1LJZA

Nmr structure of an achr-peptide (torpedo californica, alpha-subunit residues 182-202) in complex with alpha-bungarotoxin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
74
structure length
74
Chain Sequence
b'IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-Bungarotoxin
publication title The mechanism for acetylcholine receptor inhibition by alpha-neurotoxins and species-specific resistance to alpha-bungarotoxin revealed by NMR.
pubmed doi rcsb
molecule tags Receptor, toxin
total genus 9
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ljzA00
2LA1A 1ZADA 2CDXA 2NBTA 1RL5A 3ERAA 4FAOC 4HQPF 1LSIA 2HLQA 2H64B 1KBAA 2L03A 2VLWA 4OM4A 1ABTA 2CTXA 1VB0A 5IMYC 3HH7A 1REWC 2H7ZA 3FEVA 1FFJA 2MJYA 1HAJA 3LAQU 1LJZA 1IKCA 2CCXA 2H5FA 1CREA 2UX2A 1B41B 4DO8A 2X8BB 3NH7A 2JVEA 1MAHF 2FD6U 4ZQYA 2MJ0A 1FASA 1IQ9A 2ERAA 2JQPA 1LXGA 1ONJA 1MR6A 1BXPA 2QJAC 2BHIA 1DRSA 6EBXA 1TXBA 1NEAA 1TXAA 2H7ZB 1LXHA 4XJJA 1NORA 2H62C 1YWHA 1IDIA 2H62D 5DZ5A 1CDSA 1HAAA 1ERGA 1NTXA 2GOOB 3KFDE 1HC9A 2QJ9C 1M9ZA 2N99A 2MUOA 1FF4A 2J8BA 4RUDA 1KS6A 3KFDI 1XT3A 2PJYB 1KBTA 2K3GA 3U73U 5DU1A 2UWRA 5EBXA 1CXNA 1ERAA 1NYUA 1HOYA 1I02A 2CRSA 1L4WA 1QM7A 1F8UB 1V6PA 1TFSA 3NEQA 2L5SA 1JBDA 1LX5B 1KFHA 2HLRA 2BTXA 2OFSA 1FSCA 2H64C 1COEA 1RGJA 1HC9B 1H0JA 1TGXA 4FAOE 2LCRA 2MUPA 1IJCA 1W6BA 4AEAA 1KC4A 2QJBC 3BT1U 2ABXA 2I9BE 3PLCA 4LFTA 2H8UA 2MHYA 2MJ4A 1CTXA 1FRAA 1FSSB 5IMTD 1CDRA 1QKEA 1F94A 5DO6A 2MFAA 4QTIU 1KL8A 4OM5A 1KTZB 1KXIA 1NYSA 1CXOA 1CODA 3EBXA 1S4YA 1NXBA 3NDSA 1BTEA 2CRTA 1IDGA 1NTNA 1CHVS 3VTSA 1KBSA 3EVSC 1CDQA 4BIKB 2GOOC 1ES7B 1IK8A 1CVOA 1IDLA 1CCQA 1G6MA 4UY2C 4BDTB 3QB4B 1UG4A 1JE9A 3U74U 2PJYC 1KU6B 4EY8B 1PLOA 1CDTA 4P7UA 1CRFA 1CB9A 1JGKA 4IYEA 2QC1A 3BT2U 1IDHA 1QKDA
chains in the Genus database with same CATH superfamily
2LA1A 1ZADA 2CDXA 2NBTA 1RL5A 3ERAA 4FAOC 4HQPF 1LSIA 2HLQA 2H64B 1KBAA 2L03A 2VLWA 4OM4A 1ABTA 2CTXA 1VB0A 5IMYC 3HH7A 1REWC 2H7ZA 3FEVA 1FFJA 2MJYA 1HAJA 3LAQU 1LJZA 1IKCA 2CCXA 2H5FA 1CREA 2UX2A 1B41B 4DO8A 2X8BB 3NH7A 2JVEA 1MAHF 2FD6U 4ZQYA 2MJ0A 1FASA 1IQ9A 2ERAA 2JQPA 1LXGA 1ONJA 1MR6A 1BXPA 2QJAC 2BHIA 1DRSA 6EBXA 1TXBA 1NEAA 1TXAA 2H7ZB 1LXHA 4XJJA 1NORA 2H62C 1YWHA 1IDIA 2H62D 5DZ5A 4KSNA 1CDSA 1HAAA 1ERGA 1NTXA 2GOOB 3KFDE 1HC9A 2QJ9C 1M9ZA 2N99A 2MUOA 1FF4A 2J8BA 4RUDA 1KS6A 3KFDI 1XT3A 2PJYB 1KBTA 2K3GA 3U73U 5DU1A 2UWRA 5EBXA 1CXNA 1ERAA 1NYUA 1HOYA 1I02A 2CRSA 1L4WA 1QM7A 1F8UB 1V6PA 1TFSA 3NEQA 2L5SA 1JBDA 1LX5B 1KFHA 2HLRA 2BTXA 2OFSA 1FSCA 2H64C 1COEA 1RGJA 1HC9B 1H0JA 1TGXA 4FAOE 2LCRA 2MUPA 1IJCA 1W6BA 4AEAA 1KC4A 2QJBC 3BT1U 2ABXA 2I9BE 3PLCA 4LFTA 2H8UA 2MHYA 2MJ4A 1CTXA 1FRAA 1FSSB 5IMTD 1CDRA 1QKEA 1F94A 5DO6A 2MFAA 4QTIU 1KL8A 4OM5A 1KTZB 1KXIA 1NYSA 1CXOA 1CODA 3EBXA 1S4YA 1NXBA 3NDSA 1BTEA 2CRTA 1IDGA 1NTNA 1CHVS 3VTSA 1KBSA 3EVSC 1CDQA 4BIKB 2GOOC 1ES7B 1IK8A 1CVOA 1IDLA 1CCQA 1G6MA 4UY2C 4BDTB 3QB4B 1UG4A 1JE9A 3U74U 2PJYC 1KU6B 4EY8B 1PLOA 1CDTA 4P7UA 1CRFA 1CB9A 1JGKA 4IYEA 2QC1A 3BT2U 1IDHA 1QKDA
chains in the Genus database with same CATH topology
2LA1A 1ZADA 2CDXA 2NBTA 1RL5A 3ERAA 4FAOC 4HQPF 1LSIA 2HLQA 2H64B 1KBAA 2L03A 2VLWA 4OM4A 1ABTA 2CTXA 1VB0A 5IMYC 3HH7A 1REWC 2H7ZA 3FEVA 1FFJA 2MJYA 1HAJA 3LAQU 1LJZA 1IKCA 2CCXA 2H5FA 1CREA 2UX2A 1B41B 4DO8A 2X8BB 3NH7A 2JVEA 1MAHF 2FD6U 4ZQYA 2MJ0A 1FASA 1IQ9A 2ERAA 2JQPA 1LXGA 1ONJA 1MR6A 1BXPA 2QJAC 2BHIA 1DRSA 6EBXA 1TXBA 1NEAA 1TXAA 2H7ZB 1LXHA 4XJJA 1NORA 2H62C 1YWHA 1IDIA 2H62D 5DZ5A 4KSNA 1CDSA 1HAAA 1ERGA 1NTXA 2GOOB 3KFDE 1HC9A 2QJ9C 1M9ZA 2N99A 2MUOA 1FF4A 2J8BA 4RUDA 1KS6A 3KFDI 1XT3A 2PJYB 1KBTA 2K3GA 3U73U 5DU1A 2UWRA 5EBXA 1CXNA 1ERAA 1NYUA 1HOYA 1I02A 2CRSA 1L4WA 1QM7A 1F8UB 1V6PA 1TFSA 3NEQA 2L5SA 1JBDA 1LX5B 1KFHA 2HLRA 2BTXA 2OFSA 1FSCA 2H64C 1COEA 1RGJA 1HC9B 1H0JA 1TGXA 4FAOE 2LCRA 2MUPA 1IJCA 1W6BA 4AEAA 1KC4A 2QJBC 3BT1U 2ABXA 2I9BE 3PLCA 4LFTA 2H8UA 2MHYA 2MJ4A 1CTXA 1FRAA 1FSSB 5IMTD 1CDRA 1QKEA 1F94A 5DO6A 2MFAA 4QTIU 1KL8A 4OM5A 1KTZB 1KXIA 1NYSA 1CXOA 1CODA 3EBXA 1S4YA 1NXBA 3NDSA 1BTEA 2CRTA 1IDGA 1NTNA 1CHVS 3VTSA 1KBSA 3EVSC 1CDQA 4BIKB 2GOOC 1ES7B 1IK8A 1CVOA 1IDLA 1CCQA 1G6MA 4UY2C 4BDTB 3QB4B 1UG4A 1JE9A 3U74U 2PJYC 1KU6B 4EY8B 1PLOA 1CDTA 4P7UA 1CRFA 1CB9A 1JGKA 4IYEA 2QC1A 3BT2U 1IDHA 1QKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LA1 A;  1ZAD A;  2CDX A;  2NBT A;  1RL5 A;  3ERA A;  4FAO C;  4HQP F;  1LSI A;  2HLQ A;  2H64 B;  1KBA A;  2L03 A;  2VLW A;  4OM4 A;  1ABT A;  2CTX A;  1VB0 A;  5IMY C;  3HH7 A;  1REW C;  2H7Z A;  3FEV A;  1FFJ A;  2MJY A;  1HAJ A;  3LAQ U;  1LJZ A;  1IKC A;  2CCX A;  2H5F A;  1CRE A;  2UX2 A;  1B41 B;  4DO8 A;  2X8B B;  3NH7 A;  2JVE A;  1MAH F;  2FD6 U;  4ZQY A;  2MJ0 A;  1FAS A;  1IQ9 A;  2ERA A;  2JQP A;  1LXG A;  1ONJ A;  1MR6 A;  1BXP A;  2QJA C;  2BHI A;  1DRS A;  6EBX A;  1TXB A;  1NEA A;  1TXA A;  2H7Z B;  1LXH A;  4XJJ A;  1NOR A;  2H62 C;  1YWH A;  1IDI A;  2H62 D;  5DZ5 A;  1CDS A;  1HAA A;  1ERG A;  1NTX A;  2GOO B;  3KFD E;  1HC9 A;  2QJ9 C;  1M9Z A;  2N99 A;  2MUO A;  1FF4 A;  2J8B A;  4RUD A;  1KS6 A;  3KFD I;  1XT3 A;  2PJY B;  1KBT A;  2K3G A;  3U73 U;  5DU1 A;  2UWR A;  5EBX A;  1CXN A;  1ERA A;  1NYU A;  1HOY A;  1I02 A;  2CRS A;  1L4W A;  1QM7 A;  1F8U B;  1V6P A;  1TFS A;  3NEQ A;  2L5S A;  1JBD A;  1LX5 B;  1KFH A;  2HLR A;  2BTX A;  2OFS A;  1FSC A;  2H64 C;  1COE A;  1RGJ A;  1HC9 B;  1H0J A;  1TGX A;  4FAO E;  2LCR A;  2MUP A;  1IJC A;  1W6B A;  4AEA A;  1KC4 A;  2QJB C;  3BT1 U;  2ABX A;  2I9B E;  3PLC A;  4LFT A;  2H8U A;  2MHY A;  2MJ4 A;  1CTX A;  1FRA A;  1FSS B;  5IMT D;  1CDR A;  1QKE A;  1F94 A;  5DO6 A;  2MFA A;  4QTI U;  1KL8 A;  4OM5 A;  1KTZ B;  1KXI A;  1NYS A;  1CXO A;  1COD A;  3EBX A;  1S4Y A;  1NXB A;  3NDS A;  1BTE A;  2CRT A;  1IDG A;  1NTN A;  1CHV S;  3VTS A;  1KBS A;  3EVS C;  1CDQ A;  4BIK B;  2GOO C;  1ES7 B;  1IK8 A;  1CVO A;  1IDL A;  1CCQ A;  1G6M A;  4UY2 C;  4BDT B;  3QB4 B;  1UG4 A;  1JE9 A;  3U74 U;  2PJY C;  1KU6 B;  4EY8 B;  1PLO A;  1CDT A;  4P7U A;  1CRF A;  1CB9 A;  1JGK A;  4IYE A;  2QC1 A;  3BT2 U;  1IDH A;  1QKD A; 
#chains in the Genus database with same CATH topology
 2LA1 A;  1ZAD A;  2CDX A;  2NBT A;  1RL5 A;  3ERA A;  4FAO C;  4HQP F;  1LSI A;  2HLQ A;  2H64 B;  1KBA A;  2L03 A;  2VLW A;  4OM4 A;  1ABT A;  2CTX A;  1VB0 A;  5IMY C;  3HH7 A;  1REW C;  2H7Z A;  3FEV A;  1FFJ A;  2MJY A;  1HAJ A;  3LAQ U;  1LJZ A;  1IKC A;  2CCX A;  2H5F A;  1CRE A;  2UX2 A;  1B41 B;  4DO8 A;  2X8B B;  3NH7 A;  2JVE A;  1MAH F;  2FD6 U;  4ZQY A;  2MJ0 A;  1FAS A;  1IQ9 A;  2ERA A;  2JQP A;  1LXG A;  1ONJ A;  1MR6 A;  1BXP A;  2QJA C;  2BHI A;  1DRS A;  6EBX A;  1TXB A;  1NEA A;  1TXA A;  2H7Z B;  1LXH A;  4XJJ A;  1NOR A;  2H62 C;  1YWH A;  1IDI A;  2H62 D;  5DZ5 A;  4KSN A;  1CDS A;  1HAA A;  1ERG A;  1NTX A;  2GOO B;  3KFD E;  1HC9 A;  2QJ9 C;  1M9Z A;  2N99 A;  2MUO A;  1FF4 A;  2J8B A;  4RUD A;  1KS6 A;  3KFD I;  1XT3 A;  2PJY B;  1KBT A;  2K3G A;  3U73 U;  5DU1 A;  2UWR A;  5EBX A;  1CXN A;  1ERA A;  1NYU A;  1HOY A;  1I02 A;  2CRS A;  1L4W A;  1QM7 A;  1F8U B;  1V6P A;  1TFS A;  3NEQ A;  2L5S A;  1JBD A;  1LX5 B;  1KFH A;  2HLR A;  2BTX A;  2OFS A;  1FSC A;  2H64 C;  1COE A;  1RGJ A;  1HC9 B;  1H0J A;  1TGX A;  4FAO E;  2LCR A;  2MUP A;  1IJC A;  1W6B A;  4AEA A;  1KC4 A;  2QJB C;  3BT1 U;  2ABX A;  2I9B E;  3PLC A;  4LFT A;  2H8U A;  2MHY A;  2MJ4 A;  1CTX A;  1FRA A;  1FSS B;  5IMT D;  1CDR A;  1QKE A;  1F94 A;  5DO6 A;  2MFA A;  4QTI U;  1KL8 A;  4OM5 A;  1KTZ B;  1KXI A;  1NYS A;  1CXO A;  1COD A;  3EBX A;  1S4Y A;  1NXB A;  3NDS A;  1BTE A;  2CRT A;  1IDG A;  1NTN A;  1CHV S;  3VTS A;  1KBS A;  3EVS C;  1CDQ A;  4BIK B;  2GOO C;  1ES7 B;  1IK8 A;  1CVO A;  1IDL A;  1CCQ A;  1G6M A;  4UY2 C;  4BDT B;  3QB4 B;  1UG4 A;  1JE9 A;  3U74 U;  2PJY C;  1KU6 B;  4EY8 B;  1PLO A;  1CDT A;  4P7U A;  1CRF A;  1CB9 A;  1JGK A;  4IYE A;  2QC1 A;  3BT2 U;  1IDH A;  1QKD A; 
#chains in the Genus database with same CATH homology
 2LA1 A;  1ZAD A;  2CDX A;  2NBT A;  1RL5 A;  3ERA A;  4FAO C;  4HQP F;  1LSI A;  2HLQ A;  2H64 B;  1KBA A;  2L03 A;  2VLW A;  4OM4 A;  1ABT A;  2CTX A;  1VB0 A;  5IMY C;  3HH7 A;  1REW C;  2H7Z A;  3FEV A;  1FFJ A;  2MJY A;  1HAJ A;  3LAQ U;  1LJZ A;  1IKC A;  2CCX A;  2H5F A;  1CRE A;  2UX2 A;  1B41 B;  4DO8 A;  2X8B B;  3NH7 A;  2JVE A;  1MAH F;  2FD6 U;  4ZQY A;  2MJ0 A;  1FAS A;  1IQ9 A;  2ERA A;  2JQP A;  1LXG A;  1ONJ A;  1MR6 A;  1BXP A;  2QJA C;  2BHI A;  1DRS A;  6EBX A;  1TXB A;  1NEA A;  1TXA A;  2H7Z B;  1LXH A;  4XJJ A;  1NOR A;  2H62 C;  1YWH A;  1IDI A;  2H62 D;  5DZ5 A;  4KSN A;  1CDS A;  1HAA A;  1ERG A;  1NTX A;  2GOO B;  3KFD E;  1HC9 A;  2QJ9 C;  1M9Z A;  2N99 A;  2MUO A;  1FF4 A;  2J8B A;  4RUD A;  1KS6 A;  3KFD I;  1XT3 A;  2PJY B;  1KBT A;  2K3G A;  3U73 U;  5DU1 A;  2UWR A;  5EBX A;  1CXN A;  1ERA A;  1NYU A;  1HOY A;  1I02 A;  2CRS A;  1L4W A;  1QM7 A;  1F8U B;  1V6P A;  1TFS A;  3NEQ A;  2L5S A;  1JBD A;  1LX5 B;  1KFH A;  2HLR A;  2BTX A;  2OFS A;  1FSC A;  2H64 C;  1COE A;  1RGJ A;  1HC9 B;  1H0J A;  1TGX A;  4FAO E;  2LCR A;  2MUP A;  1IJC A;  1W6B A;  4AEA A;  1KC4 A;  2QJB C;  3BT1 U;  2ABX A;  2I9B E;  3PLC A;  4LFT A;  2H8U A;  2MHY A;  2MJ4 A;  1CTX A;  1FRA A;  1FSS B;  5IMT D;  1CDR A;  1QKE A;  1F94 A;  5DO6 A;  2MFA A;  4QTI U;  1KL8 A;  4OM5 A;  1KTZ B;  1KXI A;  1NYS A;  1CXO A;  1COD A;  3EBX A;  1S4Y A;  1NXB A;  3NDS A;  1BTE A;  2CRT A;  1IDG A;  1NTN A;  1CHV S;  3VTS A;  1KBS A;  3EVS C;  1CDQ A;  4BIK B;  2GOO C;  1ES7 B;  1IK8 A;  1CVO A;  1IDL A;  1CCQ A;  1G6M A;  4UY2 C;  4BDT B;  3QB4 B;  1UG4 A;  1JE9 A;  3U74 U;  2PJY C;  1KU6 B;  4EY8 B;  1PLO A;  1CDT A;  4P7U A;  1CRF A;  1CB9 A;  1JGK A;  4IYE A;  2QC1 A;  3BT2 U;  1IDH A;  1QKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...