3KFDE

Ternary complex of tgf-b1 reveals isoform-specific ligand recognition and receptor recruitment in the superfamily
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
108
structure length
108
Chain Sequence
AVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming growth factor beta-1
publication title Ternary complex of transforming growth factor-beta1 reveals isoform-specific ligand recognition and receptor recruitment in the superfamily.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 18
structure length 108
sequence length 108
chains with identical sequence F, G, H
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3kfdE00
1M9ZA 2H62C 4XJJA 1F8UB 4HQPF 1CVOA 4UY2C 1NYSA 3NEQA 2CTXA 4QTIU 1NYUA 2H62D 1JE9A 1IDIA 2CRTA 2MJYA 5EBXA 3EBXA 3QB4B 1BTEA 1ONJA 2QJBC 5IMYC 1CDSA 3BT1U 1IDLA 1V6PA 1HOYA 1HC9A 2JVEA 3KFDI 1FSCA 1CREA 2FD6U 1L4WA 2LA1A 2GOOB 1LXHA 3VTSA 1KS6A 1CDQA 1JGKA 2HLQA 4DO8A 1BXPA 4AEAA 1KXIA 6EBXA 1NXBA 1KL8A 1MAHF 1REWC 1CXNA 4FAOE 2H64B 1W6BA 3FEVA 5DZ5A 1UG4A 1TXAA 2H7ZA 4ZQYA 3KFDE 1RL5A 2VLWA 1HAJA 4RUDA 3NH7A 1CCQA 3EVSC 2BHIA 1NTXA 2MUPA 5IMTD 2MUOA 2J8BA 1FF4A 1NTNA 1KFHA 2L03A 1CRFA 1ERAA 1H0JA 1CODA 2UWRA 4IYEA 1KBSA 1LXGA 1FRAA 1ES7B 1TFSA 1ABTA 1NORA 1IDHA 1IQ9A 1MR6A 1KBTA 2QJ9C 1B41B 1DRSA 1XT3A 1QM7A 4FAOC 2QJAC 2N99A 1LSIA 1HC9B 1FSSB 4LFTA 1TGXA 2ERAA 2K3GA 1LJZA 2NBTA 1QKEA 1TXBA 1COEA 2LCRA 2X8BB 1IJCA 2MFAA 2QC1A 1FASA 2GOOC 3LAQU 1YWHA 2JQPA 1CDRA 1PLOA 2ABXA 1ERGA 1JBDA 1CTXA 2H64C 1S4YA 4OM4A 1VB0A 2PJYB 1HAAA 2MHYA 1KTZB 1I02A 1LX5B 1IK8A 1CDTA 2H5FA 1F94A 1RGJA 2OFSA 1ZADA 1CHVS 3NDSA 5DU1A 3ERAA 2BTXA 1IKCA 3U73U 3U74U 4BIKB 4EY8B 1KU6B 1NEAA 1KC4A 1QKDA 2UX2A 2L5SA 1CXOA 2CCXA 2HLRA 1KBAA 2I9BE 3HH7A 2MJ0A 4BDTB 2PJYC 1G6MA 5DO6A 3BT2U 2H7ZB 2CDXA 4P7UA 1CB9A 1FFJA 1IDGA 4OM5A 3PLCA 2CRSA 2H8UA 2MJ4A
chains in the Genus database with same CATH superfamily
4KSNA 1M9ZA 2H62C 4XJJA 1F8UB 4HQPF 1CVOA 4UY2C 1NYSA 3NEQA 2CTXA 4QTIU 1NYUA 2H62D 1JE9A 1IDIA 2CRTA 2MJYA 5EBXA 3EBXA 3QB4B 1BTEA 1ONJA 2QJBC 5IMYC 1CDSA 3BT1U 1IDLA 1V6PA 1HOYA 1HC9A 2JVEA 3KFDI 1FSCA 1CREA 2FD6U 1L4WA 2LA1A 2GOOB 1LXHA 3VTSA 1KS6A 1CDQA 1JGKA 2HLQA 4DO8A 1BXPA 4AEAA 1KXIA 6EBXA 1NXBA 1KL8A 1MAHF 1REWC 1CXNA 4FAOE 2H64B 1W6BA 3FEVA 5DZ5A 1UG4A 1TXAA 2H7ZA 4ZQYA 3KFDE 1RL5A 2VLWA 1HAJA 4RUDA 3NH7A 1CCQA 3EVSC 2BHIA 1NTXA 2MUPA 5IMTD 2MUOA 2J8BA 1FF4A 1NTNA 1KFHA 2L03A 1CRFA 1ERAA 1H0JA 1CODA 2UWRA 4IYEA 1KBSA 1LXGA 1FRAA 1ES7B 1TFSA 1ABTA 1NORA 1IDHA 1IQ9A 1MR6A 1KBTA 2QJ9C 1B41B 1DRSA 1XT3A 1QM7A 4FAOC 2QJAC 2N99A 1LSIA 1HC9B 1FSSB 4LFTA 1TGXA 2ERAA 2K3GA 1LJZA 2NBTA 1QKEA 1TXBA 1COEA 2LCRA 2X8BB 1IJCA 2MFAA 2QC1A 1FASA 2GOOC 3LAQU 1YWHA 2JQPA 1CDRA 1PLOA 2ABXA 1ERGA 1JBDA 1CTXA 2H64C 1S4YA 4OM4A 1VB0A 2PJYB 1HAAA 2MHYA 1KTZB 1I02A 1LX5B 1IK8A 1CDTA 2H5FA 1F94A 1RGJA 2OFSA 1ZADA 1CHVS 3NDSA 5DU1A 3ERAA 2BTXA 1IKCA 3U73U 3U74U 4BIKB 4EY8B 1KU6B 1NEAA 1KC4A 1QKDA 2UX2A 2L5SA 1CXOA 2CCXA 2HLRA 1KBAA 2I9BE 3HH7A 2MJ0A 4BDTB 2PJYC 1G6MA 5DO6A 3BT2U 2H7ZB 2CDXA 4P7UA 1CB9A 1FFJA 1IDGA 4OM5A 3PLCA 2CRSA 2H8UA 2MJ4A
chains in the Genus database with same CATH topology
4KSNA 1M9ZA 2H62C 4XJJA 1F8UB 4HQPF 1CVOA 4UY2C 1NYSA 3NEQA 2CTXA 4QTIU 1NYUA 2H62D 1JE9A 1IDIA 2CRTA 2MJYA 5EBXA 3EBXA 3QB4B 1BTEA 1ONJA 2QJBC 5IMYC 1CDSA 3BT1U 1IDLA 1V6PA 1HOYA 1HC9A 2JVEA 3KFDI 1FSCA 1CREA 2FD6U 1L4WA 2LA1A 2GOOB 1LXHA 3VTSA 1KS6A 1CDQA 1JGKA 2HLQA 4DO8A 1BXPA 4AEAA 1KXIA 6EBXA 1NXBA 1KL8A 1MAHF 1REWC 1CXNA 4FAOE 2H64B 1W6BA 3FEVA 5DZ5A 1UG4A 1TXAA 2H7ZA 4ZQYA 3KFDE 1RL5A 2VLWA 1HAJA 4RUDA 3NH7A 1CCQA 3EVSC 2BHIA 1NTXA 2MUPA 5IMTD 2MUOA 2J8BA 1FF4A 1NTNA 1KFHA 2L03A 1CRFA 1ERAA 1H0JA 1CODA 2UWRA 4IYEA 1KBSA 1LXGA 1FRAA 1ES7B 1TFSA 1ABTA 1NORA 1IDHA 1IQ9A 1MR6A 1KBTA 2QJ9C 1B41B 1DRSA 1XT3A 1QM7A 4FAOC 2QJAC 2N99A 1LSIA 1HC9B 1FSSB 4LFTA 1TGXA 2ERAA 2K3GA 1LJZA 2NBTA 1QKEA 1TXBA 1COEA 2LCRA 2X8BB 1IJCA 2MFAA 2QC1A 1FASA 2GOOC 3LAQU 1YWHA 2JQPA 1CDRA 1PLOA 2ABXA 1ERGA 1JBDA 1CTXA 2H64C 1S4YA 4OM4A 1VB0A 2PJYB 1HAAA 2MHYA 1KTZB 1I02A 1LX5B 1IK8A 1CDTA 2H5FA 1F94A 1RGJA 2OFSA 1ZADA 1CHVS 3NDSA 5DU1A 3ERAA 2BTXA 1IKCA 3U73U 3U74U 4BIKB 4EY8B 1KU6B 1NEAA 1KC4A 1QKDA 2UX2A 2L5SA 1CXOA 2CCXA 2HLRA 1KBAA 2I9BE 3HH7A 2MJ0A 4BDTB 2PJYC 1G6MA 5DO6A 3BT2U 2H7ZB 2CDXA 4P7UA 1CB9A 1FFJA 1IDGA 4OM5A 3PLCA 2CRSA 2H8UA 2MJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9Z A;  2H62 C;  4XJJ A;  1F8U B;  4HQP F;  1CVO A;  4UY2 C;  1NYS A;  3NEQ A;  2CTX A;  4QTI U;  1NYU A;  2H62 D;  1JE9 A;  1IDI A;  2CRT A;  2MJY A;  5EBX A;  3EBX A;  3QB4 B;  1BTE A;  1ONJ A;  2QJB C;  5IMY C;  1CDS A;  3BT1 U;  1IDL A;  1V6P A;  1HOY A;  1HC9 A;  2JVE A;  3KFD I;  1FSC A;  1CRE A;  2FD6 U;  1L4W A;  2LA1 A;  2GOO B;  1LXH A;  3VTS A;  1KS6 A;  1CDQ A;  1JGK A;  2HLQ A;  4DO8 A;  1BXP A;  4AEA A;  1KXI A;  6EBX A;  1NXB A;  1KL8 A;  1MAH F;  1REW C;  1CXN A;  4FAO E;  2H64 B;  1W6B A;  3FEV A;  5DZ5 A;  1UG4 A;  1TXA A;  2H7Z A;  4ZQY A;  3KFD E;  1RL5 A;  2VLW A;  1HAJ A;  4RUD A;  3NH7 A;  1CCQ A;  3EVS C;  2BHI A;  1NTX A;  2MUP A;  5IMT D;  2MUO A;  2J8B A;  1FF4 A;  1NTN A;  1KFH A;  2L03 A;  1CRF A;  1ERA A;  1H0J A;  1COD A;  2UWR A;  4IYE A;  1KBS A;  1LXG A;  1FRA A;  1ES7 B;  1TFS A;  1ABT A;  1NOR A;  1IDH A;  1IQ9 A;  1MR6 A;  1KBT A;  2QJ9 C;  1B41 B;  1DRS A;  1XT3 A;  1QM7 A;  4FAO C;  2QJA C;  2N99 A;  1LSI A;  1HC9 B;  1FSS B;  4LFT A;  1TGX A;  2ERA A;  2K3G A;  1LJZ A;  2NBT A;  1QKE A;  1TXB A;  1COE A;  2LCR A;  2X8B B;  1IJC A;  2MFA A;  2QC1 A;  1FAS A;  2GOO C;  3LAQ U;  1YWH A;  2JQP A;  1CDR A;  1PLO A;  2ABX A;  1ERG A;  1JBD A;  1CTX A;  2H64 C;  1S4Y A;  4OM4 A;  1VB0 A;  2PJY B;  1HAA A;  2MHY A;  1KTZ B;  1I02 A;  1LX5 B;  1IK8 A;  1CDT A;  2H5F A;  1F94 A;  1RGJ A;  2OFS A;  1ZAD A;  1CHV S;  3NDS A;  5DU1 A;  3ERA A;  2BTX A;  1IKC A;  3U73 U;  3U74 U;  4BIK B;  4EY8 B;  1KU6 B;  1NEA A;  1KC4 A;  1QKD A;  2UX2 A;  2L5S A;  1CXO A;  2CCX A;  2HLR A;  1KBA A;  2I9B E;  3HH7 A;  2MJ0 A;  4BDT B;  2PJY C;  1G6M A;  5DO6 A;  3BT2 U;  2H7Z B;  2CDX A;  4P7U A;  1CB9 A;  1FFJ A;  1IDG A;  4OM5 A;  3PLC A;  2CRS A;  2H8U A;  2MJ4 A; 
#chains in the Genus database with same CATH topology
 4KSN A;  1M9Z A;  2H62 C;  4XJJ A;  1F8U B;  4HQP F;  1CVO A;  4UY2 C;  1NYS A;  3NEQ A;  2CTX A;  4QTI U;  1NYU A;  2H62 D;  1JE9 A;  1IDI A;  2CRT A;  2MJY A;  5EBX A;  3EBX A;  3QB4 B;  1BTE A;  1ONJ A;  2QJB C;  5IMY C;  1CDS A;  3BT1 U;  1IDL A;  1V6P A;  1HOY A;  1HC9 A;  2JVE A;  3KFD I;  1FSC A;  1CRE A;  2FD6 U;  1L4W A;  2LA1 A;  2GOO B;  1LXH A;  3VTS A;  1KS6 A;  1CDQ A;  1JGK A;  2HLQ A;  4DO8 A;  1BXP A;  4AEA A;  1KXI A;  6EBX A;  1NXB A;  1KL8 A;  1MAH F;  1REW C;  1CXN A;  4FAO E;  2H64 B;  1W6B A;  3FEV A;  5DZ5 A;  1UG4 A;  1TXA A;  2H7Z A;  4ZQY A;  3KFD E;  1RL5 A;  2VLW A;  1HAJ A;  4RUD A;  3NH7 A;  1CCQ A;  3EVS C;  2BHI A;  1NTX A;  2MUP A;  5IMT D;  2MUO A;  2J8B A;  1FF4 A;  1NTN A;  1KFH A;  2L03 A;  1CRF A;  1ERA A;  1H0J A;  1COD A;  2UWR A;  4IYE A;  1KBS A;  1LXG A;  1FRA A;  1ES7 B;  1TFS A;  1ABT A;  1NOR A;  1IDH A;  1IQ9 A;  1MR6 A;  1KBT A;  2QJ9 C;  1B41 B;  1DRS A;  1XT3 A;  1QM7 A;  4FAO C;  2QJA C;  2N99 A;  1LSI A;  1HC9 B;  1FSS B;  4LFT A;  1TGX A;  2ERA A;  2K3G A;  1LJZ A;  2NBT A;  1QKE A;  1TXB A;  1COE A;  2LCR A;  2X8B B;  1IJC A;  2MFA A;  2QC1 A;  1FAS A;  2GOO C;  3LAQ U;  1YWH A;  2JQP A;  1CDR A;  1PLO A;  2ABX A;  1ERG A;  1JBD A;  1CTX A;  2H64 C;  1S4Y A;  4OM4 A;  1VB0 A;  2PJY B;  1HAA A;  2MHY A;  1KTZ B;  1I02 A;  1LX5 B;  1IK8 A;  1CDT A;  2H5F A;  1F94 A;  1RGJ A;  2OFS A;  1ZAD A;  1CHV S;  3NDS A;  5DU1 A;  3ERA A;  2BTX A;  1IKC A;  3U73 U;  3U74 U;  4BIK B;  4EY8 B;  1KU6 B;  1NEA A;  1KC4 A;  1QKD A;  2UX2 A;  2L5S A;  1CXO A;  2CCX A;  2HLR A;  1KBA A;  2I9B E;  3HH7 A;  2MJ0 A;  4BDT B;  2PJY C;  1G6M A;  5DO6 A;  3BT2 U;  2H7Z B;  2CDX A;  4P7U A;  1CB9 A;  1FFJ A;  1IDG A;  4OM5 A;  3PLC A;  2CRS A;  2H8U A;  2MJ4 A; 
#chains in the Genus database with same CATH homology
 4KSN A;  1M9Z A;  2H62 C;  4XJJ A;  1F8U B;  4HQP F;  1CVO A;  4UY2 C;  1NYS A;  3NEQ A;  2CTX A;  4QTI U;  1NYU A;  2H62 D;  1JE9 A;  1IDI A;  2CRT A;  2MJY A;  5EBX A;  3EBX A;  3QB4 B;  1BTE A;  1ONJ A;  2QJB C;  5IMY C;  1CDS A;  3BT1 U;  1IDL A;  1V6P A;  1HOY A;  1HC9 A;  2JVE A;  3KFD I;  1FSC A;  1CRE A;  2FD6 U;  1L4W A;  2LA1 A;  2GOO B;  1LXH A;  3VTS A;  1KS6 A;  1CDQ A;  1JGK A;  2HLQ A;  4DO8 A;  1BXP A;  4AEA A;  1KXI A;  6EBX A;  1NXB A;  1KL8 A;  1MAH F;  1REW C;  1CXN A;  4FAO E;  2H64 B;  1W6B A;  3FEV A;  5DZ5 A;  1UG4 A;  1TXA A;  2H7Z A;  4ZQY A;  3KFD E;  1RL5 A;  2VLW A;  1HAJ A;  4RUD A;  3NH7 A;  1CCQ A;  3EVS C;  2BHI A;  1NTX A;  2MUP A;  5IMT D;  2MUO A;  2J8B A;  1FF4 A;  1NTN A;  1KFH A;  2L03 A;  1CRF A;  1ERA A;  1H0J A;  1COD A;  2UWR A;  4IYE A;  1KBS A;  1LXG A;  1FRA A;  1ES7 B;  1TFS A;  1ABT A;  1NOR A;  1IDH A;  1IQ9 A;  1MR6 A;  1KBT A;  2QJ9 C;  1B41 B;  1DRS A;  1XT3 A;  1QM7 A;  4FAO C;  2QJA C;  2N99 A;  1LSI A;  1HC9 B;  1FSS B;  4LFT A;  1TGX A;  2ERA A;  2K3G A;  1LJZ A;  2NBT A;  1QKE A;  1TXB A;  1COE A;  2LCR A;  2X8B B;  1IJC A;  2MFA A;  2QC1 A;  1FAS A;  2GOO C;  3LAQ U;  1YWH A;  2JQP A;  1CDR A;  1PLO A;  2ABX A;  1ERG A;  1JBD A;  1CTX A;  2H64 C;  1S4Y A;  4OM4 A;  1VB0 A;  2PJY B;  1HAA A;  2MHY A;  1KTZ B;  1I02 A;  1LX5 B;  1IK8 A;  1CDT A;  2H5F A;  1F94 A;  1RGJ A;  2OFS A;  1ZAD A;  1CHV S;  3NDS A;  5DU1 A;  3ERA A;  2BTX A;  1IKC A;  3U73 U;  3U74 U;  4BIK B;  4EY8 B;  1KU6 B;  1NEA A;  1KC4 A;  1QKD A;  2UX2 A;  2L5S A;  1CXO A;  2CCX A;  2HLR A;  1KBA A;  2I9B E;  3HH7 A;  2MJ0 A;  4BDT B;  2PJY C;  1G6M A;  5DO6 A;  3BT2 U;  2H7Z B;  2CDX A;  4P7U A;  1CB9 A;  1FFJ A;  1IDG A;  4OM5 A;  3PLC A;  2CRS A;  2H8U A;  2MJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...