1TXBA

Solution nmr structure of toxin b, a long neurotoxin from the venom of the king cobra, 10 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
73
structure length
73
Chain Sequence
TKCYVTPDATSQTCPDGQDICYTKTWCDGFCSSRGKRIDLGCAATCPKVKPGVDIKCCSTDNCNPFPTWKRKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Neurotoxin
molecule keywords TOXIN B
publication title Solution structure of toxin b, a long neurotoxin from the venom of the king cobra (Ophiophagus hannah).
pubmed doi rcsb
total genus 4
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1996-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1txbA00
1DRSA 3BT2U 1KBTA 1IKCA 2MUPA 1VB0A 1PLOA 1HC9A 4FAOE 1KBSA 2QJAC 3FEVA 1FFJA 6EBXA 3U74U 1NYUA 1KL8A 4LFTA 1JE9A 1CCQA 2H8UA 1LSIA 2LA1A 1CXNA 1BXPA 2MJ0A 3NEQA 1TFSA 1KU6B 1RGJA 2H62C 1HAAA 1JBDA 5EBXA 1G6MA 1NTXA 1QM7A 2QJBC 1IDHA 2K3GA 2H7ZA 3QB4B 1I02A 1CDTA 2OFSA 1NYSA 2H64B 1CDSA 1V6PA 1FSSB 1CREA 1UG4A 2PJYB 1TXBA 2NBTA 1BTEA 2QC1A 4OM5A 2GOOB 4P7UA 2MHYA 1ES7B 1KFHA 1ZADA 2CRTA 1HC9B 1IDGA 1ONJA 5DO6A 2PJYC 2CCXA 3VTSA 1CTXA 1LXGA 4IYEA 4AEAA 1FRAA 1KS6A 1RL5A 2MFAA 1LXHA 3KFDE 2X8BB 1CXOA 5DU1A 2N99A 2CDXA 4HQPF 1YWHA 2FD6U 4DO8A 2QJ9C 3ERAA 4UY2C 1TGXA 1TXAA 1KXIA 1QKEA 1MAHF 3U73U 2LCRA 2L5SA 1KTZB 2MJ4A 1CRFA 4OM4A 2J8BA 2H64C 4RUDA 1IJCA 3EVSC 1F8UB 1LJZA 1LX5B 2CTXA 2MJYA 3PLCA 1F94A 1H0JA 3NDSA 1NXBA 2GOOC 1IQ9A 5DZ5A 1CODA 1ERAA 1KBAA 1REWC 3HH7A 3LAQU 3EBXA 2JQPA 3KFDI 2ERAA 4XJJA 1KC4A 2L03A 1IDIA 2ABXA 1S4YA 2H5FA 2UWRA 1FASA 4ZQYA 1CDRA 1HAJA 1CDQA 2JVEA 2H7ZB 5IMTD 2BHIA 5IMYC 1NTNA 1FF4A 1QKDA 2BTXA 1FSCA 1W6BA 4EY8B 1COEA 2CRSA 4BIKB 1HOYA 3BT1U 4BDTB 1CVOA 2H62D 1ABTA 1B41B 2VLWA 4FAOC 1IDLA 1XT3A 1CB9A 1CHVS 1IK8A 1JGKA 1M9ZA 1L4WA 1MR6A 1NEAA 2HLQA 2I9BE 2MUOA 2UX2A 3NH7A 4QTIU 1ERGA 2HLRA 1NORA
chains in the Genus database with same CATH superfamily
1DRSA 3BT2U 1KBTA 1IKCA 2MUPA 1VB0A 1PLOA 1HC9A 4FAOE 1KBSA 2QJAC 3FEVA 1FFJA 6EBXA 3U74U 1NYUA 1KL8A 4LFTA 1JE9A 1CCQA 2H8UA 1LSIA 2LA1A 1CXNA 1BXPA 2MJ0A 3NEQA 1TFSA 1KU6B 1RGJA 2H62C 1HAAA 1JBDA 5EBXA 1G6MA 1NTXA 1QM7A 2QJBC 1IDHA 2K3GA 2H7ZA 3QB4B 1I02A 1CDTA 2OFSA 1NYSA 2H64B 1CDSA 1V6PA 1FSSB 1CREA 1UG4A 2PJYB 1TXBA 2NBTA 1BTEA 2QC1A 4OM5A 2GOOB 4P7UA 2MHYA 1ES7B 1KFHA 1ZADA 2CRTA 1HC9B 1IDGA 1ONJA 5DO6A 2PJYC 2CCXA 3VTSA 1CTXA 1LXGA 4IYEA 4AEAA 1FRAA 1KS6A 1RL5A 2MFAA 1LXHA 3KFDE 2X8BB 1CXOA 5DU1A 2N99A 2CDXA 4HQPF 1YWHA 2FD6U 4DO8A 2QJ9C 4KSNA 3ERAA 4UY2C 1TGXA 1TXAA 1KXIA 1QKEA 1MAHF 3U73U 2LCRA 2L5SA 1KTZB 2MJ4A 1CRFA 4OM4A 2J8BA 2H64C 4RUDA 1IJCA 3EVSC 1F8UB 1LJZA 1LX5B 2CTXA 2MJYA 3PLCA 1F94A 1H0JA 3NDSA 1NXBA 2GOOC 1IQ9A 5DZ5A 1CODA 1ERAA 1KBAA 1REWC 3HH7A 3LAQU 3EBXA 2JQPA 3KFDI 2ERAA 4XJJA 1KC4A 2L03A 1IDIA 2ABXA 1S4YA 2H5FA 2UWRA 1FASA 4ZQYA 1CDRA 1HAJA 1CDQA 2JVEA 2H7ZB 5IMTD 2BHIA 5IMYC 1NTNA 1FF4A 1QKDA 2BTXA 1FSCA 1W6BA 4EY8B 1COEA 2CRSA 4BIKB 1HOYA 3BT1U 4BDTB 1CVOA 2H62D 1ABTA 1B41B 2VLWA 4FAOC 1IDLA 1XT3A 1CB9A 1CHVS 1IK8A 1JGKA 1M9ZA 1L4WA 1MR6A 1NEAA 2HLQA 2I9BE 2MUOA 2UX2A 3NH7A 4QTIU 1ERGA 2HLRA 1NORA
chains in the Genus database with same CATH topology
1DRSA 3BT2U 1KBTA 1IKCA 2MUPA 1VB0A 1PLOA 1HC9A 4FAOE 1KBSA 2QJAC 3FEVA 1FFJA 6EBXA 3U74U 1NYUA 1KL8A 4LFTA 1JE9A 1CCQA 2H8UA 1LSIA 2LA1A 1CXNA 1BXPA 2MJ0A 3NEQA 1TFSA 1KU6B 1RGJA 2H62C 1HAAA 1JBDA 5EBXA 1G6MA 1NTXA 1QM7A 2QJBC 1IDHA 2K3GA 2H7ZA 3QB4B 1I02A 1CDTA 2OFSA 1NYSA 2H64B 1CDSA 1V6PA 1FSSB 1CREA 1UG4A 2PJYB 1TXBA 2NBTA 1BTEA 2QC1A 4OM5A 2GOOB 4P7UA 2MHYA 1ES7B 1KFHA 1ZADA 2CRTA 1HC9B 1IDGA 1ONJA 5DO6A 2PJYC 2CCXA 3VTSA 1CTXA 1LXGA 4IYEA 4AEAA 1FRAA 1KS6A 1RL5A 2MFAA 1LXHA 3KFDE 2X8BB 1CXOA 5DU1A 2N99A 2CDXA 4HQPF 1YWHA 2FD6U 4DO8A 2QJ9C 4KSNA 3ERAA 4UY2C 1TGXA 1TXAA 1KXIA 1QKEA 1MAHF 3U73U 2LCRA 2L5SA 1KTZB 2MJ4A 1CRFA 4OM4A 2J8BA 2H64C 4RUDA 1IJCA 3EVSC 1F8UB 1LJZA 1LX5B 2CTXA 2MJYA 3PLCA 1F94A 1H0JA 3NDSA 1NXBA 2GOOC 1IQ9A 5DZ5A 1CODA 1ERAA 1KBAA 1REWC 3HH7A 3LAQU 3EBXA 2JQPA 3KFDI 2ERAA 4XJJA 1KC4A 2L03A 1IDIA 2ABXA 1S4YA 2H5FA 2UWRA 1FASA 4ZQYA 1CDRA 1HAJA 1CDQA 2JVEA 2H7ZB 5IMTD 2BHIA 5IMYC 1NTNA 1FF4A 1QKDA 2BTXA 1FSCA 1W6BA 4EY8B 1COEA 2CRSA 4BIKB 1HOYA 3BT1U 4BDTB 1CVOA 2H62D 1ABTA 1B41B 2VLWA 4FAOC 1IDLA 1XT3A 1CB9A 1CHVS 1IK8A 1JGKA 1M9ZA 1L4WA 1MR6A 1NEAA 2HLQA 2I9BE 2MUOA 2UX2A 3NH7A 4QTIU 1ERGA 2HLRA 1NORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DRS A;  3BT2 U;  1KBT A;  1IKC A;  2MUP A;  1VB0 A;  1PLO A;  1HC9 A;  4FAO E;  1KBS A;  2QJA C;  3FEV A;  1FFJ A;  6EBX A;  3U74 U;  1NYU A;  1KL8 A;  4LFT A;  1JE9 A;  1CCQ A;  2H8U A;  1LSI A;  2LA1 A;  1CXN A;  1BXP A;  2MJ0 A;  3NEQ A;  1TFS A;  1KU6 B;  1RGJ A;  2H62 C;  1HAA A;  1JBD A;  5EBX A;  1G6M A;  1NTX A;  1QM7 A;  2QJB C;  1IDH A;  2K3G A;  2H7Z A;  3QB4 B;  1I02 A;  1CDT A;  2OFS A;  1NYS A;  2H64 B;  1CDS A;  1V6P A;  1FSS B;  1CRE A;  1UG4 A;  2PJY B;  1TXB A;  2NBT A;  1BTE A;  2QC1 A;  4OM5 A;  2GOO B;  4P7U A;  2MHY A;  1ES7 B;  1KFH A;  1ZAD A;  2CRT A;  1HC9 B;  1IDG A;  1ONJ A;  5DO6 A;  2PJY C;  2CCX A;  3VTS A;  1CTX A;  1LXG A;  4IYE A;  4AEA A;  1FRA A;  1KS6 A;  1RL5 A;  2MFA A;  1LXH A;  3KFD E;  2X8B B;  1CXO A;  5DU1 A;  2N99 A;  2CDX A;  4HQP F;  1YWH A;  2FD6 U;  4DO8 A;  2QJ9 C;  3ERA A;  4UY2 C;  1TGX A;  1TXA A;  1KXI A;  1QKE A;  1MAH F;  3U73 U;  2LCR A;  2L5S A;  1KTZ B;  2MJ4 A;  1CRF A;  4OM4 A;  2J8B A;  2H64 C;  4RUD A;  1IJC A;  3EVS C;  1F8U B;  1LJZ A;  1LX5 B;  2CTX A;  2MJY A;  3PLC A;  1F94 A;  1H0J A;  3NDS A;  1NXB A;  2GOO C;  1IQ9 A;  5DZ5 A;  1COD A;  1ERA A;  1KBA A;  1REW C;  3HH7 A;  3LAQ U;  3EBX A;  2JQP A;  3KFD I;  2ERA A;  4XJJ A;  1KC4 A;  2L03 A;  1IDI A;  2ABX A;  1S4Y A;  2H5F A;  2UWR A;  1FAS A;  4ZQY A;  1CDR A;  1HAJ A;  1CDQ A;  2JVE A;  2H7Z B;  5IMT D;  2BHI A;  5IMY C;  1NTN A;  1FF4 A;  1QKD A;  2BTX A;  1FSC A;  1W6B A;  4EY8 B;  1COE A;  2CRS A;  4BIK B;  1HOY A;  3BT1 U;  4BDT B;  1CVO A;  2H62 D;  1ABT A;  1B41 B;  2VLW A;  4FAO C;  1IDL A;  1XT3 A;  1CB9 A;  1CHV S;  1IK8 A;  1JGK A;  1M9Z A;  1L4W A;  1MR6 A;  1NEA A;  2HLQ A;  2I9B E;  2MUO A;  2UX2 A;  3NH7 A;  4QTI U;  1ERG A;  2HLR A;  1NOR A; 
#chains in the Genus database with same CATH topology
 1DRS A;  3BT2 U;  1KBT A;  1IKC A;  2MUP A;  1VB0 A;  1PLO A;  1HC9 A;  4FAO E;  1KBS A;  2QJA C;  3FEV A;  1FFJ A;  6EBX A;  3U74 U;  1NYU A;  1KL8 A;  4LFT A;  1JE9 A;  1CCQ A;  2H8U A;  1LSI A;  2LA1 A;  1CXN A;  1BXP A;  2MJ0 A;  3NEQ A;  1TFS A;  1KU6 B;  1RGJ A;  2H62 C;  1HAA A;  1JBD A;  5EBX A;  1G6M A;  1NTX A;  1QM7 A;  2QJB C;  1IDH A;  2K3G A;  2H7Z A;  3QB4 B;  1I02 A;  1CDT A;  2OFS A;  1NYS A;  2H64 B;  1CDS A;  1V6P A;  1FSS B;  1CRE A;  1UG4 A;  2PJY B;  1TXB A;  2NBT A;  1BTE A;  2QC1 A;  4OM5 A;  2GOO B;  4P7U A;  2MHY A;  1ES7 B;  1KFH A;  1ZAD A;  2CRT A;  1HC9 B;  1IDG A;  1ONJ A;  5DO6 A;  2PJY C;  2CCX A;  3VTS A;  1CTX A;  1LXG A;  4IYE A;  4AEA A;  1FRA A;  1KS6 A;  1RL5 A;  2MFA A;  1LXH A;  3KFD E;  2X8B B;  1CXO A;  5DU1 A;  2N99 A;  2CDX A;  4HQP F;  1YWH A;  2FD6 U;  4DO8 A;  2QJ9 C;  4KSN A;  3ERA A;  4UY2 C;  1TGX A;  1TXA A;  1KXI A;  1QKE A;  1MAH F;  3U73 U;  2LCR A;  2L5S A;  1KTZ B;  2MJ4 A;  1CRF A;  4OM4 A;  2J8B A;  2H64 C;  4RUD A;  1IJC A;  3EVS C;  1F8U B;  1LJZ A;  1LX5 B;  2CTX A;  2MJY A;  3PLC A;  1F94 A;  1H0J A;  3NDS A;  1NXB A;  2GOO C;  1IQ9 A;  5DZ5 A;  1COD A;  1ERA A;  1KBA A;  1REW C;  3HH7 A;  3LAQ U;  3EBX A;  2JQP A;  3KFD I;  2ERA A;  4XJJ A;  1KC4 A;  2L03 A;  1IDI A;  2ABX A;  1S4Y A;  2H5F A;  2UWR A;  1FAS A;  4ZQY A;  1CDR A;  1HAJ A;  1CDQ A;  2JVE A;  2H7Z B;  5IMT D;  2BHI A;  5IMY C;  1NTN A;  1FF4 A;  1QKD A;  2BTX A;  1FSC A;  1W6B A;  4EY8 B;  1COE A;  2CRS A;  4BIK B;  1HOY A;  3BT1 U;  4BDT B;  1CVO A;  2H62 D;  1ABT A;  1B41 B;  2VLW A;  4FAO C;  1IDL A;  1XT3 A;  1CB9 A;  1CHV S;  1IK8 A;  1JGK A;  1M9Z A;  1L4W A;  1MR6 A;  1NEA A;  2HLQ A;  2I9B E;  2MUO A;  2UX2 A;  3NH7 A;  4QTI U;  1ERG A;  2HLR A;  1NOR A; 
#chains in the Genus database with same CATH homology
 1DRS A;  3BT2 U;  1KBT A;  1IKC A;  2MUP A;  1VB0 A;  1PLO A;  1HC9 A;  4FAO E;  1KBS A;  2QJA C;  3FEV A;  1FFJ A;  6EBX A;  3U74 U;  1NYU A;  1KL8 A;  4LFT A;  1JE9 A;  1CCQ A;  2H8U A;  1LSI A;  2LA1 A;  1CXN A;  1BXP A;  2MJ0 A;  3NEQ A;  1TFS A;  1KU6 B;  1RGJ A;  2H62 C;  1HAA A;  1JBD A;  5EBX A;  1G6M A;  1NTX A;  1QM7 A;  2QJB C;  1IDH A;  2K3G A;  2H7Z A;  3QB4 B;  1I02 A;  1CDT A;  2OFS A;  1NYS A;  2H64 B;  1CDS A;  1V6P A;  1FSS B;  1CRE A;  1UG4 A;  2PJY B;  1TXB A;  2NBT A;  1BTE A;  2QC1 A;  4OM5 A;  2GOO B;  4P7U A;  2MHY A;  1ES7 B;  1KFH A;  1ZAD A;  2CRT A;  1HC9 B;  1IDG A;  1ONJ A;  5DO6 A;  2PJY C;  2CCX A;  3VTS A;  1CTX A;  1LXG A;  4IYE A;  4AEA A;  1FRA A;  1KS6 A;  1RL5 A;  2MFA A;  1LXH A;  3KFD E;  2X8B B;  1CXO A;  5DU1 A;  2N99 A;  2CDX A;  4HQP F;  1YWH A;  2FD6 U;  4DO8 A;  2QJ9 C;  4KSN A;  3ERA A;  4UY2 C;  1TGX A;  1TXA A;  1KXI A;  1QKE A;  1MAH F;  3U73 U;  2LCR A;  2L5S A;  1KTZ B;  2MJ4 A;  1CRF A;  4OM4 A;  2J8B A;  2H64 C;  4RUD A;  1IJC A;  3EVS C;  1F8U B;  1LJZ A;  1LX5 B;  2CTX A;  2MJY A;  3PLC A;  1F94 A;  1H0J A;  3NDS A;  1NXB A;  2GOO C;  1IQ9 A;  5DZ5 A;  1COD A;  1ERA A;  1KBA A;  1REW C;  3HH7 A;  3LAQ U;  3EBX A;  2JQP A;  3KFD I;  2ERA A;  4XJJ A;  1KC4 A;  2L03 A;  1IDI A;  2ABX A;  1S4Y A;  2H5F A;  2UWR A;  1FAS A;  4ZQY A;  1CDR A;  1HAJ A;  1CDQ A;  2JVE A;  2H7Z B;  5IMT D;  2BHI A;  5IMY C;  1NTN A;  1FF4 A;  1QKD A;  2BTX A;  1FSC A;  1W6B A;  4EY8 B;  1COE A;  2CRS A;  4BIK B;  1HOY A;  3BT1 U;  4BDT B;  1CVO A;  2H62 D;  1ABT A;  1B41 B;  2VLW A;  4FAO C;  1IDL A;  1XT3 A;  1CB9 A;  1CHV S;  1IK8 A;  1JGK A;  1M9Z A;  1L4W A;  1MR6 A;  1NEA A;  2HLQ A;  2I9B E;  2MUO A;  2UX2 A;  3NH7 A;  4QTI U;  1ERG A;  2HLR A;  1NOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...