1ABTA

Nmr solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
74
structure length
74
Chain Sequence
b'IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-BUNGAROTOXIN
publication title NMR solution structure of an alpha-bungarotoxin/nicotinic receptor peptide complex.
pubmed doi rcsb
molecule tags Toxin
total genus 9
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1993-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1abtA00
1MAHF 4DO8A 2FD6U 1FF4A 1LX5B 1JE9A 4ZQYA 1TFSA 1RGJA 4AEAA 2MUPA 2ERAA 1CRFA 2I9BE 1ERGA 5IMTD 1RL5A 2MJYA 2JQPA 2MJ4A 1W6BA 1ES7B 2UWRA 2VLWA 2X8BB 1ABTA 1KBTA 1DRSA 2H7ZA 1CTXA 1KBAA 1IK8A 3QB4B 5IMYC 1BXPA 1S4YA 5DZ5A 1COEA 1CXNA 2N99A 2QJAC 2BHIA 3ERAA 1ZADA 3FEVA 4BIKB 2QJ9C 1HC9B 1KU6B 1YWHA 1IDLA 1ERAA 2H62D 1M9ZA 1LXHA 1NORA 1IKCA 1B41B 4OM5A 2ABXA 1TXBA 1FFJA 2MFAA 1NTNA 6EBXA 1LJZA 2HLRA 2MHYA 4FAOE 2CTXA 1G6MA 1CHVS 5DO6A 2OFSA 1LSIA 4EY8B 1JGKA 1IDGA 1KC4A 2LA1A 3NEQA 1F94A 4LFTA 3HH7A 1CXOA 1V6PA 2NBTA 4UY2C 3PLCA 2GOOB 1HOYA 1I02A 1CDTA 4IYEA 1KS6A 3NH7A 1NXBA 4HQPF 1IDIA 1REWC 1H0JA 2PJYB 2QJBC 3LAQU 1CREA 1F8UB 1FSSB 2L5SA 2H62C 2HLQA 3EVSC 1IDHA 1NTXA 2H8UA 2H64C 1LXGA 1HAAA 1KTZB 1HAJA 1NYSA 3U74U 2H64B 2CRSA 1NEAA 2H7ZB 1CVOA 1QKEA 2MUOA 4XJJA 4P7UA 2CCXA 2CDXA 1CDSA 1QKDA 2UX2A 1KFHA 1L4WA 3EBXA 1JBDA 2GOOC 4BDTB 2QC1A 3BT1U 2J8BA 1FASA 2PJYC 2BTXA 3NDSA 1FRAA 3VTSA 1NYUA 1MR6A 2MJ0A 3U73U 1PLOA 1XT3A 1CCQA 5EBXA 1KBSA 1BTEA 2L03A 2JVEA 1HC9A 3BT2U 4OM4A 1TGXA 1UG4A 1CDRA 1CB9A 4RUDA 1CDQA 3KFDE 2LCRA 3KFDI 2CRTA 1CODA 5DU1A 4FAOC 1FSCA 1TXAA 1QM7A 1KXIA 1KL8A 2H5FA 1ONJA 1IQ9A 2K3GA 1VB0A 4QTIU 1IJCA
chains in the Genus database with same CATH superfamily
1MAHF 4KSNA 4DO8A 2FD6U 1FF4A 1LX5B 1JE9A 4ZQYA 1TFSA 1RGJA 4AEAA 2MUPA 2ERAA 1CRFA 2I9BE 1ERGA 5IMTD 1RL5A 2MJYA 2JQPA 2MJ4A 1W6BA 1ES7B 2UWRA 2VLWA 2X8BB 1ABTA 1KBTA 1DRSA 2H7ZA 1CTXA 1KBAA 1IK8A 3QB4B 5IMYC 1BXPA 1S4YA 5DZ5A 1COEA 1CXNA 2N99A 2QJAC 2BHIA 3ERAA 1ZADA 3FEVA 4BIKB 2QJ9C 1HC9B 1KU6B 1YWHA 1IDLA 1ERAA 2H62D 1M9ZA 1LXHA 1NORA 1IKCA 1B41B 4OM5A 2ABXA 1TXBA 1FFJA 2MFAA 1NTNA 6EBXA 1LJZA 2HLRA 2MHYA 4FAOE 2CTXA 1G6MA 1CHVS 5DO6A 2OFSA 1LSIA 4EY8B 1JGKA 1IDGA 1KC4A 2LA1A 3NEQA 1F94A 4LFTA 3HH7A 1CXOA 1V6PA 2NBTA 4UY2C 3PLCA 2GOOB 1HOYA 1I02A 1CDTA 4IYEA 1KS6A 3NH7A 1NXBA 4HQPF 1IDIA 1REWC 1H0JA 2PJYB 2QJBC 3LAQU 1CREA 1F8UB 1FSSB 2L5SA 2H62C 2HLQA 3EVSC 1IDHA 1NTXA 2H8UA 2H64C 1LXGA 1HAAA 1KTZB 1HAJA 1NYSA 3U74U 2H64B 2CRSA 1NEAA 2H7ZB 1CVOA 1QKEA 2MUOA 4XJJA 4P7UA 2CCXA 2CDXA 1CDSA 1QKDA 2UX2A 1KFHA 1L4WA 3EBXA 1JBDA 2GOOC 4BDTB 2QC1A 3BT1U 2J8BA 1FASA 2PJYC 2BTXA 3NDSA 1FRAA 3VTSA 1NYUA 1MR6A 2MJ0A 3U73U 1PLOA 1XT3A 1CCQA 5EBXA 1KBSA 1BTEA 2L03A 2JVEA 1HC9A 3BT2U 4OM4A 1TGXA 1UG4A 1CDRA 1CB9A 4RUDA 1CDQA 3KFDE 2LCRA 3KFDI 2CRTA 1CODA 5DU1A 4FAOC 1FSCA 1TXAA 1QM7A 1KXIA 1KL8A 2H5FA 1ONJA 1IQ9A 2K3GA 1VB0A 4QTIU 1IJCA
chains in the Genus database with same CATH topology
1MAHF 4KSNA 4DO8A 2FD6U 1FF4A 1LX5B 1JE9A 4ZQYA 1TFSA 1RGJA 4AEAA 2MUPA 2ERAA 1CRFA 2I9BE 1ERGA 5IMTD 1RL5A 2MJYA 2JQPA 2MJ4A 1W6BA 1ES7B 2UWRA 2VLWA 2X8BB 1ABTA 1KBTA 1DRSA 2H7ZA 1CTXA 1KBAA 1IK8A 3QB4B 5IMYC 1BXPA 1S4YA 5DZ5A 1COEA 1CXNA 2N99A 2QJAC 2BHIA 3ERAA 1ZADA 3FEVA 4BIKB 2QJ9C 1HC9B 1KU6B 1YWHA 1IDLA 1ERAA 2H62D 1M9ZA 1LXHA 1NORA 1IKCA 1B41B 4OM5A 2ABXA 1TXBA 1FFJA 2MFAA 1NTNA 6EBXA 1LJZA 2HLRA 2MHYA 4FAOE 2CTXA 1G6MA 1CHVS 5DO6A 2OFSA 1LSIA 4EY8B 1JGKA 1IDGA 1KC4A 2LA1A 3NEQA 1F94A 4LFTA 3HH7A 1CXOA 1V6PA 2NBTA 4UY2C 3PLCA 2GOOB 1HOYA 1I02A 1CDTA 4IYEA 1KS6A 3NH7A 1NXBA 4HQPF 1IDIA 1REWC 1H0JA 2PJYB 2QJBC 3LAQU 1CREA 1F8UB 1FSSB 2L5SA 2H62C 2HLQA 3EVSC 1IDHA 1NTXA 2H8UA 2H64C 1LXGA 1HAAA 1KTZB 1HAJA 1NYSA 3U74U 2H64B 2CRSA 1NEAA 2H7ZB 1CVOA 1QKEA 2MUOA 4XJJA 4P7UA 2CCXA 2CDXA 1CDSA 1QKDA 2UX2A 1KFHA 1L4WA 3EBXA 1JBDA 2GOOC 4BDTB 2QC1A 3BT1U 2J8BA 1FASA 2PJYC 2BTXA 3NDSA 1FRAA 3VTSA 1NYUA 1MR6A 2MJ0A 3U73U 1PLOA 1XT3A 1CCQA 5EBXA 1KBSA 1BTEA 2L03A 2JVEA 1HC9A 3BT2U 4OM4A 1TGXA 1UG4A 1CDRA 1CB9A 4RUDA 1CDQA 3KFDE 2LCRA 3KFDI 2CRTA 1CODA 5DU1A 4FAOC 1FSCA 1TXAA 1QM7A 1KXIA 1KL8A 2H5FA 1ONJA 1IQ9A 2K3GA 1VB0A 4QTIU 1IJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAH F;  4DO8 A;  2FD6 U;  1FF4 A;  1LX5 B;  1JE9 A;  4ZQY A;  1TFS A;  1RGJ A;  4AEA A;  2MUP A;  2ERA A;  1CRF A;  2I9B E;  1ERG A;  5IMT D;  1RL5 A;  2MJY A;  2JQP A;  2MJ4 A;  1W6B A;  1ES7 B;  2UWR A;  2VLW A;  2X8B B;  1ABT A;  1KBT A;  1DRS A;  2H7Z A;  1CTX A;  1KBA A;  1IK8 A;  3QB4 B;  5IMY C;  1BXP A;  1S4Y A;  5DZ5 A;  1COE A;  1CXN A;  2N99 A;  2QJA C;  2BHI A;  3ERA A;  1ZAD A;  3FEV A;  4BIK B;  2QJ9 C;  1HC9 B;  1KU6 B;  1YWH A;  1IDL A;  1ERA A;  2H62 D;  1M9Z A;  1LXH A;  1NOR A;  1IKC A;  1B41 B;  4OM5 A;  2ABX A;  1TXB A;  1FFJ A;  2MFA A;  1NTN A;  6EBX A;  1LJZ A;  2HLR A;  2MHY A;  4FAO E;  2CTX A;  1G6M A;  1CHV S;  5DO6 A;  2OFS A;  1LSI A;  4EY8 B;  1JGK A;  1IDG A;  1KC4 A;  2LA1 A;  3NEQ A;  1F94 A;  4LFT A;  3HH7 A;  1CXO A;  1V6P A;  2NBT A;  4UY2 C;  3PLC A;  2GOO B;  1HOY A;  1I02 A;  1CDT A;  4IYE A;  1KS6 A;  3NH7 A;  1NXB A;  4HQP F;  1IDI A;  1REW C;  1H0J A;  2PJY B;  2QJB C;  3LAQ U;  1CRE A;  1F8U B;  1FSS B;  2L5S A;  2H62 C;  2HLQ A;  3EVS C;  1IDH A;  1NTX A;  2H8U A;  2H64 C;  1LXG A;  1HAA A;  1KTZ B;  1HAJ A;  1NYS A;  3U74 U;  2H64 B;  2CRS A;  1NEA A;  2H7Z B;  1CVO A;  1QKE A;  2MUO A;  4XJJ A;  4P7U A;  2CCX A;  2CDX A;  1CDS A;  1QKD A;  2UX2 A;  1KFH A;  1L4W A;  3EBX A;  1JBD A;  2GOO C;  4BDT B;  2QC1 A;  3BT1 U;  2J8B A;  1FAS A;  2PJY C;  2BTX A;  3NDS A;  1FRA A;  3VTS A;  1NYU A;  1MR6 A;  2MJ0 A;  3U73 U;  1PLO A;  1XT3 A;  1CCQ A;  5EBX A;  1KBS A;  1BTE A;  2L03 A;  2JVE A;  1HC9 A;  3BT2 U;  4OM4 A;  1TGX A;  1UG4 A;  1CDR A;  1CB9 A;  4RUD A;  1CDQ A;  3KFD E;  2LCR A;  3KFD I;  2CRT A;  1COD A;  5DU1 A;  4FAO C;  1FSC A;  1TXA A;  1QM7 A;  1KXI A;  1KL8 A;  2H5F A;  1ONJ A;  1IQ9 A;  2K3G A;  1VB0 A;  4QTI U;  1IJC A; 
#chains in the Genus database with same CATH topology
 1MAH F;  4KSN A;  4DO8 A;  2FD6 U;  1FF4 A;  1LX5 B;  1JE9 A;  4ZQY A;  1TFS A;  1RGJ A;  4AEA A;  2MUP A;  2ERA A;  1CRF A;  2I9B E;  1ERG A;  5IMT D;  1RL5 A;  2MJY A;  2JQP A;  2MJ4 A;  1W6B A;  1ES7 B;  2UWR A;  2VLW A;  2X8B B;  1ABT A;  1KBT A;  1DRS A;  2H7Z A;  1CTX A;  1KBA A;  1IK8 A;  3QB4 B;  5IMY C;  1BXP A;  1S4Y A;  5DZ5 A;  1COE A;  1CXN A;  2N99 A;  2QJA C;  2BHI A;  3ERA A;  1ZAD A;  3FEV A;  4BIK B;  2QJ9 C;  1HC9 B;  1KU6 B;  1YWH A;  1IDL A;  1ERA A;  2H62 D;  1M9Z A;  1LXH A;  1NOR A;  1IKC A;  1B41 B;  4OM5 A;  2ABX A;  1TXB A;  1FFJ A;  2MFA A;  1NTN A;  6EBX A;  1LJZ A;  2HLR A;  2MHY A;  4FAO E;  2CTX A;  1G6M A;  1CHV S;  5DO6 A;  2OFS A;  1LSI A;  4EY8 B;  1JGK A;  1IDG A;  1KC4 A;  2LA1 A;  3NEQ A;  1F94 A;  4LFT A;  3HH7 A;  1CXO A;  1V6P A;  2NBT A;  4UY2 C;  3PLC A;  2GOO B;  1HOY A;  1I02 A;  1CDT A;  4IYE A;  1KS6 A;  3NH7 A;  1NXB A;  4HQP F;  1IDI A;  1REW C;  1H0J A;  2PJY B;  2QJB C;  3LAQ U;  1CRE A;  1F8U B;  1FSS B;  2L5S A;  2H62 C;  2HLQ A;  3EVS C;  1IDH A;  1NTX A;  2H8U A;  2H64 C;  1LXG A;  1HAA A;  1KTZ B;  1HAJ A;  1NYS A;  3U74 U;  2H64 B;  2CRS A;  1NEA A;  2H7Z B;  1CVO A;  1QKE A;  2MUO A;  4XJJ A;  4P7U A;  2CCX A;  2CDX A;  1CDS A;  1QKD A;  2UX2 A;  1KFH A;  1L4W A;  3EBX A;  1JBD A;  2GOO C;  4BDT B;  2QC1 A;  3BT1 U;  2J8B A;  1FAS A;  2PJY C;  2BTX A;  3NDS A;  1FRA A;  3VTS A;  1NYU A;  1MR6 A;  2MJ0 A;  3U73 U;  1PLO A;  1XT3 A;  1CCQ A;  5EBX A;  1KBS A;  1BTE A;  2L03 A;  2JVE A;  1HC9 A;  3BT2 U;  4OM4 A;  1TGX A;  1UG4 A;  1CDR A;  1CB9 A;  4RUD A;  1CDQ A;  3KFD E;  2LCR A;  3KFD I;  2CRT A;  1COD A;  5DU1 A;  4FAO C;  1FSC A;  1TXA A;  1QM7 A;  1KXI A;  1KL8 A;  2H5F A;  1ONJ A;  1IQ9 A;  2K3G A;  1VB0 A;  4QTI U;  1IJC A; 
#chains in the Genus database with same CATH homology
 1MAH F;  4KSN A;  4DO8 A;  2FD6 U;  1FF4 A;  1LX5 B;  1JE9 A;  4ZQY A;  1TFS A;  1RGJ A;  4AEA A;  2MUP A;  2ERA A;  1CRF A;  2I9B E;  1ERG A;  5IMT D;  1RL5 A;  2MJY A;  2JQP A;  2MJ4 A;  1W6B A;  1ES7 B;  2UWR A;  2VLW A;  2X8B B;  1ABT A;  1KBT A;  1DRS A;  2H7Z A;  1CTX A;  1KBA A;  1IK8 A;  3QB4 B;  5IMY C;  1BXP A;  1S4Y A;  5DZ5 A;  1COE A;  1CXN A;  2N99 A;  2QJA C;  2BHI A;  3ERA A;  1ZAD A;  3FEV A;  4BIK B;  2QJ9 C;  1HC9 B;  1KU6 B;  1YWH A;  1IDL A;  1ERA A;  2H62 D;  1M9Z A;  1LXH A;  1NOR A;  1IKC A;  1B41 B;  4OM5 A;  2ABX A;  1TXB A;  1FFJ A;  2MFA A;  1NTN A;  6EBX A;  1LJZ A;  2HLR A;  2MHY A;  4FAO E;  2CTX A;  1G6M A;  1CHV S;  5DO6 A;  2OFS A;  1LSI A;  4EY8 B;  1JGK A;  1IDG A;  1KC4 A;  2LA1 A;  3NEQ A;  1F94 A;  4LFT A;  3HH7 A;  1CXO A;  1V6P A;  2NBT A;  4UY2 C;  3PLC A;  2GOO B;  1HOY A;  1I02 A;  1CDT A;  4IYE A;  1KS6 A;  3NH7 A;  1NXB A;  4HQP F;  1IDI A;  1REW C;  1H0J A;  2PJY B;  2QJB C;  3LAQ U;  1CRE A;  1F8U B;  1FSS B;  2L5S A;  2H62 C;  2HLQ A;  3EVS C;  1IDH A;  1NTX A;  2H8U A;  2H64 C;  1LXG A;  1HAA A;  1KTZ B;  1HAJ A;  1NYS A;  3U74 U;  2H64 B;  2CRS A;  1NEA A;  2H7Z B;  1CVO A;  1QKE A;  2MUO A;  4XJJ A;  4P7U A;  2CCX A;  2CDX A;  1CDS A;  1QKD A;  2UX2 A;  1KFH A;  1L4W A;  3EBX A;  1JBD A;  2GOO C;  4BDT B;  2QC1 A;  3BT1 U;  2J8B A;  1FAS A;  2PJY C;  2BTX A;  3NDS A;  1FRA A;  3VTS A;  1NYU A;  1MR6 A;  2MJ0 A;  3U73 U;  1PLO A;  1XT3 A;  1CCQ A;  5EBX A;  1KBS A;  1BTE A;  2L03 A;  2JVE A;  1HC9 A;  3BT2 U;  4OM4 A;  1TGX A;  1UG4 A;  1CDR A;  1CB9 A;  4RUD A;  1CDQ A;  3KFD E;  2LCR A;  3KFD I;  2CRT A;  1COD A;  5DU1 A;  4FAO C;  1FSC A;  1TXA A;  1QM7 A;  1KXI A;  1KL8 A;  2H5F A;  1ONJ A;  1IQ9 A;  2K3G A;  1VB0 A;  4QTI U;  1IJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...