3PLCA

Crystal structure of beta-cardiotoxin, a novel three-finger cardiotoxin from the venom of ophiophagus hannah
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
54
Chain Sequence
RKCLNTPLPLIYTTCPIGQDKCVKMTDVIRGCIDICPKSSADVEVLCCDTNKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Beta-cardiotoxin OH-27
publication title Crystal structure of Beta-Cardiotoxin, a novel three-finger cardiotoxin from the venom of Ophiophagus hannah
rcsb
total genus 8
structure length 54
sequence length 62
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3plcA00
2H7ZA 1CXNA 2I9BE 3BT1U 1KFHA 1BTEA 1IDIA 2L5SA 1ERGA 1KBTA 4AEAA 1IK8A 1LX5B 2K3GA 2MJYA 1CDTA 1ZADA 1ONJA 1I02A 1IDLA 4P7UA 4BDTB 1ES7B 2GOOB 1FRAA 2MHYA 1KS6A 2JVEA 1CREA 2GOOC 1HC9A 2CDXA 2UWRA 2H62C 5EBXA 1F94A 2H7ZB 1REWC 5IMYC 2BHIA 1TXAA 3NH7A 1UG4A 1NEAA 2H62D 1CDSA 3NEQA 3U73U 2CCXA 2LCRA 5DO6A 1KTZB 1BXPA 1LXGA 4RUDA 1LSIA 1NYSA 1HOYA 2HLRA 2UX2A 1F8UB 1MAHF 2MFAA 1NXBA 3EBXA 1CHVS 4HQPF 1QKEA 1CDQA 3NDSA 3ERAA 2QJBC 4IYEA 3EVSC 1HC9B 1LJZA 1TFSA 2J8BA 1MR6A 4FAOC 1KU6B 4XJJA 1TXBA 1KL8A 1PLOA 2QC1A 2ABXA 1IDHA 1ABTA 1IKCA 1RGJA 1JGKA 2VLWA 2LA1A 2PJYB 1JBDA 2MJ0A 2QJ9C 2PJYC 2QJAC 1KXIA 3VTSA 2JQPA 4DO8A 2H8UA 3PLCA 4BIKB 4EY8B 1FSCA 1QM7A 1W6BA 2HLQA 1M9ZA 3HH7A 1CDRA 2H64B 2ERAA 1CTXA 4QTIU 2MUOA 1G6MA 3U74U 1CODA 2L03A 1V6PA 2H64C 2MJ4A 1NTXA 2OFSA 2H5FA 1JE9A 1COEA 4ZQYA 3KFDE 1FASA 1DRSA 6EBXA 2N99A 4OM5A 3QB4B 1LXHA 2X8BB 1KC4A 1H0JA 2BTXA 2NBTA 4LFTA 1YWHA 1CRFA 1B41B 1XT3A 1ERAA 1VB0A 2FD6U 1TGXA 5DU1A 2CRTA 1RL5A 1IDGA 2MUPA 1KBSA 3FEVA 1FF4A 1NYUA 3LAQU 1FFJA 1HAJA 1IJCA 1HAAA 1CCQA 1CB9A 4OM4A 1KBAA 1NORA 2CRSA 1CXOA 1NTNA 1FSSB 3KFDI 4FAOE 4UY2C 1QKDA 1L4WA 2CTXA 1CVOA 5DZ5A 5IMTD 3BT2U 1S4YA 1IQ9A
chains in the Genus database with same CATH superfamily
2H7ZA 1CXNA 2I9BE 3BT1U 1KFHA 1BTEA 1IDIA 2L5SA 1ERGA 1KBTA 4AEAA 1IK8A 1LX5B 2K3GA 2MJYA 1CDTA 1ZADA 1ONJA 1I02A 1IDLA 4P7UA 4BDTB 1ES7B 2GOOB 1FRAA 2MHYA 1KS6A 2JVEA 1CREA 2GOOC 1HC9A 2CDXA 2UWRA 2H62C 5EBXA 1F94A 2H7ZB 1REWC 5IMYC 2BHIA 1TXAA 3NH7A 1UG4A 1NEAA 2H62D 1CDSA 3NEQA 3U73U 2CCXA 2LCRA 5DO6A 1KTZB 1BXPA 1LXGA 4RUDA 1LSIA 1NYSA 1HOYA 2HLRA 2UX2A 1F8UB 1MAHF 2MFAA 1NXBA 3EBXA 1CHVS 4HQPF 1QKEA 1CDQA 3NDSA 3ERAA 2QJBC 4IYEA 3EVSC 1HC9B 1LJZA 1TFSA 2J8BA 1MR6A 4FAOC 1KU6B 4XJJA 1TXBA 1KL8A 1PLOA 2QC1A 2ABXA 1IDHA 1ABTA 1IKCA 1RGJA 1JGKA 2VLWA 2LA1A 2PJYB 1JBDA 2MJ0A 2QJ9C 2PJYC 2QJAC 1KXIA 3VTSA 2JQPA 4DO8A 2H8UA 3PLCA 4BIKB 4EY8B 1FSCA 1QM7A 1W6BA 2HLQA 1M9ZA 3HH7A 1CDRA 2H64B 2ERAA 1CTXA 4QTIU 2MUOA 1G6MA 3U74U 1CODA 2L03A 1V6PA 2H64C 2MJ4A 1NTXA 2OFSA 2H5FA 1JE9A 1COEA 4ZQYA 3KFDE 1FASA 1DRSA 6EBXA 2N99A 4OM5A 3QB4B 1LXHA 2X8BB 1KC4A 1H0JA 2BTXA 2NBTA 4LFTA 1YWHA 1CRFA 1B41B 1XT3A 1ERAA 1VB0A 2FD6U 1TGXA 5DU1A 2CRTA 1RL5A 1IDGA 2MUPA 1KBSA 3FEVA 1FF4A 1NYUA 3LAQU 1FFJA 1HAJA 1IJCA 1HAAA 1CCQA 1CB9A 4OM4A 1KBAA 1NORA 2CRSA 1CXOA 1NTNA 1FSSB 3KFDI 4FAOE 4UY2C 1QKDA 1L4WA 2CTXA 4KSNA 5DZ5A 5IMTD 1CVOA 3BT2U 1S4YA 1IQ9A
chains in the Genus database with same CATH topology
2H7ZA 1CXNA 2I9BE 3BT1U 1KFHA 1BTEA 1IDIA 2L5SA 1ERGA 1KBTA 4AEAA 1IK8A 1LX5B 2K3GA 2MJYA 1CDTA 1ZADA 1ONJA 1I02A 1IDLA 4P7UA 4BDTB 1ES7B 2GOOB 1FRAA 2MHYA 1KS6A 2JVEA 1CREA 2GOOC 1HC9A 2CDXA 2UWRA 2H62C 5EBXA 1F94A 2H7ZB 1REWC 5IMYC 2BHIA 1TXAA 3NH7A 1UG4A 1NEAA 2H62D 1CDSA 3NEQA 3U73U 2CCXA 2LCRA 5DO6A 1KTZB 1BXPA 1LXGA 4RUDA 1LSIA 1NYSA 1HOYA 2HLRA 2UX2A 1F8UB 1MAHF 2MFAA 1NXBA 3EBXA 1CHVS 4HQPF 1QKEA 1CDQA 3NDSA 3ERAA 2QJBC 4IYEA 3EVSC 1HC9B 1LJZA 1TFSA 2J8BA 1MR6A 4FAOC 1KU6B 4XJJA 1TXBA 1KL8A 1PLOA 2QC1A 2ABXA 1IDHA 1ABTA 1IKCA 1RGJA 1JGKA 2VLWA 2LA1A 2PJYB 1JBDA 2MJ0A 2QJ9C 2PJYC 2QJAC 1KXIA 3VTSA 2JQPA 4DO8A 2H8UA 3PLCA 4BIKB 4EY8B 1FSCA 1QM7A 1W6BA 2HLQA 1M9ZA 3HH7A 1CDRA 2H64B 2ERAA 1CTXA 4QTIU 2MUOA 1G6MA 3U74U 1CODA 2L03A 1V6PA 2H64C 2MJ4A 1NTXA 2OFSA 2H5FA 1JE9A 1COEA 4ZQYA 3KFDE 1FASA 1DRSA 6EBXA 2N99A 4OM5A 3QB4B 1LXHA 2X8BB 1KC4A 1H0JA 2BTXA 2NBTA 4LFTA 1YWHA 1CRFA 1B41B 1XT3A 1ERAA 1VB0A 2FD6U 1TGXA 5DU1A 2CRTA 1RL5A 1IDGA 2MUPA 1KBSA 3FEVA 1FF4A 1NYUA 3LAQU 1FFJA 1HAJA 1IJCA 1HAAA 1CCQA 1CB9A 4OM4A 1KBAA 1NORA 2CRSA 1CXOA 1NTNA 1FSSB 3KFDI 4FAOE 4UY2C 1QKDA 1L4WA 2CTXA 4KSNA 5DZ5A 5IMTD 1CVOA 3BT2U 1S4YA 1IQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H7Z A;  1CXN A;  2I9B E;  3BT1 U;  1KFH A;  1BTE A;  1IDI A;  2L5S A;  1ERG A;  1KBT A;  4AEA A;  1IK8 A;  1LX5 B;  2K3G A;  2MJY A;  1CDT A;  1ZAD A;  1ONJ A;  1I02 A;  1IDL A;  4P7U A;  4BDT B;  1ES7 B;  2GOO B;  1FRA A;  2MHY A;  1KS6 A;  2JVE A;  1CRE A;  2GOO C;  1HC9 A;  2CDX A;  2UWR A;  2H62 C;  5EBX A;  1F94 A;  2H7Z B;  1REW C;  5IMY C;  2BHI A;  1TXA A;  3NH7 A;  1UG4 A;  1NEA A;  2H62 D;  1CDS A;  3NEQ A;  3U73 U;  2CCX A;  2LCR A;  5DO6 A;  1KTZ B;  1BXP A;  1LXG A;  4RUD A;  1LSI A;  1NYS A;  1HOY A;  2HLR A;  2UX2 A;  1F8U B;  1MAH F;  2MFA A;  1NXB A;  3EBX A;  1CHV S;  4HQP F;  1QKE A;  1CDQ A;  3NDS A;  3ERA A;  2QJB C;  4IYE A;  3EVS C;  1HC9 B;  1LJZ A;  1TFS A;  2J8B A;  1MR6 A;  4FAO C;  1KU6 B;  4XJJ A;  1TXB A;  1KL8 A;  1PLO A;  2QC1 A;  2ABX A;  1IDH A;  1ABT A;  1IKC A;  1RGJ A;  1JGK A;  2VLW A;  2LA1 A;  2PJY B;  1JBD A;  2MJ0 A;  2QJ9 C;  2PJY C;  2QJA C;  1KXI A;  3VTS A;  2JQP A;  4DO8 A;  2H8U A;  3PLC A;  4BIK B;  4EY8 B;  1FSC A;  1QM7 A;  1W6B A;  2HLQ A;  1M9Z A;  3HH7 A;  1CDR A;  2H64 B;  2ERA A;  1CTX A;  4QTI U;  2MUO A;  1G6M A;  3U74 U;  1COD A;  2L03 A;  1V6P A;  2H64 C;  2MJ4 A;  1NTX A;  2OFS A;  2H5F A;  1JE9 A;  1COE A;  4ZQY A;  3KFD E;  1FAS A;  1DRS A;  6EBX A;  2N99 A;  4OM5 A;  3QB4 B;  1LXH A;  2X8B B;  1KC4 A;  1H0J A;  2BTX A;  2NBT A;  4LFT A;  1YWH A;  1CRF A;  1B41 B;  1XT3 A;  1ERA A;  1VB0 A;  2FD6 U;  1TGX A;  5DU1 A;  2CRT A;  1RL5 A;  1IDG A;  2MUP A;  1KBS A;  3FEV A;  1FF4 A;  1NYU A;  3LAQ U;  1FFJ A;  1HAJ A;  1IJC A;  1HAA A;  1CCQ A;  1CB9 A;  4OM4 A;  1KBA A;  1NOR A;  2CRS A;  1CXO A;  1NTN A;  1FSS B;  3KFD I;  4FAO E;  4UY2 C;  1QKD A;  1L4W A;  2CTX A;  1CVO A;  5DZ5 A;  5IMT D;  3BT2 U;  1S4Y A;  1IQ9 A; 
#chains in the Genus database with same CATH topology
 2H7Z A;  1CXN A;  2I9B E;  3BT1 U;  1KFH A;  1BTE A;  1IDI A;  2L5S A;  1ERG A;  1KBT A;  4AEA A;  1IK8 A;  1LX5 B;  2K3G A;  2MJY A;  1CDT A;  1ZAD A;  1ONJ A;  1I02 A;  1IDL A;  4P7U A;  4BDT B;  1ES7 B;  2GOO B;  1FRA A;  2MHY A;  1KS6 A;  2JVE A;  1CRE A;  2GOO C;  1HC9 A;  2CDX A;  2UWR A;  2H62 C;  5EBX A;  1F94 A;  2H7Z B;  1REW C;  5IMY C;  2BHI A;  1TXA A;  3NH7 A;  1UG4 A;  1NEA A;  2H62 D;  1CDS A;  3NEQ A;  3U73 U;  2CCX A;  2LCR A;  5DO6 A;  1KTZ B;  1BXP A;  1LXG A;  4RUD A;  1LSI A;  1NYS A;  1HOY A;  2HLR A;  2UX2 A;  1F8U B;  1MAH F;  2MFA A;  1NXB A;  3EBX A;  1CHV S;  4HQP F;  1QKE A;  1CDQ A;  3NDS A;  3ERA A;  2QJB C;  4IYE A;  3EVS C;  1HC9 B;  1LJZ A;  1TFS A;  2J8B A;  1MR6 A;  4FAO C;  1KU6 B;  4XJJ A;  1TXB A;  1KL8 A;  1PLO A;  2QC1 A;  2ABX A;  1IDH A;  1ABT A;  1IKC A;  1RGJ A;  1JGK A;  2VLW A;  2LA1 A;  2PJY B;  1JBD A;  2MJ0 A;  2QJ9 C;  2PJY C;  2QJA C;  1KXI A;  3VTS A;  2JQP A;  4DO8 A;  2H8U A;  3PLC A;  4BIK B;  4EY8 B;  1FSC A;  1QM7 A;  1W6B A;  2HLQ A;  1M9Z A;  3HH7 A;  1CDR A;  2H64 B;  2ERA A;  1CTX A;  4QTI U;  2MUO A;  1G6M A;  3U74 U;  1COD A;  2L03 A;  1V6P A;  2H64 C;  2MJ4 A;  1NTX A;  2OFS A;  2H5F A;  1JE9 A;  1COE A;  4ZQY A;  3KFD E;  1FAS A;  1DRS A;  6EBX A;  2N99 A;  4OM5 A;  3QB4 B;  1LXH A;  2X8B B;  1KC4 A;  1H0J A;  2BTX A;  2NBT A;  4LFT A;  1YWH A;  1CRF A;  1B41 B;  1XT3 A;  1ERA A;  1VB0 A;  2FD6 U;  1TGX A;  5DU1 A;  2CRT A;  1RL5 A;  1IDG A;  2MUP A;  1KBS A;  3FEV A;  1FF4 A;  1NYU A;  3LAQ U;  1FFJ A;  1HAJ A;  1IJC A;  1HAA A;  1CCQ A;  1CB9 A;  4OM4 A;  1KBA A;  1NOR A;  2CRS A;  1CXO A;  1NTN A;  1FSS B;  3KFD I;  4FAO E;  4UY2 C;  1QKD A;  1L4W A;  2CTX A;  4KSN A;  5DZ5 A;  5IMT D;  1CVO A;  3BT2 U;  1S4Y A;  1IQ9 A; 
#chains in the Genus database with same CATH homology
 2H7Z A;  1CXN A;  2I9B E;  3BT1 U;  1KFH A;  1BTE A;  1IDI A;  2L5S A;  1ERG A;  1KBT A;  4AEA A;  1IK8 A;  1LX5 B;  2K3G A;  2MJY A;  1CDT A;  1ZAD A;  1ONJ A;  1I02 A;  1IDL A;  4P7U A;  4BDT B;  1ES7 B;  2GOO B;  1FRA A;  2MHY A;  1KS6 A;  2JVE A;  1CRE A;  2GOO C;  1HC9 A;  2CDX A;  2UWR A;  2H62 C;  5EBX A;  1F94 A;  2H7Z B;  1REW C;  5IMY C;  2BHI A;  1TXA A;  3NH7 A;  1UG4 A;  1NEA A;  2H62 D;  1CDS A;  3NEQ A;  3U73 U;  2CCX A;  2LCR A;  5DO6 A;  1KTZ B;  1BXP A;  1LXG A;  4RUD A;  1LSI A;  1NYS A;  1HOY A;  2HLR A;  2UX2 A;  1F8U B;  1MAH F;  2MFA A;  1NXB A;  3EBX A;  1CHV S;  4HQP F;  1QKE A;  1CDQ A;  3NDS A;  3ERA A;  2QJB C;  4IYE A;  3EVS C;  1HC9 B;  1LJZ A;  1TFS A;  2J8B A;  1MR6 A;  4FAO C;  1KU6 B;  4XJJ A;  1TXB A;  1KL8 A;  1PLO A;  2QC1 A;  2ABX A;  1IDH A;  1ABT A;  1IKC A;  1RGJ A;  1JGK A;  2VLW A;  2LA1 A;  2PJY B;  1JBD A;  2MJ0 A;  2QJ9 C;  2PJY C;  2QJA C;  1KXI A;  3VTS A;  2JQP A;  4DO8 A;  2H8U A;  3PLC A;  4BIK B;  4EY8 B;  1FSC A;  1QM7 A;  1W6B A;  2HLQ A;  1M9Z A;  3HH7 A;  1CDR A;  2H64 B;  2ERA A;  1CTX A;  4QTI U;  2MUO A;  1G6M A;  3U74 U;  1COD A;  2L03 A;  1V6P A;  2H64 C;  2MJ4 A;  1NTX A;  2OFS A;  2H5F A;  1JE9 A;  1COE A;  4ZQY A;  3KFD E;  1FAS A;  1DRS A;  6EBX A;  2N99 A;  4OM5 A;  3QB4 B;  1LXH A;  2X8B B;  1KC4 A;  1H0J A;  2BTX A;  2NBT A;  4LFT A;  1YWH A;  1CRF A;  1B41 B;  1XT3 A;  1ERA A;  1VB0 A;  2FD6 U;  1TGX A;  5DU1 A;  2CRT A;  1RL5 A;  1IDG A;  2MUP A;  1KBS A;  3FEV A;  1FF4 A;  1NYU A;  3LAQ U;  1FFJ A;  1HAJ A;  1IJC A;  1HAA A;  1CCQ A;  1CB9 A;  4OM4 A;  1KBA A;  1NOR A;  2CRS A;  1CXO A;  1NTN A;  1FSS B;  3KFD I;  4FAO E;  4UY2 C;  1QKD A;  1L4W A;  2CTX A;  4KSN A;  5DZ5 A;  5IMT D;  1CVO A;  3BT2 U;  1S4Y A;  1IQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...