3KFDE

Ternary complex of tgf-b1 reveals isoform-specific ligand recognition and receptor recruitment in the superfamily
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
108
structure length
108
Chain Sequence
AVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/cytokine receptor
molecule keywords Transforming growth factor beta-1
publication title Ternary complex of transforming growth factor-beta1 reveals isoform-specific ligand recognition and receptor recruitment in the superfamily.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 108
sequence length 108
chains with identical sequence F, G, H
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3kfdE00
3PLCA 2GOOC 1CTXA 2H64B 3NH7A 1VB0A 1KFHA 1CODA 2PJYC 1KBAA 3EVSC 1CREA 2UX2A 1CXOA 2L03A 2CCXA 1I02A 3QB4B 1LXHA 2VLWA 4ZQYA 1JGKA 4HQPF 1QM7A 1TXBA 1COEA 1CXNA 1JBDA 1MAHF 2LA1A 1QKDA 1RGJA 2MJ0A 1G6MA 5IMTD 1TXAA 4P7UA 2QJBC 4LFTA 2L5SA 2CDXA 1CHVS 1IQ9A 2CTXA 4FAOE 1V6PA 2CRSA 2H62C 2UWRA 5DO6A 1IDHA 4OM5A 2GOOB 2MJ4A 2MUOA 3KFDI 2MUPA 3KFDE 1CRFA 2PJYB 1HOYA 1CDTA 1NYSA 1F8UB 3EBXA 4AEAA 2JQPA 5DU1A 2ERAA 2X8BB 2LCRA 4FAOC 1RL5A 1LSIA 2HLRA 3U74U 4IYEA 1YWHA 1QKEA 1ERGA 1IDIA 1FASA 3HH7A 2H7ZA 1IJCA 2JVEA 1NTXA 2QJ9C 1IKCA 2NBTA 1CB9A 1FSCA 1KU6B 3LAQU 1HC9A 1W6BA 2MFAA 1MR6A 1F94A 1H0JA 3U73U 4BIKB 2BTXA 2N99A 1NYUA 1M9ZA 5EBXA 1HAJA 2H8UA 3VTSA 2QC1A 1ABTA 3BT2U 1PLOA 1KL8A 1IDGA 1ZADA 2H5FA 4OM4A 1CCQA 1IK8A 1ONJA 1FFJA 1LJZA 1XT3A 2QJAC 2MJYA 1S4YA 1ES7B 1FSSB 1DRSA 1BXPA 2H7ZB 5IMYC 3NDSA 3BT1U 2FD6U 1CVOA 1FRAA 1BTEA 1HC9B 1KXIA 1REWC 3NEQA 1TFSA 2ABXA 1IDLA 2J8BA 1NTNA 1KBSA 2H64C 1FF4A 1B41B 1ERAA 4UY2C 3FEVA 4XJJA 4BDTB 1JE9A 1KC4A 1NORA 2K3GA 4DO8A 2H62D 1KS6A 4EY8B 1CDSA 4QTIU 1L4WA 1NXBA 2I9BE 6EBXA 1HAAA 1TGXA 1CDQA 1KBTA 2HLQA 1LX5B 5DZ5A 2OFSA 1CDRA 1NEAA 1UG4A 2MHYA 1KTZB 2BHIA 3ERAA 2CRTA 1LXGA 4RUDA
chains in the Genus database with same CATH superfamily
3PLCA 2GOOC 1CTXA 2H64B 3NH7A 1VB0A 1KFHA 1CODA 2PJYC 1KBAA 3EVSC 1CREA 2UX2A 1CXOA 2L03A 2CCXA 1I02A 3QB4B 1LXHA 2VLWA 4ZQYA 1JGKA 4HQPF 1QM7A 1TXBA 1COEA 1CXNA 1JBDA 1MAHF 2LA1A 1QKDA 1RGJA 2MJ0A 1G6MA 5IMTD 1TXAA 4P7UA 2QJBC 4LFTA 2L5SA 2CDXA 1CHVS 1IQ9A 2CTXA 4FAOE 1V6PA 2CRSA 2H62C 2UWRA 5DO6A 1IDHA 4OM5A 2GOOB 2MJ4A 2MUOA 3KFDI 2MUPA 3KFDE 1CRFA 2PJYB 1HOYA 1CDTA 1NYSA 1F8UB 3EBXA 4AEAA 2JQPA 5DU1A 2ERAA 2X8BB 2LCRA 4FAOC 1RL5A 1LSIA 2HLRA 3U74U 4IYEA 1YWHA 1QKEA 1ERGA 1IDIA 1FASA 3HH7A 2H7ZA 1IJCA 2JVEA 1NTXA 2QJ9C 1IKCA 2NBTA 1CB9A 1FSCA 1KU6B 3LAQU 1HC9A 1W6BA 2MFAA 1MR6A 1F94A 1H0JA 3U73U 4BIKB 2BTXA 2N99A 1NYUA 1M9ZA 5EBXA 1HAJA 2H8UA 3VTSA 2QC1A 1ABTA 3BT2U 1PLOA 1KL8A 1IDGA 1ZADA 2H5FA 4OM4A 1CCQA 1IK8A 1ONJA 1FFJA 1LJZA 1XT3A 2QJAC 4KSNA 2MJYA 1S4YA 1ES7B 1FSSB 1DRSA 1BXPA 2H7ZB 5IMYC 3NDSA 3BT1U 2FD6U 1CVOA 1FRAA 1BTEA 1HC9B 1KXIA 1REWC 3NEQA 1TFSA 2ABXA 1IDLA 2J8BA 1NTNA 1KBSA 2H64C 1FF4A 1B41B 1ERAA 4UY2C 3FEVA 4XJJA 4BDTB 1JE9A 1KC4A 1NORA 2K3GA 4DO8A 2H62D 1KS6A 4EY8B 1CDSA 4QTIU 1L4WA 1NXBA 2I9BE 6EBXA 1HAAA 1TGXA 1CDQA 1KBTA 2HLQA 1LX5B 5DZ5A 2OFSA 1CDRA 1NEAA 1UG4A 2MHYA 1KTZB 2BHIA 3ERAA 2CRTA 1LXGA 4RUDA
chains in the Genus database with same CATH topology
3PLCA 2GOOC 1CTXA 2H64B 3NH7A 1VB0A 1KFHA 1CODA 2PJYC 1KBAA 3EVSC 1CREA 2UX2A 1CXOA 2L03A 2CCXA 1I02A 3QB4B 1LXHA 2VLWA 4ZQYA 1JGKA 4HQPF 1QM7A 1TXBA 1COEA 1CXNA 1JBDA 1MAHF 2LA1A 1QKDA 1RGJA 2MJ0A 1G6MA 5IMTD 1TXAA 4P7UA 2QJBC 4LFTA 2L5SA 2CDXA 1CHVS 1IQ9A 2CTXA 4FAOE 1V6PA 2CRSA 2H62C 2UWRA 5DO6A 1IDHA 4OM5A 2GOOB 2MJ4A 2MUOA 3KFDI 2MUPA 3KFDE 1CRFA 2PJYB 1HOYA 1CDTA 1NYSA 1F8UB 3EBXA 4AEAA 2JQPA 5DU1A 2ERAA 2X8BB 2LCRA 4FAOC 1RL5A 1LSIA 2HLRA 3U74U 4IYEA 1YWHA 1QKEA 1ERGA 1IDIA 1FASA 3HH7A 2H7ZA 1IJCA 2JVEA 1NTXA 2QJ9C 1IKCA 2NBTA 1CB9A 1FSCA 1KU6B 3LAQU 1HC9A 1W6BA 2MFAA 1MR6A 1F94A 1H0JA 3U73U 4BIKB 2BTXA 2N99A 1NYUA 1M9ZA 5EBXA 1HAJA 2H8UA 3VTSA 2QC1A 1ABTA 3BT2U 1PLOA 1KL8A 1IDGA 1ZADA 2H5FA 4OM4A 1CCQA 1IK8A 1ONJA 1FFJA 1LJZA 1XT3A 2QJAC 4KSNA 2MJYA 1S4YA 1ES7B 1FSSB 1DRSA 1BXPA 2H7ZB 5IMYC 3NDSA 3BT1U 2FD6U 1CVOA 1FRAA 1BTEA 1HC9B 1KXIA 1REWC 3NEQA 1TFSA 2ABXA 1IDLA 2J8BA 1NTNA 1KBSA 2H64C 1FF4A 1B41B 1ERAA 4UY2C 3FEVA 4XJJA 4BDTB 1JE9A 1KC4A 1NORA 2K3GA 4DO8A 2H62D 1KS6A 4EY8B 1CDSA 4QTIU 1L4WA 1NXBA 2I9BE 6EBXA 1HAAA 1TGXA 1CDQA 1KBTA 2HLQA 1LX5B 5DZ5A 2OFSA 1CDRA 1NEAA 1UG4A 2MHYA 1KTZB 2BHIA 3ERAA 2CRTA 1LXGA 4RUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLC A;  2GOO C;  1CTX A;  2H64 B;  3NH7 A;  1VB0 A;  1KFH A;  1COD A;  2PJY C;  1KBA A;  3EVS C;  1CRE A;  2UX2 A;  1CXO A;  2L03 A;  2CCX A;  1I02 A;  3QB4 B;  1LXH A;  2VLW A;  4ZQY A;  1JGK A;  4HQP F;  1QM7 A;  1TXB A;  1COE A;  1CXN A;  1JBD A;  1MAH F;  2LA1 A;  1QKD A;  1RGJ A;  2MJ0 A;  1G6M A;  5IMT D;  1TXA A;  4P7U A;  2QJB C;  4LFT A;  2L5S A;  2CDX A;  1CHV S;  1IQ9 A;  2CTX A;  4FAO E;  1V6P A;  2CRS A;  2H62 C;  2UWR A;  5DO6 A;  1IDH A;  4OM5 A;  2GOO B;  2MJ4 A;  2MUO A;  3KFD I;  2MUP A;  3KFD E;  1CRF A;  2PJY B;  1HOY A;  1CDT A;  1NYS A;  1F8U B;  3EBX A;  4AEA A;  2JQP A;  5DU1 A;  2ERA A;  2X8B B;  2LCR A;  4FAO C;  1RL5 A;  1LSI A;  2HLR A;  3U74 U;  4IYE A;  1YWH A;  1QKE A;  1ERG A;  1IDI A;  1FAS A;  3HH7 A;  2H7Z A;  1IJC A;  2JVE A;  1NTX A;  2QJ9 C;  1IKC A;  2NBT A;  1CB9 A;  1FSC A;  1KU6 B;  3LAQ U;  1HC9 A;  1W6B A;  2MFA A;  1MR6 A;  1F94 A;  1H0J A;  3U73 U;  4BIK B;  2BTX A;  2N99 A;  1NYU A;  1M9Z A;  5EBX A;  1HAJ A;  2H8U A;  3VTS A;  2QC1 A;  1ABT A;  3BT2 U;  1PLO A;  1KL8 A;  1IDG A;  1ZAD A;  2H5F A;  4OM4 A;  1CCQ A;  1IK8 A;  1ONJ A;  1FFJ A;  1LJZ A;  1XT3 A;  2QJA C;  2MJY A;  1S4Y A;  1ES7 B;  1FSS B;  1DRS A;  1BXP A;  2H7Z B;  5IMY C;  3NDS A;  3BT1 U;  2FD6 U;  1CVO A;  1FRA A;  1BTE A;  1HC9 B;  1KXI A;  1REW C;  3NEQ A;  1TFS A;  2ABX A;  1IDL A;  2J8B A;  1NTN A;  1KBS A;  2H64 C;  1FF4 A;  1B41 B;  1ERA A;  4UY2 C;  3FEV A;  4XJJ A;  4BDT B;  1JE9 A;  1KC4 A;  1NOR A;  2K3G A;  4DO8 A;  2H62 D;  1KS6 A;  4EY8 B;  1CDS A;  4QTI U;  1L4W A;  1NXB A;  2I9B E;  6EBX A;  1HAA A;  1TGX A;  1CDQ A;  1KBT A;  2HLQ A;  1LX5 B;  5DZ5 A;  2OFS A;  1CDR A;  1NEA A;  1UG4 A;  2MHY A;  1KTZ B;  2BHI A;  3ERA A;  2CRT A;  1LXG A;  4RUD A; 
#chains in the Genus database with same CATH topology
 3PLC A;  2GOO C;  1CTX A;  2H64 B;  3NH7 A;  1VB0 A;  1KFH A;  1COD A;  2PJY C;  1KBA A;  3EVS C;  1CRE A;  2UX2 A;  1CXO A;  2L03 A;  2CCX A;  1I02 A;  3QB4 B;  1LXH A;  2VLW A;  4ZQY A;  1JGK A;  4HQP F;  1QM7 A;  1TXB A;  1COE A;  1CXN A;  1JBD A;  1MAH F;  2LA1 A;  1QKD A;  1RGJ A;  2MJ0 A;  1G6M A;  5IMT D;  1TXA A;  4P7U A;  2QJB C;  4LFT A;  2L5S A;  2CDX A;  1CHV S;  1IQ9 A;  2CTX A;  4FAO E;  1V6P A;  2CRS A;  2H62 C;  2UWR A;  5DO6 A;  1IDH A;  4OM5 A;  2GOO B;  2MJ4 A;  2MUO A;  3KFD I;  2MUP A;  3KFD E;  1CRF A;  2PJY B;  1HOY A;  1CDT A;  1NYS A;  1F8U B;  3EBX A;  4AEA A;  2JQP A;  5DU1 A;  2ERA A;  2X8B B;  2LCR A;  4FAO C;  1RL5 A;  1LSI A;  2HLR A;  3U74 U;  4IYE A;  1YWH A;  1QKE A;  1ERG A;  1IDI A;  1FAS A;  3HH7 A;  2H7Z A;  1IJC A;  2JVE A;  1NTX A;  2QJ9 C;  1IKC A;  2NBT A;  1CB9 A;  1FSC A;  1KU6 B;  3LAQ U;  1HC9 A;  1W6B A;  2MFA A;  1MR6 A;  1F94 A;  1H0J A;  3U73 U;  4BIK B;  2BTX A;  2N99 A;  1NYU A;  1M9Z A;  5EBX A;  1HAJ A;  2H8U A;  3VTS A;  2QC1 A;  1ABT A;  3BT2 U;  1PLO A;  1KL8 A;  1IDG A;  1ZAD A;  2H5F A;  4OM4 A;  1CCQ A;  1IK8 A;  1ONJ A;  1FFJ A;  1LJZ A;  1XT3 A;  2QJA C;  4KSN A;  2MJY A;  1S4Y A;  1ES7 B;  1FSS B;  1DRS A;  1BXP A;  2H7Z B;  5IMY C;  3NDS A;  3BT1 U;  2FD6 U;  1CVO A;  1FRA A;  1BTE A;  1HC9 B;  1KXI A;  1REW C;  3NEQ A;  1TFS A;  2ABX A;  1IDL A;  2J8B A;  1NTN A;  1KBS A;  2H64 C;  1FF4 A;  1B41 B;  1ERA A;  4UY2 C;  3FEV A;  4XJJ A;  4BDT B;  1JE9 A;  1KC4 A;  1NOR A;  2K3G A;  4DO8 A;  2H62 D;  1KS6 A;  4EY8 B;  1CDS A;  4QTI U;  1L4W A;  1NXB A;  2I9B E;  6EBX A;  1HAA A;  1TGX A;  1CDQ A;  1KBT A;  2HLQ A;  1LX5 B;  5DZ5 A;  2OFS A;  1CDR A;  1NEA A;  1UG4 A;  2MHY A;  1KTZ B;  2BHI A;  3ERA A;  2CRT A;  1LXG A;  4RUD A; 
#chains in the Genus database with same CATH homology
 3PLC A;  2GOO C;  1CTX A;  2H64 B;  3NH7 A;  1VB0 A;  1KFH A;  1COD A;  2PJY C;  1KBA A;  3EVS C;  1CRE A;  2UX2 A;  1CXO A;  2L03 A;  2CCX A;  1I02 A;  3QB4 B;  1LXH A;  2VLW A;  4ZQY A;  1JGK A;  4HQP F;  1QM7 A;  1TXB A;  1COE A;  1CXN A;  1JBD A;  1MAH F;  2LA1 A;  1QKD A;  1RGJ A;  2MJ0 A;  1G6M A;  5IMT D;  1TXA A;  4P7U A;  2QJB C;  4LFT A;  2L5S A;  2CDX A;  1CHV S;  1IQ9 A;  2CTX A;  4FAO E;  1V6P A;  2CRS A;  2H62 C;  2UWR A;  5DO6 A;  1IDH A;  4OM5 A;  2GOO B;  2MJ4 A;  2MUO A;  3KFD I;  2MUP A;  3KFD E;  1CRF A;  2PJY B;  1HOY A;  1CDT A;  1NYS A;  1F8U B;  3EBX A;  4AEA A;  2JQP A;  5DU1 A;  2ERA A;  2X8B B;  2LCR A;  4FAO C;  1RL5 A;  1LSI A;  2HLR A;  3U74 U;  4IYE A;  1YWH A;  1QKE A;  1ERG A;  1IDI A;  1FAS A;  3HH7 A;  2H7Z A;  1IJC A;  2JVE A;  1NTX A;  2QJ9 C;  1IKC A;  2NBT A;  1CB9 A;  1FSC A;  1KU6 B;  3LAQ U;  1HC9 A;  1W6B A;  2MFA A;  1MR6 A;  1F94 A;  1H0J A;  3U73 U;  4BIK B;  2BTX A;  2N99 A;  1NYU A;  1M9Z A;  5EBX A;  1HAJ A;  2H8U A;  3VTS A;  2QC1 A;  1ABT A;  3BT2 U;  1PLO A;  1KL8 A;  1IDG A;  1ZAD A;  2H5F A;  4OM4 A;  1CCQ A;  1IK8 A;  1ONJ A;  1FFJ A;  1LJZ A;  1XT3 A;  2QJA C;  4KSN A;  2MJY A;  1S4Y A;  1ES7 B;  1FSS B;  1DRS A;  1BXP A;  2H7Z B;  5IMY C;  3NDS A;  3BT1 U;  2FD6 U;  1CVO A;  1FRA A;  1BTE A;  1HC9 B;  1KXI A;  1REW C;  3NEQ A;  1TFS A;  2ABX A;  1IDL A;  2J8B A;  1NTN A;  1KBS A;  2H64 C;  1FF4 A;  1B41 B;  1ERA A;  4UY2 C;  3FEV A;  4XJJ A;  4BDT B;  1JE9 A;  1KC4 A;  1NOR A;  2K3G A;  4DO8 A;  2H62 D;  1KS6 A;  4EY8 B;  1CDS A;  4QTI U;  1L4W A;  1NXB A;  2I9B E;  6EBX A;  1HAA A;  1TGX A;  1CDQ A;  1KBT A;  2HLQ A;  1LX5 B;  5DZ5 A;  2OFS A;  1CDR A;  1NEA A;  1UG4 A;  2MHY A;  1KTZ B;  2BHI A;  3ERA A;  2CRT A;  1LXG A;  4RUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...