1LJZA

Nmr structure of an achr-peptide (torpedo californica, alpha-subunit residues 182-202) in complex with alpha-bungarotoxin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor, toxin
molecule keywords alpha-Bungarotoxin
publication title The mechanism for acetylcholine receptor inhibition by alpha-neurotoxins and species-specific resistance to alpha-bungarotoxin revealed by NMR.
pubmed doi rcsb
total genus 9
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ljzA00
2GOOC 1V6PA 3NDSA 1LSIA 1YWHA 2H62D 1ERAA 1CREA 3ERAA 1CHVS 1ERGA 1JGKA 1REWC 1NYSA 1KS6A 2VLWA 2L5SA 1CB9A 1BXPA 1NYUA 1VB0A 2FD6U 1RGJA 1IJCA 1B41B 2GOOB 1TXAA 1HC9B 1KXIA 2ABXA 1IKCA 4EY8B 2H62C 2H64C 1RL5A 1NORA 1CDTA 1KC4A 2ERAA 1CDSA 3EVSC 1MAHF 2MJ4A 1KTZB 1S4YA 1NEAA 1HOYA 2MUPA 1NTXA 2H8UA 1IDLA 1CTXA 4P7UA 1IDHA 2H64B 1JE9A 5DZ5A 1CDQA 1UG4A 3VTSA 1KBSA 3FEVA 1QKEA 1BTEA 2QJ9C 1CRFA 1FRAA 1NTNA 2CCXA 2NBTA 2L03A 2LCRA 2I9BE 1CVOA 4DO8A 1TXBA 2MFAA 1IK8A 2MHYA 2QJBC 3EBXA 1CXOA 4FAOC 2LA1A 4BDTB 2CRTA 4AEAA 3HH7A 1FSSB 3U73U 1W6BA 1LJZA 1JBDA 1TFSA 1IDGA 4HQPF 4ZQYA 1HAAA 3PLCA 1IQ9A 1LXGA 4XJJA 3U74U 4FAOE 5DU1A 2K3GA 2CDXA 1CXNA 3KFDE 1HAJA 1FASA 1H0JA 2H7ZA 1CODA 2JVEA 2MJYA 1KU6B 1QKDA 1KFHA 1CCQA 5DO6A 2H5FA 1COEA 1F8UB 2H7ZB 4QTIU 1PLOA 2PJYC 2QC1A 1I02A 1ZADA 1KL8A 2UWRA 3BT2U 1DRSA 4UY2C 5EBXA 1QM7A 3BT1U 2UX2A 1G6MA 2MUOA 1IDIA 2PJYB 6EBXA 1CDRA 3NH7A 5IMYC 2CRSA 1KBTA 1HC9A 2HLRA 2N99A 2MJ0A 1LXHA 2JQPA 1FF4A 3QB4B 2QJAC 4BIKB 3LAQU 4OM4A 4LFTA 3NEQA 1MR6A 1ABTA 1NXBA 2J8BA 1FSCA 1ONJA 1F94A 2X8BB 1LX5B 2BTXA 4OM5A 1FFJA 1TGXA 2BHIA 5IMTD 4RUDA 2CTXA 1KBAA 3KFDI 1XT3A 2OFSA 4IYEA 1M9ZA 2HLQA 1L4WA 1ES7B
chains in the Genus database with same CATH superfamily
2GOOC 1V6PA 3NDSA 1LSIA 1YWHA 2H62D 1ERAA 1CREA 3ERAA 1CHVS 1ERGA 1JGKA 1REWC 1NYSA 1KS6A 2VLWA 2L5SA 1CB9A 1BXPA 1NYUA 1VB0A 2FD6U 1RGJA 1IJCA 1B41B 2GOOB 1TXAA 1HC9B 1KXIA 2ABXA 1IKCA 4KSNA 4EY8B 2H62C 2H64C 1RL5A 1NORA 1CDTA 1KC4A 2ERAA 1CDSA 3EVSC 1MAHF 2MJ4A 1KTZB 1S4YA 1NEAA 1HOYA 2MUPA 1NTXA 2H8UA 1IDLA 1CTXA 4P7UA 1IDHA 2H64B 1JE9A 5DZ5A 1CDQA 1UG4A 3VTSA 1KBSA 3FEVA 1QKEA 1BTEA 2QJ9C 1CRFA 1FRAA 1NTNA 2CCXA 2NBTA 2L03A 2LCRA 2I9BE 1CVOA 4DO8A 1TXBA 2MFAA 1IK8A 2MHYA 2QJBC 3EBXA 1CXOA 4FAOC 2LA1A 4BDTB 2CRTA 4AEAA 3HH7A 1FSSB 3U73U 1W6BA 1LJZA 1JBDA 1TFSA 1IDGA 4HQPF 4ZQYA 1HAAA 3PLCA 1IQ9A 1LXGA 4XJJA 3U74U 4FAOE 5DU1A 2K3GA 2CDXA 1CXNA 3KFDE 1HAJA 1FASA 1H0JA 2H7ZA 1CODA 2JVEA 2MJYA 1KU6B 1QKDA 1KFHA 1CCQA 5DO6A 2H5FA 1COEA 1F8UB 2H7ZB 4QTIU 1PLOA 2PJYC 2QC1A 1I02A 1ZADA 1KL8A 2UWRA 3BT2U 1DRSA 4UY2C 5EBXA 1QM7A 3BT1U 2UX2A 1G6MA 2MUOA 1IDIA 2PJYB 6EBXA 1CDRA 3NH7A 5IMYC 2CRSA 1KBTA 1HC9A 2HLRA 2N99A 2MJ0A 1LXHA 2JQPA 1FF4A 3QB4B 2QJAC 4BIKB 3LAQU 4OM4A 4LFTA 3NEQA 1MR6A 1ABTA 1NXBA 2J8BA 1FSCA 1ONJA 1F94A 2X8BB 1LX5B 2BTXA 4OM5A 1FFJA 1TGXA 2BHIA 5IMTD 4RUDA 2CTXA 1KBAA 3KFDI 1XT3A 2OFSA 4IYEA 1M9ZA 2HLQA 1L4WA 1ES7B
chains in the Genus database with same CATH topology
2GOOC 1V6PA 3NDSA 1LSIA 1YWHA 2H62D 1ERAA 1CREA 3ERAA 1CHVS 1ERGA 1JGKA 1REWC 1NYSA 1KS6A 2VLWA 2L5SA 1CB9A 1BXPA 1NYUA 1VB0A 2FD6U 1RGJA 1IJCA 1B41B 2GOOB 1TXAA 1HC9B 1KXIA 2ABXA 1IKCA 4KSNA 4EY8B 2H62C 2H64C 1RL5A 1NORA 1CDTA 1KC4A 2ERAA 1CDSA 3EVSC 1MAHF 2MJ4A 1KTZB 1S4YA 1NEAA 1HOYA 2MUPA 1NTXA 2H8UA 1IDLA 1CTXA 4P7UA 1IDHA 2H64B 1JE9A 5DZ5A 1CDQA 1UG4A 3VTSA 1KBSA 3FEVA 1QKEA 1BTEA 2QJ9C 1CRFA 1FRAA 1NTNA 2CCXA 2NBTA 2L03A 2LCRA 2I9BE 1CVOA 4DO8A 1TXBA 2MFAA 1IK8A 2MHYA 2QJBC 3EBXA 1CXOA 4FAOC 2LA1A 4BDTB 2CRTA 4AEAA 3HH7A 1FSSB 3U73U 1W6BA 1LJZA 1JBDA 1TFSA 1IDGA 4HQPF 4ZQYA 1HAAA 3PLCA 1IQ9A 1LXGA 4XJJA 3U74U 4FAOE 5DU1A 2K3GA 2CDXA 1CXNA 3KFDE 1HAJA 1FASA 1H0JA 2H7ZA 1CODA 2JVEA 2MJYA 1KU6B 1QKDA 1KFHA 1CCQA 5DO6A 2H5FA 1COEA 1F8UB 2H7ZB 4QTIU 1PLOA 2PJYC 2QC1A 1I02A 1ZADA 1KL8A 2UWRA 3BT2U 1DRSA 4UY2C 5EBXA 1QM7A 3BT1U 2UX2A 1G6MA 2MUOA 1IDIA 2PJYB 6EBXA 1CDRA 3NH7A 5IMYC 2CRSA 1KBTA 1HC9A 2HLRA 2N99A 2MJ0A 1LXHA 2JQPA 1FF4A 3QB4B 2QJAC 4BIKB 3LAQU 4OM4A 4LFTA 3NEQA 1MR6A 1ABTA 1NXBA 2J8BA 1FSCA 1ONJA 1F94A 2X8BB 1LX5B 2BTXA 4OM5A 1FFJA 1TGXA 2BHIA 5IMTD 4RUDA 2CTXA 1KBAA 3KFDI 1XT3A 2OFSA 4IYEA 1M9ZA 2HLQA 1L4WA 1ES7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOO C;  1V6P A;  3NDS A;  1LSI A;  1YWH A;  2H62 D;  1ERA A;  1CRE A;  3ERA A;  1CHV S;  1ERG A;  1JGK A;  1REW C;  1NYS A;  1KS6 A;  2VLW A;  2L5S A;  1CB9 A;  1BXP A;  1NYU A;  1VB0 A;  2FD6 U;  1RGJ A;  1IJC A;  1B41 B;  2GOO B;  1TXA A;  1HC9 B;  1KXI A;  2ABX A;  1IKC A;  4EY8 B;  2H62 C;  2H64 C;  1RL5 A;  1NOR A;  1CDT A;  1KC4 A;  2ERA A;  1CDS A;  3EVS C;  1MAH F;  2MJ4 A;  1KTZ B;  1S4Y A;  1NEA A;  1HOY A;  2MUP A;  1NTX A;  2H8U A;  1IDL A;  1CTX A;  4P7U A;  1IDH A;  2H64 B;  1JE9 A;  5DZ5 A;  1CDQ A;  1UG4 A;  3VTS A;  1KBS A;  3FEV A;  1QKE A;  1BTE A;  2QJ9 C;  1CRF A;  1FRA A;  1NTN A;  2CCX A;  2NBT A;  2L03 A;  2LCR A;  2I9B E;  1CVO A;  4DO8 A;  1TXB A;  2MFA A;  1IK8 A;  2MHY A;  2QJB C;  3EBX A;  1CXO A;  4FAO C;  2LA1 A;  4BDT B;  2CRT A;  4AEA A;  3HH7 A;  1FSS B;  3U73 U;  1W6B A;  1LJZ A;  1JBD A;  1TFS A;  1IDG A;  4HQP F;  4ZQY A;  1HAA A;  3PLC A;  1IQ9 A;  1LXG A;  4XJJ A;  3U74 U;  4FAO E;  5DU1 A;  2K3G A;  2CDX A;  1CXN A;  3KFD E;  1HAJ A;  1FAS A;  1H0J A;  2H7Z A;  1COD A;  2JVE A;  2MJY A;  1KU6 B;  1QKD A;  1KFH A;  1CCQ A;  5DO6 A;  2H5F A;  1COE A;  1F8U B;  2H7Z B;  4QTI U;  1PLO A;  2PJY C;  2QC1 A;  1I02 A;  1ZAD A;  1KL8 A;  2UWR A;  3BT2 U;  1DRS A;  4UY2 C;  5EBX A;  1QM7 A;  3BT1 U;  2UX2 A;  1G6M A;  2MUO A;  1IDI A;  2PJY B;  6EBX A;  1CDR A;  3NH7 A;  5IMY C;  2CRS A;  1KBT A;  1HC9 A;  2HLR A;  2N99 A;  2MJ0 A;  1LXH A;  2JQP A;  1FF4 A;  3QB4 B;  2QJA C;  4BIK B;  3LAQ U;  4OM4 A;  4LFT A;  3NEQ A;  1MR6 A;  1ABT A;  1NXB A;  2J8B A;  1FSC A;  1ONJ A;  1F94 A;  2X8B B;  1LX5 B;  2BTX A;  4OM5 A;  1FFJ A;  1TGX A;  2BHI A;  5IMT D;  4RUD A;  2CTX A;  1KBA A;  3KFD I;  1XT3 A;  2OFS A;  4IYE A;  1M9Z A;  2HLQ A;  1L4W A;  1ES7 B; 
#chains in the Genus database with same CATH topology
 2GOO C;  1V6P A;  3NDS A;  1LSI A;  1YWH A;  2H62 D;  1ERA A;  1CRE A;  3ERA A;  1CHV S;  1ERG A;  1JGK A;  1REW C;  1NYS A;  1KS6 A;  2VLW A;  2L5S A;  1CB9 A;  1BXP A;  1NYU A;  1VB0 A;  2FD6 U;  1RGJ A;  1IJC A;  1B41 B;  2GOO B;  1TXA A;  1HC9 B;  1KXI A;  2ABX A;  1IKC A;  4KSN A;  4EY8 B;  2H62 C;  2H64 C;  1RL5 A;  1NOR A;  1CDT A;  1KC4 A;  2ERA A;  1CDS A;  3EVS C;  1MAH F;  2MJ4 A;  1KTZ B;  1S4Y A;  1NEA A;  1HOY A;  2MUP A;  1NTX A;  2H8U A;  1IDL A;  1CTX A;  4P7U A;  1IDH A;  2H64 B;  1JE9 A;  5DZ5 A;  1CDQ A;  1UG4 A;  3VTS A;  1KBS A;  3FEV A;  1QKE A;  1BTE A;  2QJ9 C;  1CRF A;  1FRA A;  1NTN A;  2CCX A;  2NBT A;  2L03 A;  2LCR A;  2I9B E;  1CVO A;  4DO8 A;  1TXB A;  2MFA A;  1IK8 A;  2MHY A;  2QJB C;  3EBX A;  1CXO A;  4FAO C;  2LA1 A;  4BDT B;  2CRT A;  4AEA A;  3HH7 A;  1FSS B;  3U73 U;  1W6B A;  1LJZ A;  1JBD A;  1TFS A;  1IDG A;  4HQP F;  4ZQY A;  1HAA A;  3PLC A;  1IQ9 A;  1LXG A;  4XJJ A;  3U74 U;  4FAO E;  5DU1 A;  2K3G A;  2CDX A;  1CXN A;  3KFD E;  1HAJ A;  1FAS A;  1H0J A;  2H7Z A;  1COD A;  2JVE A;  2MJY A;  1KU6 B;  1QKD A;  1KFH A;  1CCQ A;  5DO6 A;  2H5F A;  1COE A;  1F8U B;  2H7Z B;  4QTI U;  1PLO A;  2PJY C;  2QC1 A;  1I02 A;  1ZAD A;  1KL8 A;  2UWR A;  3BT2 U;  1DRS A;  4UY2 C;  5EBX A;  1QM7 A;  3BT1 U;  2UX2 A;  1G6M A;  2MUO A;  1IDI A;  2PJY B;  6EBX A;  1CDR A;  3NH7 A;  5IMY C;  2CRS A;  1KBT A;  1HC9 A;  2HLR A;  2N99 A;  2MJ0 A;  1LXH A;  2JQP A;  1FF4 A;  3QB4 B;  2QJA C;  4BIK B;  3LAQ U;  4OM4 A;  4LFT A;  3NEQ A;  1MR6 A;  1ABT A;  1NXB A;  2J8B A;  1FSC A;  1ONJ A;  1F94 A;  2X8B B;  1LX5 B;  2BTX A;  4OM5 A;  1FFJ A;  1TGX A;  2BHI A;  5IMT D;  4RUD A;  2CTX A;  1KBA A;  3KFD I;  1XT3 A;  2OFS A;  4IYE A;  1M9Z A;  2HLQ A;  1L4W A;  1ES7 B; 
#chains in the Genus database with same CATH homology
 2GOO C;  1V6P A;  3NDS A;  1LSI A;  1YWH A;  2H62 D;  1ERA A;  1CRE A;  3ERA A;  1CHV S;  1ERG A;  1JGK A;  1REW C;  1NYS A;  1KS6 A;  2VLW A;  2L5S A;  1CB9 A;  1BXP A;  1NYU A;  1VB0 A;  2FD6 U;  1RGJ A;  1IJC A;  1B41 B;  2GOO B;  1TXA A;  1HC9 B;  1KXI A;  2ABX A;  1IKC A;  4KSN A;  4EY8 B;  2H62 C;  2H64 C;  1RL5 A;  1NOR A;  1CDT A;  1KC4 A;  2ERA A;  1CDS A;  3EVS C;  1MAH F;  2MJ4 A;  1KTZ B;  1S4Y A;  1NEA A;  1HOY A;  2MUP A;  1NTX A;  2H8U A;  1IDL A;  1CTX A;  4P7U A;  1IDH A;  2H64 B;  1JE9 A;  5DZ5 A;  1CDQ A;  1UG4 A;  3VTS A;  1KBS A;  3FEV A;  1QKE A;  1BTE A;  2QJ9 C;  1CRF A;  1FRA A;  1NTN A;  2CCX A;  2NBT A;  2L03 A;  2LCR A;  2I9B E;  1CVO A;  4DO8 A;  1TXB A;  2MFA A;  1IK8 A;  2MHY A;  2QJB C;  3EBX A;  1CXO A;  4FAO C;  2LA1 A;  4BDT B;  2CRT A;  4AEA A;  3HH7 A;  1FSS B;  3U73 U;  1W6B A;  1LJZ A;  1JBD A;  1TFS A;  1IDG A;  4HQP F;  4ZQY A;  1HAA A;  3PLC A;  1IQ9 A;  1LXG A;  4XJJ A;  3U74 U;  4FAO E;  5DU1 A;  2K3G A;  2CDX A;  1CXN A;  3KFD E;  1HAJ A;  1FAS A;  1H0J A;  2H7Z A;  1COD A;  2JVE A;  2MJY A;  1KU6 B;  1QKD A;  1KFH A;  1CCQ A;  5DO6 A;  2H5F A;  1COE A;  1F8U B;  2H7Z B;  4QTI U;  1PLO A;  2PJY C;  2QC1 A;  1I02 A;  1ZAD A;  1KL8 A;  2UWR A;  3BT2 U;  1DRS A;  4UY2 C;  5EBX A;  1QM7 A;  3BT1 U;  2UX2 A;  1G6M A;  2MUO A;  1IDI A;  2PJY B;  6EBX A;  1CDR A;  3NH7 A;  5IMY C;  2CRS A;  1KBT A;  1HC9 A;  2HLR A;  2N99 A;  2MJ0 A;  1LXH A;  2JQP A;  1FF4 A;  3QB4 B;  2QJA C;  4BIK B;  3LAQ U;  4OM4 A;  4LFT A;  3NEQ A;  1MR6 A;  1ABT A;  1NXB A;  2J8B A;  1FSC A;  1ONJ A;  1F94 A;  2X8B B;  1LX5 B;  2BTX A;  4OM5 A;  1FFJ A;  1TGX A;  2BHI A;  5IMT D;  4RUD A;  2CTX A;  1KBA A;  3KFD I;  1XT3 A;  2OFS A;  4IYE A;  1M9Z A;  2HLQ A;  1L4W A;  1ES7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...