1KBSA

Solution structure of cardiotoxin iv, nmr, 1 structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTX IV
publication title Comparison of the hemolytic activity and solution structures of two snake venom cardiotoxin analogues which only differ in their N-terminal amino acid.
pubmed doi rcsb
molecule tags Cytotoxin
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1996-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1kbsA00
1IK8A 1F94A 4P7UA 1HC9B 2CRTA 1IJCA 2MHYA 1HOYA 3EVSC 3VTSA 1QKEA 2J8BA 1CB9A 1CXNA 2K3GA 2PJYC 1NYUA 1IDGA 3KFDE 3EBXA 3FEVA 3NH7A 1L4WA 2GOOC 1KL8A 1QKDA 2NBTA 3HH7A 1LXGA 1JBDA 2QJ9C 1KBSA 2UX2A 3PLCA 2MUPA 1FF4A 1MR6A 1RL5A 1UG4A 2H62D 2H64C 4FAOC 1B41B 4FAOE 1KTZB 1CXOA 1LXHA 3NEQA 5IMTD 2H7ZB 4OM4A 2BTXA 1CRFA 2PJYB 1REWC 2MJ4A 1HAAA 1CHVS 2MUOA 1KBTA 1NORA 5DU1A 1KFHA 2BHIA 1CDTA 2CDXA 4IYEA 3U74U 1TFSA 1W6BA 2UWRA 2OFSA 1BTEA 1IDLA 1YWHA 1NEAA 1CODA 1DRSA 3LAQU 5EBXA 1IKCA 2JQPA 1NTXA 2VLWA 1CVOA 1TXBA 1MAHF 2H5FA 2H8UA 4OM5A 2MFAA 4QTIU 2JVEA 1I02A 1HC9A 2CTXA 1G6MA 1LSIA 4DO8A 1FSCA 1ZADA 1NYSA 4AEAA 1BXPA 2I9BE 2MJYA 2QC1A 2N99A 1HAJA 1H0JA 1RGJA 4RUDA 1NTNA 4BDTB 3BT1U 2GOOB 1NXBA 2FD6U 2HLRA 1KXIA 1JE9A 1FASA 4LFTA 2H64B 1XT3A 1CDSA 1CDRA 1KC4A 1ERAA 2CCXA 2H62C 1FSSB 1VB0A 2H7ZA 1KS6A 3NDSA 2QJBC 4BIKB 1F8UB 1JGKA 1ERGA 2HLQA 2X8BB 1CTXA 1COEA 2MJ0A 3ERAA 4UY2C 1ABTA 2LA1A 1KBAA 3U73U 1ONJA 5IMYC 1TXAA 1TGXA 4EY8B 5DO6A 4ZQYA 1KU6B 4XJJA 1ES7B 1IDIA 2ABXA 1LX5B 1LJZA 2L03A 2CRSA 3QB4B 5DZ5A 2LCRA 1QM7A 4HQPF 1CCQA 1IQ9A 2QJAC 1FRAA 1CREA 2L5SA 1IDHA 3KFDI 1M9ZA 1V6PA 3BT2U 1S4YA 1FFJA 2ERAA 6EBXA 1PLOA 1CDQA
chains in the Genus database with same CATH superfamily
1IK8A 1F94A 4P7UA 1HC9B 2CRTA 1IJCA 2MHYA 1HOYA 3EVSC 4KSNA 3VTSA 1QKEA 2J8BA 1CB9A 1CXNA 2K3GA 2PJYC 1NYUA 1IDGA 3KFDE 3EBXA 3FEVA 3NH7A 1L4WA 2GOOC 1KL8A 1QKDA 2NBTA 3HH7A 1LXGA 1JBDA 2QJ9C 1KBSA 2UX2A 3PLCA 2MUPA 1FF4A 1MR6A 1RL5A 1UG4A 2H62D 2H64C 4FAOC 1B41B 4FAOE 1KTZB 1CXOA 1LXHA 3NEQA 5IMTD 2H7ZB 4OM4A 2BTXA 1CRFA 2PJYB 1REWC 2MJ4A 1HAAA 1CHVS 2MUOA 1KBTA 1NORA 5DU1A 1KFHA 2BHIA 1CDTA 2CDXA 4IYEA 3U74U 1TFSA 1W6BA 2UWRA 2OFSA 1BTEA 1IDLA 1YWHA 1NEAA 1CODA 1DRSA 3LAQU 5EBXA 1IKCA 2JQPA 1NTXA 2VLWA 1CVOA 1TXBA 1MAHF 2H5FA 2H8UA 4OM5A 2MFAA 4QTIU 2JVEA 1I02A 1HC9A 2CTXA 1G6MA 1LSIA 4DO8A 1FSCA 1ZADA 1NYSA 4AEAA 1BXPA 2I9BE 2MJYA 2QC1A 2N99A 1HAJA 1H0JA 1RGJA 4RUDA 1NTNA 4BDTB 3BT1U 2GOOB 1NXBA 2FD6U 2HLRA 1KXIA 1JE9A 1FASA 4LFTA 2H64B 1XT3A 1CDSA 1CDRA 1KC4A 1ERAA 2CCXA 2H62C 1FSSB 1VB0A 2H7ZA 1KS6A 3NDSA 2QJBC 4BIKB 1F8UB 1JGKA 1ERGA 2HLQA 2X8BB 1CTXA 1COEA 2MJ0A 3ERAA 4UY2C 1ABTA 2LA1A 1KBAA 3U73U 1ONJA 5IMYC 1TXAA 1TGXA 4EY8B 5DO6A 4ZQYA 1KU6B 4XJJA 1ES7B 1IDIA 2ABXA 1LX5B 1LJZA 2L03A 2CRSA 3QB4B 5DZ5A 2LCRA 1QM7A 4HQPF 1CCQA 1IQ9A 2QJAC 1FRAA 1CREA 2L5SA 1IDHA 3KFDI 1M9ZA 1V6PA 3BT2U 1S4YA 1FFJA 2ERAA 6EBXA 1PLOA 1CDQA
chains in the Genus database with same CATH topology
1IK8A 1F94A 4P7UA 1HC9B 2CRTA 1IJCA 2MHYA 1HOYA 3EVSC 4KSNA 3VTSA 1QKEA 2J8BA 1CB9A 1CXNA 2K3GA 2PJYC 1NYUA 1IDGA 3KFDE 3EBXA 3FEVA 3NH7A 1L4WA 2GOOC 1KL8A 1QKDA 2NBTA 3HH7A 1LXGA 1JBDA 2QJ9C 1KBSA 2UX2A 3PLCA 2MUPA 1FF4A 1MR6A 1RL5A 1UG4A 2H62D 2H64C 4FAOC 1B41B 4FAOE 1KTZB 1CXOA 1LXHA 3NEQA 5IMTD 2H7ZB 4OM4A 2BTXA 1CRFA 2PJYB 1REWC 2MJ4A 1HAAA 1CHVS 2MUOA 1KBTA 1NORA 5DU1A 1KFHA 2BHIA 1CDTA 2CDXA 4IYEA 3U74U 1TFSA 1W6BA 2UWRA 2OFSA 1BTEA 1IDLA 1YWHA 1NEAA 1CODA 1DRSA 3LAQU 5EBXA 1IKCA 2JQPA 1NTXA 2VLWA 1CVOA 1TXBA 1MAHF 2H5FA 2H8UA 4OM5A 2MFAA 4QTIU 2JVEA 1I02A 1HC9A 2CTXA 1G6MA 1LSIA 4DO8A 1FSCA 1ZADA 1NYSA 4AEAA 1BXPA 2I9BE 2MJYA 2QC1A 2N99A 1HAJA 1H0JA 1RGJA 4RUDA 1NTNA 4BDTB 3BT1U 2GOOB 1NXBA 2FD6U 2HLRA 1KXIA 1JE9A 1FASA 4LFTA 2H64B 1XT3A 1CDSA 1CDRA 1KC4A 1ERAA 2CCXA 2H62C 1FSSB 1VB0A 2H7ZA 1KS6A 3NDSA 2QJBC 4BIKB 1F8UB 1JGKA 1ERGA 2HLQA 2X8BB 1CTXA 1COEA 2MJ0A 3ERAA 4UY2C 1ABTA 2LA1A 1KBAA 3U73U 1ONJA 5IMYC 1TXAA 1TGXA 4EY8B 5DO6A 4ZQYA 1KU6B 4XJJA 1ES7B 1IDIA 2ABXA 1LX5B 1LJZA 2L03A 2CRSA 3QB4B 5DZ5A 2LCRA 1QM7A 4HQPF 1CCQA 1IQ9A 2QJAC 1FRAA 1CREA 2L5SA 1IDHA 3KFDI 1M9ZA 1V6PA 3BT2U 1S4YA 1FFJA 2ERAA 6EBXA 1PLOA 1CDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IK8 A;  1F94 A;  4P7U A;  1HC9 B;  2CRT A;  1IJC A;  2MHY A;  1HOY A;  3EVS C;  3VTS A;  1QKE A;  2J8B A;  1CB9 A;  1CXN A;  2K3G A;  2PJY C;  1NYU A;  1IDG A;  3KFD E;  3EBX A;  3FEV A;  3NH7 A;  1L4W A;  2GOO C;  1KL8 A;  1QKD A;  2NBT A;  3HH7 A;  1LXG A;  1JBD A;  2QJ9 C;  1KBS A;  2UX2 A;  3PLC A;  2MUP A;  1FF4 A;  1MR6 A;  1RL5 A;  1UG4 A;  2H62 D;  2H64 C;  4FAO C;  1B41 B;  4FAO E;  1KTZ B;  1CXO A;  1LXH A;  3NEQ A;  5IMT D;  2H7Z B;  4OM4 A;  2BTX A;  1CRF A;  2PJY B;  1REW C;  2MJ4 A;  1HAA A;  1CHV S;  2MUO A;  1KBT A;  1NOR A;  5DU1 A;  1KFH A;  2BHI A;  1CDT A;  2CDX A;  4IYE A;  3U74 U;  1TFS A;  1W6B A;  2UWR A;  2OFS A;  1BTE A;  1IDL A;  1YWH A;  1NEA A;  1COD A;  1DRS A;  3LAQ U;  5EBX A;  1IKC A;  2JQP A;  1NTX A;  2VLW A;  1CVO A;  1TXB A;  1MAH F;  2H5F A;  2H8U A;  4OM5 A;  2MFA A;  4QTI U;  2JVE A;  1I02 A;  1HC9 A;  2CTX A;  1G6M A;  1LSI A;  4DO8 A;  1FSC A;  1ZAD A;  1NYS A;  4AEA A;  1BXP A;  2I9B E;  2MJY A;  2QC1 A;  2N99 A;  1HAJ A;  1H0J A;  1RGJ A;  4RUD A;  1NTN A;  4BDT B;  3BT1 U;  2GOO B;  1NXB A;  2FD6 U;  2HLR A;  1KXI A;  1JE9 A;  1FAS A;  4LFT A;  2H64 B;  1XT3 A;  1CDS A;  1CDR A;  1KC4 A;  1ERA A;  2CCX A;  2H62 C;  1FSS B;  1VB0 A;  2H7Z A;  1KS6 A;  3NDS A;  2QJB C;  4BIK B;  1F8U B;  1JGK A;  1ERG A;  2HLQ A;  2X8B B;  1CTX A;  1COE A;  2MJ0 A;  3ERA A;  4UY2 C;  1ABT A;  2LA1 A;  1KBA A;  3U73 U;  1ONJ A;  5IMY C;  1TXA A;  1TGX A;  4EY8 B;  5DO6 A;  4ZQY A;  1KU6 B;  4XJJ A;  1ES7 B;  1IDI A;  2ABX A;  1LX5 B;  1LJZ A;  2L03 A;  2CRS A;  3QB4 B;  5DZ5 A;  2LCR A;  1QM7 A;  4HQP F;  1CCQ A;  1IQ9 A;  2QJA C;  1FRA A;  1CRE A;  2L5S A;  1IDH A;  3KFD I;  1M9Z A;  1V6P A;  3BT2 U;  1S4Y A;  1FFJ A;  2ERA A;  6EBX A;  1PLO A;  1CDQ A; 
#chains in the Genus database with same CATH topology
 1IK8 A;  1F94 A;  4P7U A;  1HC9 B;  2CRT A;  1IJC A;  2MHY A;  1HOY A;  3EVS C;  4KSN A;  3VTS A;  1QKE A;  2J8B A;  1CB9 A;  1CXN A;  2K3G A;  2PJY C;  1NYU A;  1IDG A;  3KFD E;  3EBX A;  3FEV A;  3NH7 A;  1L4W A;  2GOO C;  1KL8 A;  1QKD A;  2NBT A;  3HH7 A;  1LXG A;  1JBD A;  2QJ9 C;  1KBS A;  2UX2 A;  3PLC A;  2MUP A;  1FF4 A;  1MR6 A;  1RL5 A;  1UG4 A;  2H62 D;  2H64 C;  4FAO C;  1B41 B;  4FAO E;  1KTZ B;  1CXO A;  1LXH A;  3NEQ A;  5IMT D;  2H7Z B;  4OM4 A;  2BTX A;  1CRF A;  2PJY B;  1REW C;  2MJ4 A;  1HAA A;  1CHV S;  2MUO A;  1KBT A;  1NOR A;  5DU1 A;  1KFH A;  2BHI A;  1CDT A;  2CDX A;  4IYE A;  3U74 U;  1TFS A;  1W6B A;  2UWR A;  2OFS A;  1BTE A;  1IDL A;  1YWH A;  1NEA A;  1COD A;  1DRS A;  3LAQ U;  5EBX A;  1IKC A;  2JQP A;  1NTX A;  2VLW A;  1CVO A;  1TXB A;  1MAH F;  2H5F A;  2H8U A;  4OM5 A;  2MFA A;  4QTI U;  2JVE A;  1I02 A;  1HC9 A;  2CTX A;  1G6M A;  1LSI A;  4DO8 A;  1FSC A;  1ZAD A;  1NYS A;  4AEA A;  1BXP A;  2I9B E;  2MJY A;  2QC1 A;  2N99 A;  1HAJ A;  1H0J A;  1RGJ A;  4RUD A;  1NTN A;  4BDT B;  3BT1 U;  2GOO B;  1NXB A;  2FD6 U;  2HLR A;  1KXI A;  1JE9 A;  1FAS A;  4LFT A;  2H64 B;  1XT3 A;  1CDS A;  1CDR A;  1KC4 A;  1ERA A;  2CCX A;  2H62 C;  1FSS B;  1VB0 A;  2H7Z A;  1KS6 A;  3NDS A;  2QJB C;  4BIK B;  1F8U B;  1JGK A;  1ERG A;  2HLQ A;  2X8B B;  1CTX A;  1COE A;  2MJ0 A;  3ERA A;  4UY2 C;  1ABT A;  2LA1 A;  1KBA A;  3U73 U;  1ONJ A;  5IMY C;  1TXA A;  1TGX A;  4EY8 B;  5DO6 A;  4ZQY A;  1KU6 B;  4XJJ A;  1ES7 B;  1IDI A;  2ABX A;  1LX5 B;  1LJZ A;  2L03 A;  2CRS A;  3QB4 B;  5DZ5 A;  2LCR A;  1QM7 A;  4HQP F;  1CCQ A;  1IQ9 A;  2QJA C;  1FRA A;  1CRE A;  2L5S A;  1IDH A;  3KFD I;  1M9Z A;  1V6P A;  3BT2 U;  1S4Y A;  1FFJ A;  2ERA A;  6EBX A;  1PLO A;  1CDQ A; 
#chains in the Genus database with same CATH homology
 1IK8 A;  1F94 A;  4P7U A;  1HC9 B;  2CRT A;  1IJC A;  2MHY A;  1HOY A;  3EVS C;  4KSN A;  3VTS A;  1QKE A;  2J8B A;  1CB9 A;  1CXN A;  2K3G A;  2PJY C;  1NYU A;  1IDG A;  3KFD E;  3EBX A;  3FEV A;  3NH7 A;  1L4W A;  2GOO C;  1KL8 A;  1QKD A;  2NBT A;  3HH7 A;  1LXG A;  1JBD A;  2QJ9 C;  1KBS A;  2UX2 A;  3PLC A;  2MUP A;  1FF4 A;  1MR6 A;  1RL5 A;  1UG4 A;  2H62 D;  2H64 C;  4FAO C;  1B41 B;  4FAO E;  1KTZ B;  1CXO A;  1LXH A;  3NEQ A;  5IMT D;  2H7Z B;  4OM4 A;  2BTX A;  1CRF A;  2PJY B;  1REW C;  2MJ4 A;  1HAA A;  1CHV S;  2MUO A;  1KBT A;  1NOR A;  5DU1 A;  1KFH A;  2BHI A;  1CDT A;  2CDX A;  4IYE A;  3U74 U;  1TFS A;  1W6B A;  2UWR A;  2OFS A;  1BTE A;  1IDL A;  1YWH A;  1NEA A;  1COD A;  1DRS A;  3LAQ U;  5EBX A;  1IKC A;  2JQP A;  1NTX A;  2VLW A;  1CVO A;  1TXB A;  1MAH F;  2H5F A;  2H8U A;  4OM5 A;  2MFA A;  4QTI U;  2JVE A;  1I02 A;  1HC9 A;  2CTX A;  1G6M A;  1LSI A;  4DO8 A;  1FSC A;  1ZAD A;  1NYS A;  4AEA A;  1BXP A;  2I9B E;  2MJY A;  2QC1 A;  2N99 A;  1HAJ A;  1H0J A;  1RGJ A;  4RUD A;  1NTN A;  4BDT B;  3BT1 U;  2GOO B;  1NXB A;  2FD6 U;  2HLR A;  1KXI A;  1JE9 A;  1FAS A;  4LFT A;  2H64 B;  1XT3 A;  1CDS A;  1CDR A;  1KC4 A;  1ERA A;  2CCX A;  2H62 C;  1FSS B;  1VB0 A;  2H7Z A;  1KS6 A;  3NDS A;  2QJB C;  4BIK B;  1F8U B;  1JGK A;  1ERG A;  2HLQ A;  2X8B B;  1CTX A;  1COE A;  2MJ0 A;  3ERA A;  4UY2 C;  1ABT A;  2LA1 A;  1KBA A;  3U73 U;  1ONJ A;  5IMY C;  1TXA A;  1TGX A;  4EY8 B;  5DO6 A;  4ZQY A;  1KU6 B;  4XJJ A;  1ES7 B;  1IDI A;  2ABX A;  1LX5 B;  1LJZ A;  2L03 A;  2CRS A;  3QB4 B;  5DZ5 A;  2LCR A;  1QM7 A;  4HQP F;  1CCQ A;  1IQ9 A;  2QJA C;  1FRA A;  1CRE A;  2L5S A;  1IDH A;  3KFD I;  1M9Z A;  1V6P A;  3BT2 U;  1S4Y A;  1FFJ A;  2ERA A;  6EBX A;  1PLO A;  1CDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...