA 2QJ9C 3BT1U 1JGKA 4ZQYA 5EBXA 4BIKB 2H64B 1IQ9A 2CRSA 2H7ZB 1I02A 4AEAA 1IDHA 1UG4A 2NBTA 4FAOC 4DO8A 1IKCA 4LFTA 1DRSA 1M9ZA 1NXBA 2MUPA 3U74U 1CTXA 1LJZA 1BXPA 4P7UA 1CDTA 1HC9B 1CXNA 2MUOA 2N99A 2UWRA 4EY8B 1CB9A 1IJCA 2H7ZA 1RGJA 3ERAA 1QKEA 4OM5A 1CDRA 1CDSA 1XT3A 1VB0A 1REWC 3KFDE 1FFJA 1KU6B 3NH7A 1ERAA 2CCXA 1BTEA 2GOOB 1LX5B 1LXGA 1HAAA 2VLWA 1IDGA 1QM7A 1LXHA 1PLOA 1HC9A 1B41B 1JE9A 4IYEA 1CCQA 1FASA 4RUDA
chains in the Genus database with same CATH topology
3HH7A 1KBSA 2ERAA 3EVSC 5IMYC 2LA1A 1TXBA 3NDSA 1NORA 1KS6A 1FF4A 1TGXA 1H0JA 1KTZB 1KBTA 3NEQA 2CDXA 1CRFA 4UY2C 4BDTB 3BT2U 1CHVS 2UX2A 1MAHF 5IMTD 5DU1A 1ONJA 2H62D 1CREA 2QJBC 3VTSA 2QC1A 2OFSA 3KFDI 4OM4A 3LAQU 3FEVA 5DZ5A 1NTXA 1KBAA 1COEA 1NEAA 1ES7B 1W6BA 1L4WA 1IK8A 1NYSA 1ERGA 1NYUA 1ZADA 1F94A 1FSCA 2HLQA 2PJYC 1HOYA 6EBXA 2H5FA 3U73U 4HQPF 1YWHA 2J8BA 3EBXA 2CTXA 1RL5A 1TFSA 4KSNA 2MJ4A 1KL8A 2MJYA 2QJAC 1FSSB 2HLRA 2CRTA 1IDIA 1KXIA 1G6MA 1V6PA 1JBDA 2JQPA 2MFAA 1LSIA 3PLCA 2H64C 2K3GA 2L5SA 1CVOA 1CXOA 1ABTA 2LCRA 1MR6A 2MHYA 1F8UB 2H62C 1S4YA 2GOOC 2X8BB 2PJYB 1KC4A 1TXAA 1NTNA 2I9BE 1QKDA 2H8UA 1KFHA 2BHIA 4XJJA 4FAOE 5DO6A 2JVEA 2L03A 2BTXA 2MJ0A 4QTIU 2ABXA 2FD6U 1FRAA 1CDQA 1CODA 1HAJA 3QB4B 1IDLA 2QJ9C 3BT1U 1JGKA 4ZQYA 5EBXA 4BIKB 2H64B 1IQ9A 2CRSA 2H7ZB 1I02A 4AEAA 1IDHA 1UG4A 2NBTA 4FAOC 4DO8A 1IKCA 4LFTA 1DRSA 1M9ZA 1NXBA 2MUPA 3U74U 1CTXA 1LJZA 1BXPA 4P7UA 1CDTA 1HC9B 1CXNA 2MUOA 2N99A 2UWRA 4EY8B 1CB9A 1IJCA 2H7ZA 1RGJA 3ERAA 1QKEA 4OM5A 1CDRA 1CDSA 1XT3A 1VB0A 1REWC 3KFDE 1FFJA 1KU6B 3NH7A 1ERAA 2CCXA 1BTEA 2GOOB 1LX5B 1LXGA 1HAAA 2VLWA 1IDGA 1QM7A 1LXHA 1PLOA 1HC9A 1B41B 1JE9A 4IYEA 1CCQA 1FASA 4RUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HH7 A;  1KBS A;  2ERA A;  3EVS C;  5IMY C;  2LA1 A;  1TXB A;  3NDS A;  1NOR A;  1KS6 A;  1FF4 A;  1TGX A;  1H0J A;  1KTZ B;  1KBT A;  3NEQ A;  2CDX A;  1CRF A;  4UY2 C;  4BDT B;  3BT2 U;  1CHV S;  2UX2 A;  1MAH F;  5IMT D;  5DU1 A;  1ONJ A;  2H62 D;  1CRE A;  2QJB C;  3VTS A;  2QC1 A;  2OFS A;  3KFD I;  4OM4 A;  3LAQ U;  3FEV A;  5DZ5 A;  1NTX A;  1KBA A;  1COE A;  1NEA A;  1ES7 B;  1W6B A;  1L4W A;  1IK8 A;  1NYS A;  1ERG A;  1NYU A;  1ZAD A;  1F94 A;  1FSC A;  2HLQ A;  2PJY C;  1HOY A;  6EBX A;  2H5F A;  3U73 U;  4HQP F;  1YWH A;  2J8B A;  3EBX A;  2CTX A;  1RL5 A;  1TFS A;  2MJ4 A;  1KL8 A;  2MJY A;  2QJA C;  1FSS B;  2HLR A;  2CRT A;  1IDI A;  1KXI A;  1G6M A;  1V6P A;  1JBD A;  2JQP A;  2MFA A;  1LSI A;  3PLC A;  2H64 C;  2K3G A;  2L5S A;  1CVO A;  1CXO A;  1ABT A;  2LCR A;  1MR6 A;  2MHY A;  1F8U B;  2H62 C;  1S4Y A;  2GOO C;  2X8B B;  2PJY B;  1KC4 A;  1TXA A;  1NTN A;  2I9B E;  1QKD A;  2H8U A;  1KFH A;  2BHI A;  4XJJ A;  4FAO E;  5DO6 A;  2JVE A;  2L03 A;  2BTX A;  2MJ0 A;  4QTI U;  2ABX A;  2FD6 U;  1FRA A;  1CDQ A;  1COD A;  1HAJ A;  3QB4 B;  1IDL A;  2QJ9 C;  3BT1 U;  1JGK A;  4ZQY A;  5EBX A;  4BIK B;  2H64 B;  1IQ9 A;  2CRS A;  2H7Z B;  1I02 A;  4AEA A;  1IDH A;  1UG4 A;  2NBT A;  4FAO C;  4DO8 A;  1IKC A;  4LFT A;  1DRS A;  1M9Z A;  1NXB A;  2MUP A;  3U74 U;  1CTX A;  1LJZ A;  1BXP A;  4P7U A;  1CDT A;  1HC9 B;  1CXN A;  2MUO A;  2N99 A;  2UWR A;  4EY8 B;  1CB9 A;  1IJC A;  2H7Z A;  1RGJ A;  3ERA A;  1QKE A;  4OM5 A;  1CDR A;  1CDS A;  1XT3 A;  1VB0 A;  1REW C;  3KFD E;  1FFJ A;  1KU6 B;  3NH7 A;  1ERA A;  2CCX A;  1BTE A;  2GOO B;  1LX5 B;  1LXG A;  1HAA A;  2VLW A;  1IDG A;  1QM7 A;  1LXH A;  1PLO A;  1HC9 A;  1B41 B;  1JE9 A;  4IYE A;  1CCQ A;  1FAS A;  4RUD A; 
#chains in the Genus database with same CATH topology
 3HH7 A;  1KBS A;  2ERA A;  3EVS C;  5IMY C;  2LA1 A;  1TXB A;  3NDS A;  1NOR A;  1KS6 A;  1FF4 A;  1TGX A;  1H0J A;  1KTZ B;  1KBT A;  3NEQ A;  2CDX A;  1CRF A;  4UY2 C;  4BDT B;  3BT2 U;  1CHV S;  2UX2 A;  1MAH F;  5IMT D;  5DU1 A;  1ONJ A;  2H62 D;  1CRE A;  2QJB C;  3VTS A;  2QC1 A;  2OFS A;  3KFD I;  4OM4 A;  3LAQ U;  3FEV A;  5DZ5 A;  1NTX A;  1KBA A;  1COE A;  1NEA A;  1ES7 B;  1W6B A;  1L4W A;  1IK8 A;  1NYS A;  1ERG A;  1NYU A;  1ZAD A;  1F94 A;  1FSC A;  2HLQ A;  2PJY C;  1HOY A;  6EBX A;  2H5F A;  3U73 U;  4HQP F;  1YWH A;  2J8B A;  3EBX A;  2CTX A;  1RL5 A;  1TFS A;  4KSN A;  2MJ4 A;  1KL8 A;  2MJY A;  2QJA C;  1FSS B;  2HLR A;  2CRT A;  1IDI A;  1KXI A;  1G6M A;  1V6P A;  1JBD A;  2JQP A;  2MFA A;  1LSI A;  3PLC A;  2H64 C;  2K3G A;  2L5S A;  1CVO A;  1CXO A;  1ABT A;  2LCR A;  1MR6 A;  2MHY A;  1F8U B;  2H62 C;  1S4Y A;  2GOO C;  2X8B B;  2PJY B;  1KC4 A;  1TXA A;  1NTN A;  2I9B E;  1QKD A;  2H8U A;  1KFH A;  2BHI A;  4XJJ A;  4FAO E;  5DO6 A;  2JVE A;  2L03 A;  2BTX A;  2MJ0 A;  4QTI U;  2ABX A;  2FD6 U;  1FRA A;  1CDQ A;  1COD A;  1HAJ A;  3QB4 B;  1IDL A;  2QJ9 C;  3BT1 U;  1JGK A;  4ZQY A;  5EBX A;  4BIK B;  2H64 B;  1IQ9 A;  2CRS A;  2H7Z B;  1I02 A;  4AEA A;  1IDH A;  1UG4 A;  2NBT A;  4FAO C;  4DO8 A;  1IKC A;  4LFT A;  1DRS A;  1M9Z A;  1NXB A;  2MUP A;  3U74 U;  1CTX A;  1LJZ A;  1BXP A;  4P7U A;  1CDT A;  1HC9 B;  1CXN A;  2MUO A;  2N99 A;  2UWR A;  4EY8 B;  1CB9 A;  1IJC A;  2H7Z A;  1RGJ A;  3ERA A;  1QKE A;  4OM5 A;  1CDR A;  1CDS A;  1XT3 A;  1VB0 A;  1REW C;  3KFD E;  1FFJ A;  1KU6 B;  3NH7 A;  1ERA A;  2CCX A;  1BTE A;  2GOO B;  1LX5 B;  1LXG A;  1HAA A;  2VLW A;  1IDG A;  1QM7 A;  1LXH A;  1PLO A;  1HC9 A;  1B41 B;  1JE9 A;  4IYE A;  1CCQ A;  1FAS A;  4RUD A; 
#chains in the Genus database with same CATH homology
 3HH7 A;  1KBS A;  2ERA A;  3EVS C;  5IMY C;  2LA1 A;  1TXB A;  3NDS A;  1NOR A;  1KS6 A;  1FF4 A;  1TGX A;  1H0J A;  1KTZ B;  1KBT A;  3NEQ A;  2CDX A;  1CRF A;  4UY2 C;  4BDT B;  3BT2 U;  1CHV S;  2UX2 A;  1MAH F;  5IMT D;  5DU1 A;  1ONJ A;  2H62 D;  1CRE A;  2QJB C;  3VTS A;  2QC1 A;  2OFS A;  3KFD I;  4OM4 A;  3LAQ U;  3FEV A;  5DZ5 A;  1NTX A;  1KBA A;  1COE A;  1NEA A;  1ES7 B;  1W6B A;  1L4W A;  1IK8 A;  1NYS A;  1ERG A;  1NYU A;  1ZAD A;  1F94 A;  1FSC A;  2HLQ A;  2PJY C;  1HOY A;  6EBX A;  2H5F A;  3U73 U;  4HQP F;  1YWH A;  2J8B A;  3EBX A;  2CTX A;  1RL5 A;  1TFS A;  4KSN A;  2MJ4 A;  1KL8 A;  2MJY A;  2QJA C;  1FSS B;  2HLR A;  2CRT A;  1IDI A;  1KXI A;  1G6M A;  1V6P A;  1JBD A;  2JQP A;  2MFA A;  1LSI A;  3PLC A;  2H64 C;  2K3G A;  2L5S A;  1CVO A;  1CXO A;  1ABT A;  2LCR A;  1MR6 A;  2MHY A;  1F8U B;  2H62 C;  1S4Y A;  2GOO C;  2X8B B;  2PJY B;  1KC4 A;  1TXA A;  1NTN A;  2I9B E;  1QKD A;  2H8U A;  1KFH A;  2BHI A;  4XJJ A;  4FAO E;  5DO6 A;  2JVE A;  2L03 A;  2BTX A;  2MJ0 A;  4QTI U;  2ABX A;  2FD6 U;  1FRA A;  1CDQ A;  1COD A;  1HAJ A;  3QB4 B;  1IDL A;  2QJ9 C;  3BT1 U;  1JGK A;  4ZQY A;  5EBX A;  4BIK B;  2H64 B;  1IQ9 A;  2CRS A;  2H7Z B;  1I02 A;  4AEA A;  1IDH A;  1UG4 A;  2NBT A;  4FAO C;  4DO8 A;  1IKC A;  4LFT A;  1DRS A;  1M9Z A;  1NXB A;  2MUP A;  3U74 U;  1CTX A;  1LJZ A;  1BXP A;  4P7U A;  1CDT A;  1HC9 B;  1CXN A;  2MUO A;  2N99 A;  2UWR A;  4EY8 B;  1CB9 A;  1IJC A;  2H7Z A;  1RGJ A;  3ERA A;  1QKE A;  4OM5 A;  1CDR A;  1CDS A;  1XT3 A;  1VB0 A;  1REW C;  3KFD E;  1FFJ A;  1KU6 B;  3NH7 A;  1ERA A;  2CCX A;  1BTE A;  2GOO B;  1LX5 B;  1LXG A;  1HAA A;  2VLW A;  1IDG A;  1QM7 A;  1LXH A;  1PLO A;  1HC9 A;  1B41 B;  1JE9 A;  4IYE A;  1CCQ A;  1FAS A;  4RUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...