1KBSA

Solution structure of cardiotoxin iv, nmr, 1 structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytotoxin
molecule keywords CTX IV
publication title Comparison of the hemolytic activity and solution structures of two snake venom cardiotoxin analogues which only differ in their N-terminal amino acid.
pubmed doi rcsb
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1996-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1kbsA00
1FSCA 1KC4A 4OM4A 2CRSA 4OM5A 1L4WA 2ABXA 2QC1A 1HC9B 1RGJA 1ABTA 2PJYB 1HAJA 3BT1U 2MJYA 2GOOC 3LAQU 1KU6B 5DO6A 1IQ9A 5IMYC 2H7ZB 1ES7B 4HQPF 1CVOA 1NEAA 1KL8A 1FSSB 1B41B 2K3GA 1LXHA 3BT2U 1IJCA 2UWRA 1LJZA 2VLWA 3QB4B 2BHIA 2LCRA 1HAAA 1QKEA 1KBTA 2GOOB 2N99A 2MUOA 1KTZB 4LFTA 1KFHA 2H64C 1IDGA 3U74U 2MUPA 2MHYA 4DO8A 1FFJA 1QM7A 3NH7A 2CDXA 1I02A 2HLQA 1ERGA 1CRFA 1JGKA 2X8BB 1LXGA 2H64B 1IK8A 4IYEA 1RL5A 2ERAA 1QKDA 1G6MA 1CB9A 2MJ4A 5DZ5A 1TFSA 4P7UA 1NYUA 1KBAA 2J8BA 4UY2C 1FASA 1ONJA 1CDSA 1HOYA 1NXBA 1CDQA 2FD6U 1CDTA 1S4YA 3VTSA 1V6PA 1CTXA 1H0JA 1NTNA 1F8UB 1NORA 2QJBC 1CXNA 1W6BA 1IDIA 3ERAA 1CCQA 1IDHA 1M9ZA 1LSIA 3FEVA 1IDLA 4QTIU 3U73U 1BXPA 3KFDI 1JE9A 1TXAA 2OFSA 3NDSA 5EBXA 2NBTA 2CTXA 2I9BE 4FAOE 1KS6A 1NYSA 4BDTB 1NTXA 1DRSA 1CDRA 2CRTA 1KXIA 1UG4A 3PLCA 4XJJA 2HLRA 1MR6A 2UX2A 2H62C 4AEAA 1FF4A 1BTEA 5DU1A 2JVEA 2H8UA 4EY8B 1PLOA 1JBDA 1MAHF 2QJAC 1CODA 3HH7A 1F94A 4ZQYA 1FRAA 2QJ9C 1VB0A 2H62D 4BIKB 2L03A 1IKCA 1XT3A 2MFAA 6EBXA 2L5SA 1ZADA 2JQPA 2MJ0A 3EBXA 1ERAA 2BTXA 1CXOA 1REWC 1CHVS 1CREA 1HC9A 1KBSA 4FAOC 3NEQA 3KFDE 5IMTD 2H5FA 1LX5B 3EVSC 1TGXA 2PJYC 4RUDA 1YWHA 1TXBA 2LA1A 2H7ZA 1COEA 2CCXA
chains in the Genus database with same CATH superfamily
4KSNA 1FSCA 1KC4A 4OM4A 2CRSA 4OM5A 1L4WA 2ABXA 2QC1A 1HC9B 1RGJA 1ABTA 2PJYB 1HAJA 3BT1U 2MJYA 2GOOC 3LAQU 1KU6B 5DO6A 1IQ9A 5IMYC 2H7ZB 1ES7B 4HQPF 1CVOA 1NEAA 1KL8A 1FSSB 1B41B 2K3GA 1LXHA 3BT2U 1IJCA 2UWRA 1LJZA 2VLWA 3QB4B 2BHIA 2LCRA 1HAAA 1QKEA 1KBTA 2GOOB 2N99A 2MUOA 1KTZB 4LFTA 1KFHA 2H64C 1IDGA 3U74U 2MUPA 2MHYA 4DO8A 1FFJA 1QM7A 3NH7A 2CDXA 1I02A 2HLQA 1ERGA 1CRFA 1JGKA 2X8BB 1LXGA 2H64B 1IK8A 4IYEA 1RL5A 2ERAA 1QKDA 1G6MA 1CB9A 2MJ4A 5DZ5A 1TFSA 4P7UA 1NYUA 1KBAA 2J8BA 4UY2C 1FASA 1ONJA 1CDSA 1HOYA 1NXBA 1CDQA 2FD6U 1CDTA 1S4YA 3VTSA 1V6PA 1CTXA 1H0JA 1NTNA 1F8UB 1NORA 2QJBC 1CXNA 1W6BA 1IDIA 3ERAA 1CCQA 1IDHA 1M9ZA 1LSIA 3FEVA 1IDLA 4QTIU 3U73U 1BXPA 3KFDI 1JE9A 1TXAA 2OFSA 3NDSA 5EBXA 2NBTA 2CTXA 2I9BE 4FAOE 1KS6A 1NYSA 4BDTB 1NTXA 1DRSA 1CDRA 2CRTA 1KXIA 1UG4A 3PLCA 4XJJA 2HLRA 1MR6A 2UX2A 2H62C 4AEAA 1FF4A 1BTEA 5DU1A 2JVEA 2H8UA 4EY8B 1PLOA 1JBDA 1MAHF 2QJAC 1CODA 3HH7A 1F94A 4ZQYA 1FRAA 2QJ9C 1VB0A 2H62D 4BIKB 2L03A 1IKCA 1XT3A 2MFAA 6EBXA 2L5SA 1ZADA 2JQPA 2MJ0A 3EBXA 1ERAA 2BTXA 1CXOA 1REWC 1CHVS 1CREA 1HC9A 1KBSA 4FAOC 3NEQA 3KFDE 5IMTD 2H5FA 1LX5B 3EVSC 1TGXA 2PJYC 4RUDA 1YWHA 1TXBA 2LA1A 2H7ZA 1COEA 2CCXA
chains in the Genus database with same CATH topology
4KSNA 1FSCA 1KC4A 4OM4A 2CRSA 4OM5A 1L4WA 2ABXA 2QC1A 1HC9B 1RGJA 1ABTA 2PJYB 1HAJA 3BT1U 2MJYA 2GOOC 3LAQU 1KU6B 5DO6A 1IQ9A 5IMYC 2H7ZB 1ES7B 4HQPF 1CVOA 1NEAA 1KL8A 1FSSB 1B41B 2K3GA 1LXHA 3BT2U 1IJCA 2UWRA 1LJZA 2VLWA 3QB4B 2BHIA 2LCRA 1HAAA 1QKEA 1KBTA 2GOOB 2N99A 2MUOA 1KTZB 4LFTA 1KFHA 2H64C 1IDGA 3U74U 2MUPA 2MHYA 4DO8A 1FFJA 1QM7A 3NH7A 2CDXA 1I02A 2HLQA 1ERGA 1CRFA 1JGKA 2X8BB 1LXGA 2H64B 1IK8A 4IYEA 1RL5A 2ERAA 1QKDA 1G6MA 1CB9A 2MJ4A 5DZ5A 1TFSA 4P7UA 1NYUA 1KBAA 2J8BA 4UY2C 1FASA 1ONJA 1CDSA 1HOYA 1NXBA 1CDQA 2FD6U 1CDTA 1S4YA 3VTSA 1V6PA 1CTXA 1H0JA 1NTNA 1F8UB 1NORA 2QJBC 1CXNA 1W6BA 1IDIA 3ERAA 1CCQA 1IDHA 1M9ZA 1LSIA 3FEVA 1IDLA 4QTIU 3U73U 1BXPA 3KFDI 1JE9A 1TXAA 2OFSA 3NDSA 5EBXA 2NBTA 2CTXA 2I9BE 4FAOE 1KS6A 1NYSA 4BDTB 1NTXA 1DRSA 1CDRA 2CRTA 1KXIA 1UG4A 3PLCA 4XJJA 2HLRA 1MR6A 2UX2A 2H62C 4AEAA 1FF4A 1BTEA 5DU1A 2JVEA 2H8UA 4EY8B 1PLOA 1JBDA 1MAHF 2QJAC 1CODA 3HH7A 1F94A 4ZQYA 1FRAA 2QJ9C 1VB0A 2H62D 4BIKB 2L03A 1IKCA 1XT3A 2MFAA 6EBXA 2L5SA 1ZADA 2JQPA 2MJ0A 3EBXA 1ERAA 2BTXA 1CXOA 1REWC 1CHVS 1CREA 1HC9A 1KBSA 4FAOC 3NEQA 3KFDE 5IMTD 2H5FA 1LX5B 3EVSC 1TGXA 2PJYC 4RUDA 1YWHA 1TXBA 2LA1A 2H7ZA 1COEA 2CCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSC A;  1KC4 A;  4OM4 A;  2CRS A;  4OM5 A;  1L4W A;  2ABX A;  2QC1 A;  1HC9 B;  1RGJ A;  1ABT A;  2PJY B;  1HAJ A;  3BT1 U;  2MJY A;  2GOO C;  3LAQ U;  1KU6 B;  5DO6 A;  1IQ9 A;  5IMY C;  2H7Z B;  1ES7 B;  4HQP F;  1CVO A;  1NEA A;  1KL8 A;  1FSS B;  1B41 B;  2K3G A;  1LXH A;  3BT2 U;  1IJC A;  2UWR A;  1LJZ A;  2VLW A;  3QB4 B;  2BHI A;  2LCR A;  1HAA A;  1QKE A;  1KBT A;  2GOO B;  2N99 A;  2MUO A;  1KTZ B;  4LFT A;  1KFH A;  2H64 C;  1IDG A;  3U74 U;  2MUP A;  2MHY A;  4DO8 A;  1FFJ A;  1QM7 A;  3NH7 A;  2CDX A;  1I02 A;  2HLQ A;  1ERG A;  1CRF A;  1JGK A;  2X8B B;  1LXG A;  2H64 B;  1IK8 A;  4IYE A;  1RL5 A;  2ERA A;  1QKD A;  1G6M A;  1CB9 A;  2MJ4 A;  5DZ5 A;  1TFS A;  4P7U A;  1NYU A;  1KBA A;  2J8B A;  4UY2 C;  1FAS A;  1ONJ A;  1CDS A;  1HOY A;  1NXB A;  1CDQ A;  2FD6 U;  1CDT A;  1S4Y A;  3VTS A;  1V6P A;  1CTX A;  1H0J A;  1NTN A;  1F8U B;  1NOR A;  2QJB C;  1CXN A;  1W6B A;  1IDI A;  3ERA A;  1CCQ A;  1IDH A;  1M9Z A;  1LSI A;  3FEV A;  1IDL A;  4QTI U;  3U73 U;  1BXP A;  3KFD I;  1JE9 A;  1TXA A;  2OFS A;  3NDS A;  5EBX A;  2NBT A;  2CTX A;  2I9B E;  4FAO E;  1KS6 A;  1NYS A;  4BDT B;  1NTX A;  1DRS A;  1CDR A;  2CRT A;  1KXI A;  1UG4 A;  3PLC A;  4XJJ A;  2HLR A;  1MR6 A;  2UX2 A;  2H62 C;  4AEA A;  1FF4 A;  1BTE A;  5DU1 A;  2JVE A;  2H8U A;  4EY8 B;  1PLO A;  1JBD A;  1MAH F;  2QJA C;  1COD A;  3HH7 A;  1F94 A;  4ZQY A;  1FRA A;  2QJ9 C;  1VB0 A;  2H62 D;  4BIK B;  2L03 A;  1IKC A;  1XT3 A;  2MFA A;  6EBX A;  2L5S A;  1ZAD A;  2JQP A;  2MJ0 A;  3EBX A;  1ERA A;  2BTX A;  1CXO A;  1REW C;  1CHV S;  1CRE A;  1HC9 A;  1KBS A;  4FAO C;  3NEQ A;  3KFD E;  5IMT D;  2H5F A;  1LX5 B;  3EVS C;  1TGX A;  2PJY C;  4RUD A;  1YWH A;  1TXB A;  2LA1 A;  2H7Z A;  1COE A;  2CCX A; 
#chains in the Genus database with same CATH topology
 4KSN A;  1FSC A;  1KC4 A;  4OM4 A;  2CRS A;  4OM5 A;  1L4W A;  2ABX A;  2QC1 A;  1HC9 B;  1RGJ A;  1ABT A;  2PJY B;  1HAJ A;  3BT1 U;  2MJY A;  2GOO C;  3LAQ U;  1KU6 B;  5DO6 A;  1IQ9 A;  5IMY C;  2H7Z B;  1ES7 B;  4HQP F;  1CVO A;  1NEA A;  1KL8 A;  1FSS B;  1B41 B;  2K3G A;  1LXH A;  3BT2 U;  1IJC A;  2UWR A;  1LJZ A;  2VLW A;  3QB4 B;  2BHI A;  2LCR A;  1HAA A;  1QKE A;  1KBT A;  2GOO B;  2N99 A;  2MUO A;  1KTZ B;  4LFT A;  1KFH A;  2H64 C;  1IDG A;  3U74 U;  2MUP A;  2MHY A;  4DO8 A;  1FFJ A;  1QM7 A;  3NH7 A;  2CDX A;  1I02 A;  2HLQ A;  1ERG A;  1CRF A;  1JGK A;  2X8B B;  1LXG A;  2H64 B;  1IK8 A;  4IYE A;  1RL5 A;  2ERA A;  1QKD A;  1G6M A;  1CB9 A;  2MJ4 A;  5DZ5 A;  1TFS A;  4P7U A;  1NYU A;  1KBA A;  2J8B A;  4UY2 C;  1FAS A;  1ONJ A;  1CDS A;  1HOY A;  1NXB A;  1CDQ A;  2FD6 U;  1CDT A;  1S4Y A;  3VTS A;  1V6P A;  1CTX A;  1H0J A;  1NTN A;  1F8U B;  1NOR A;  2QJB C;  1CXN A;  1W6B A;  1IDI A;  3ERA A;  1CCQ A;  1IDH A;  1M9Z A;  1LSI A;  3FEV A;  1IDL A;  4QTI U;  3U73 U;  1BXP A;  3KFD I;  1JE9 A;  1TXA A;  2OFS A;  3NDS A;  5EBX A;  2NBT A;  2CTX A;  2I9B E;  4FAO E;  1KS6 A;  1NYS A;  4BDT B;  1NTX A;  1DRS A;  1CDR A;  2CRT A;  1KXI A;  1UG4 A;  3PLC A;  4XJJ A;  2HLR A;  1MR6 A;  2UX2 A;  2H62 C;  4AEA A;  1FF4 A;  1BTE A;  5DU1 A;  2JVE A;  2H8U A;  4EY8 B;  1PLO A;  1JBD A;  1MAH F;  2QJA C;  1COD A;  3HH7 A;  1F94 A;  4ZQY A;  1FRA A;  2QJ9 C;  1VB0 A;  2H62 D;  4BIK B;  2L03 A;  1IKC A;  1XT3 A;  2MFA A;  6EBX A;  2L5S A;  1ZAD A;  2JQP A;  2MJ0 A;  3EBX A;  1ERA A;  2BTX A;  1CXO A;  1REW C;  1CHV S;  1CRE A;  1HC9 A;  1KBS A;  4FAO C;  3NEQ A;  3KFD E;  5IMT D;  2H5F A;  1LX5 B;  3EVS C;  1TGX A;  2PJY C;  4RUD A;  1YWH A;  1TXB A;  2LA1 A;  2H7Z A;  1COE A;  2CCX A; 
#chains in the Genus database with same CATH homology
 4KSN A;  1FSC A;  1KC4 A;  4OM4 A;  2CRS A;  4OM5 A;  1L4W A;  2ABX A;  2QC1 A;  1HC9 B;  1RGJ A;  1ABT A;  2PJY B;  1HAJ A;  3BT1 U;  2MJY A;  2GOO C;  3LAQ U;  1KU6 B;  5DO6 A;  1IQ9 A;  5IMY C;  2H7Z B;  1ES7 B;  4HQP F;  1CVO A;  1NEA A;  1KL8 A;  1FSS B;  1B41 B;  2K3G A;  1LXH A;  3BT2 U;  1IJC A;  2UWR A;  1LJZ A;  2VLW A;  3QB4 B;  2BHI A;  2LCR A;  1HAA A;  1QKE A;  1KBT A;  2GOO B;  2N99 A;  2MUO A;  1KTZ B;  4LFT A;  1KFH A;  2H64 C;  1IDG A;  3U74 U;  2MUP A;  2MHY A;  4DO8 A;  1FFJ A;  1QM7 A;  3NH7 A;  2CDX A;  1I02 A;  2HLQ A;  1ERG A;  1CRF A;  1JGK A;  2X8B B;  1LXG A;  2H64 B;  1IK8 A;  4IYE A;  1RL5 A;  2ERA A;  1QKD A;  1G6M A;  1CB9 A;  2MJ4 A;  5DZ5 A;  1TFS A;  4P7U A;  1NYU A;  1KBA A;  2J8B A;  4UY2 C;  1FAS A;  1ONJ A;  1CDS A;  1HOY A;  1NXB A;  1CDQ A;  2FD6 U;  1CDT A;  1S4Y A;  3VTS A;  1V6P A;  1CTX A;  1H0J A;  1NTN A;  1F8U B;  1NOR A;  2QJB C;  1CXN A;  1W6B A;  1IDI A;  3ERA A;  1CCQ A;  1IDH A;  1M9Z A;  1LSI A;  3FEV A;  1IDL A;  4QTI U;  3U73 U;  1BXP A;  3KFD I;  1JE9 A;  1TXA A;  2OFS A;  3NDS A;  5EBX A;  2NBT A;  2CTX A;  2I9B E;  4FAO E;  1KS6 A;  1NYS A;  4BDT B;  1NTX A;  1DRS A;  1CDR A;  2CRT A;  1KXI A;  1UG4 A;  3PLC A;  4XJJ A;  2HLR A;  1MR6 A;  2UX2 A;  2H62 C;  4AEA A;  1FF4 A;  1BTE A;  5DU1 A;  2JVE A;  2H8U A;  4EY8 B;  1PLO A;  1JBD A;  1MAH F;  2QJA C;  1COD A;  3HH7 A;  1F94 A;  4ZQY A;  1FRA A;  2QJ9 C;  1VB0 A;  2H62 D;  4BIK B;  2L03 A;  1IKC A;  1XT3 A;  2MFA A;  6EBX A;  2L5S A;  1ZAD A;  2JQP A;  2MJ0 A;  3EBX A;  1ERA A;  2BTX A;  1CXO A;  1REW C;  1CHV S;  1CRE A;  1HC9 A;  1KBS A;  4FAO C;  3NEQ A;  3KFD E;  5IMT D;  2H5F A;  1LX5 B;  3EVS C;  1TGX A;  2PJY C;  4RUD A;  1YWH A;  1TXB A;  2LA1 A;  2H7Z A;  1COE A;  2CCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...