1ABTA

Nmr solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of an alpha-bungarotoxin/nicotinic receptor peptide complex.
pubmed doi rcsb
molecule tags Toxin
molecule keywords ALPHA-BUNGAROTOXIN
total genus 9
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1993-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1abtA00
2N99A 1QKDA 2JQPA 2CTXA 2JVEA 5DU1A 3U74U 2X8BB 4DO8A 1IK8A 1KC4A 2UWRA 5IMYC 1VB0A 2MHYA 1G6MA 1CDTA 2K3GA 2MUOA 3LAQU 1LSIA 4OM4A 1NEAA 1TFSA 2HLRA 1KXIA 1NYUA 2QJAC 1JBDA 1BTEA 1KU6B 2PJYB 4AEAA 3PLCA 3U73U 1CDRA 1XT3A 1I02A 1HAAA 1B41B 2H5FA 1CRFA 2H64C 3ERAA 2CRSA 1PLOA 1ABTA 2QJ9C 2LCRA 2H62D 4LFTA 2H64B 1CTXA 1ERAA 1V6PA 4QTIU 2CCXA 4XJJA 1NXBA 1NYSA 1FSSB 1FASA 2NBTA 1IJCA 1MAHF 1CDQA 1CHVS 1LJZA 2CRTA 2MJ0A 1FFJA 2ABXA 2GOOB 1FRAA 1IDLA 1KBSA 1QM7A 2L5SA 1M9ZA 2MJ4A 2H8UA 1KS6A 1LX5B 2ERAA 2GOOC 4P7UA 5EBXA 1DRSA 1JGKA 3NH7A 1F94A 3VTSA 4FAOC 1IDHA 2FD6U 4BDTB 1ERGA 1TGXA 1KBTA 4ZQYA 1ES7B 4IYEA 1KTZB 1W6BA 1CVOA 6EBXA 2QC1A 1KL8A 1UG4A 2PJYC 1IQ9A 1NTXA 4OM5A 4HQPF 5IMTD 2UX2A 2QJBC 1MR6A 1CDSA 2CDXA 2HLQA 1IKCA 1LXHA 2H62C 1JE9A 1IDIA 1HC9A 5DO6A 1L4WA 1HC9B 1F8UB 1YWHA 1KFHA 2MJYA 2VLWA 1CB9A 1QKEA 1CXOA 1CODA 3FEVA 1BXPA 2LA1A 1TXAA 1ZADA 3BT1U 1IDGA 2BTXA 3NDSA 3QB4B 2H7ZB 1HOYA 2MUPA 1ONJA 2H7ZA 4FAOE 1CREA 3KFDE 1HAJA 1TXBA 1RL5A 2L03A 4EY8B 3NEQA 1REWC 2MFAA 3HH7A 1FF4A 2OFSA 2BHIA 1CXNA 3EBXA 4RUDA 3BT2U 2J8BA 1S4YA 1COEA 1NORA 3EVSC 1KBAA 4BIKB 1FSCA 1CCQA 1H0JA 5DZ5A 4UY2C 2I9BE 1LXGA 1RGJA 3KFDI 1NTNA
chains in the Genus database with same CATH superfamily
2N99A 1QKDA 2JQPA 2CTXA 2JVEA 5DU1A 3U74U 2X8BB 4DO8A 1IK8A 1KC4A 2UWRA 5IMYC 1VB0A 2MHYA 1G6MA 1CDTA 2K3GA 2MUOA 3LAQU 1LSIA 4OM4A 1NEAA 1TFSA 2HLRA 1KXIA 1NYUA 2QJAC 1JBDA 1BTEA 1KU6B 2PJYB 4AEAA 3PLCA 3U73U 1CDRA 1XT3A 1I02A 1HAAA 1B41B 2H5FA 1CRFA 2H64C 3ERAA 2CRSA 1PLOA 1ABTA 2QJ9C 2LCRA 2H62D 4KSNA 4LFTA 2H64B 1CTXA 1ERAA 1V6PA 4QTIU 2CCXA 4XJJA 1NXBA 1NYSA 1FSSB 1FASA 2NBTA 1IJCA 1MAHF 1CDQA 1CHVS 1LJZA 2CRTA 2MJ0A 1FFJA 2ABXA 2GOOB 1FRAA 1IDLA 1KBSA 1QM7A 2L5SA 1M9ZA 2MJ4A 2H8UA 1KS6A 1LX5B 2ERAA 2GOOC 4P7UA 5EBXA 1DRSA 1JGKA 3NH7A 1F94A 3VTSA 4FAOC 1IDHA 2FD6U 4BDTB 1ERGA 1TGXA 1KBTA 4ZQYA 1ES7B 4IYEA 1KTZB 1W6BA 1CVOA 6EBXA 2QC1A 1KL8A 1UG4A 2PJYC 1IQ9A 1NTXA 4OM5A 4HQPF 5IMTD 2UX2A 2QJBC 1MR6A 1CDSA 2CDXA 2HLQA 1IKCA 1LXHA 2H62C 1JE9A 1IDIA 1HC9A 5DO6A 1L4WA 1HC9B 1F8UB 1YWHA 1KFHA 2MJYA 2VLWA 1CB9A 1QKEA 1CXOA 1CODA 3FEVA 1BXPA 2LA1A 1TXAA 1ZADA 3BT1U 1IDGA 2BTXA 3NDSA 3QB4B 2H7ZB 1HOYA 2MUPA 1ONJA 2H7ZA 4FAOE 1CREA 3KFDE 1HAJA 1TXBA 1RL5A 2L03A 4EY8B 3NEQA 1REWC 2MFAA 3HH7A 1FF4A 2OFSA 2BHIA 1CXNA 3EBXA 4RUDA 3BT2U 2J8BA 1S4YA 1COEA 1NORA 3EVSC 1KBAA 4BIKB 1FSCA 1CCQA 1H0JA 5DZ5A 4UY2C 2I9BE 1LXGA 1RGJA 3KFDI 1NTNA
chains in the Genus database with same CATH topology
2N99A 1QKDA 2JQPA 2CTXA 2JVEA 5DU1A 3U74U 2X8BB 4DO8A 1IK8A 1KC4A 2UWRA 5IMYC 1VB0A 2MHYA 1G6MA 1CDTA 2K3GA 2MUOA 3LAQU 1LSIA 4OM4A 1NEAA 1TFSA 2HLRA 1KXIA 1NYUA 2QJAC 1JBDA 1BTEA 1KU6B 2PJYB 4AEAA 3PLCA 3U73U 1CDRA 1XT3A 1I02A 1HAAA 1B41B 2H5FA 1CRFA 2H64C 3ERAA 2CRSA 1PLOA 1ABTA 2QJ9C 2LCRA 2H62D 4KSNA 4LFTA 2H64B 1CTXA 1ERAA 1V6PA 4QTIU 2CCXA 4XJJA 1NXBA 1NYSA 1FSSB 1FASA 2NBTA 1IJCA 1MAHF 1CDQA 1CHVS 1LJZA 2CRTA 2MJ0A 1FFJA 2ABXA 2GOOB 1FRAA 1IDLA 1KBSA 1QM7A 2L5SA 1M9ZA 2MJ4A 2H8UA 1KS6A 1LX5B 2ERAA 2GOOC 4P7UA 5EBXA 1DRSA 1JGKA 3NH7A 1F94A 3VTSA 4FAOC 1IDHA 2FD6U 4BDTB 1ERGA 1TGXA 1KBTA 4ZQYA 1ES7B 4IYEA 1KTZB 1W6BA 1CVOA 6EBXA 2QC1A 1KL8A 1UG4A 2PJYC 1IQ9A 1NTXA 4OM5A 4HQPF 5IMTD 2UX2A 2QJBC 1MR6A 1CDSA 2CDXA 2HLQA 1IKCA 1LXHA 2H62C 1JE9A 1IDIA 1HC9A 5DO6A 1L4WA 1HC9B 1F8UB 1YWHA 1KFHA 2MJYA 2VLWA 1CB9A 1QKEA 1CXOA 1CODA 3FEVA 1BXPA 2LA1A 1TXAA 1ZADA 3BT1U 1IDGA 2BTXA 3NDSA 3QB4B 2H7ZB 1HOYA 2MUPA 1ONJA 2H7ZA 4FAOE 1CREA 3KFDE 1HAJA 1TXBA 1RL5A 2L03A 4EY8B 3NEQA 1REWC 2MFAA 3HH7A 1FF4A 2OFSA 2BHIA 1CXNA 3EBXA 4RUDA 3BT2U 2J8BA 1S4YA 1COEA 1NORA 3EVSC 1KBAA 4BIKB 1FSCA 1CCQA 1H0JA 5DZ5A 4UY2C 2I9BE 1LXGA 1RGJA 3KFDI 1NTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N99 A;  1QKD A;  2JQP A;  2CTX A;  2JVE A;  5DU1 A;  3U74 U;  2X8B B;  4DO8 A;  1IK8 A;  1KC4 A;  2UWR A;  5IMY C;  1VB0 A;  2MHY A;  1G6M A;  1CDT A;  2K3G A;  2MUO A;  3LAQ U;  1LSI A;  4OM4 A;  1NEA A;  1TFS A;  2HLR A;  1KXI A;  1NYU A;  2QJA C;  1JBD A;  1BTE A;  1KU6 B;  2PJY B;  4AEA A;  3PLC A;  3U73 U;  1CDR A;  1XT3 A;  1I02 A;  1HAA A;  1B41 B;  2H5F A;  1CRF A;  2H64 C;  3ERA A;  2CRS A;  1PLO A;  1ABT A;  2QJ9 C;  2LCR A;  2H62 D;  4LFT A;  2H64 B;  1CTX A;  1ERA A;  1V6P A;  4QTI U;  2CCX A;  4XJJ A;  1NXB A;  1NYS A;  1FSS B;  1FAS A;  2NBT A;  1IJC A;  1MAH F;  1CDQ A;  1CHV S;  1LJZ A;  2CRT A;  2MJ0 A;  1FFJ A;  2ABX A;  2GOO B;  1FRA A;  1IDL A;  1KBS A;  1QM7 A;  2L5S A;  1M9Z A;  2MJ4 A;  2H8U A;  1KS6 A;  1LX5 B;  2ERA A;  2GOO C;  4P7U A;  5EBX A;  1DRS A;  1JGK A;  3NH7 A;  1F94 A;  3VTS A;  4FAO C;  1IDH A;  2FD6 U;  4BDT B;  1ERG A;  1TGX A;  1KBT A;  4ZQY A;  1ES7 B;  4IYE A;  1KTZ B;  1W6B A;  1CVO A;  6EBX A;  2QC1 A;  1KL8 A;  1UG4 A;  2PJY C;  1IQ9 A;  1NTX A;  4OM5 A;  4HQP F;  5IMT D;  2UX2 A;  2QJB C;  1MR6 A;  1CDS A;  2CDX A;  2HLQ A;  1IKC A;  1LXH A;  2H62 C;  1JE9 A;  1IDI A;  1HC9 A;  5DO6 A;  1L4W A;  1HC9 B;  1F8U B;  1YWH A;  1KFH A;  2MJY A;  2VLW A;  1CB9 A;  1QKE A;  1CXO A;  1COD A;  3FEV A;  1BXP A;  2LA1 A;  1TXA A;  1ZAD A;  3BT1 U;  1IDG A;  2BTX A;  3NDS A;  3QB4 B;  2H7Z B;  1HOY A;  2MUP A;  1ONJ A;  2H7Z A;  4FAO E;  1CRE A;  3KFD E;  1HAJ A;  1TXB A;  1RL5 A;  2L03 A;  4EY8 B;  3NEQ A;  1REW C;  2MFA A;  3HH7 A;  1FF4 A;  2OFS A;  2BHI A;  1CXN A;  3EBX A;  4RUD A;  3BT2 U;  2J8B A;  1S4Y A;  1COE A;  1NOR A;  3EVS C;  1KBA A;  4BIK B;  1FSC A;  1CCQ A;  1H0J A;  5DZ5 A;  4UY2 C;  2I9B E;  1LXG A;  1RGJ A;  3KFD I;  1NTN A; 
#chains in the Genus database with same CATH topology
 2N99 A;  1QKD A;  2JQP A;  2CTX A;  2JVE A;  5DU1 A;  3U74 U;  2X8B B;  4DO8 A;  1IK8 A;  1KC4 A;  2UWR A;  5IMY C;  1VB0 A;  2MHY A;  1G6M A;  1CDT A;  2K3G A;  2MUO A;  3LAQ U;  1LSI A;  4OM4 A;  1NEA A;  1TFS A;  2HLR A;  1KXI A;  1NYU A;  2QJA C;  1JBD A;  1BTE A;  1KU6 B;  2PJY B;  4AEA A;  3PLC A;  3U73 U;  1CDR A;  1XT3 A;  1I02 A;  1HAA A;  1B41 B;  2H5F A;  1CRF A;  2H64 C;  3ERA A;  2CRS A;  1PLO A;  1ABT A;  2QJ9 C;  2LCR A;  2H62 D;  4KSN A;  4LFT A;  2H64 B;  1CTX A;  1ERA A;  1V6P A;  4QTI U;  2CCX A;  4XJJ A;  1NXB A;  1NYS A;  1FSS B;  1FAS A;  2NBT A;  1IJC A;  1MAH F;  1CDQ A;  1CHV S;  1LJZ A;  2CRT A;  2MJ0 A;  1FFJ A;  2ABX A;  2GOO B;  1FRA A;  1IDL A;  1KBS A;  1QM7 A;  2L5S A;  1M9Z A;  2MJ4 A;  2H8U A;  1KS6 A;  1LX5 B;  2ERA A;  2GOO C;  4P7U A;  5EBX A;  1DRS A;  1JGK A;  3NH7 A;  1F94 A;  3VTS A;  4FAO C;  1IDH A;  2FD6 U;  4BDT B;  1ERG A;  1TGX A;  1KBT A;  4ZQY A;  1ES7 B;  4IYE A;  1KTZ B;  1W6B A;  1CVO A;  6EBX A;  2QC1 A;  1KL8 A;  1UG4 A;  2PJY C;  1IQ9 A;  1NTX A;  4OM5 A;  4HQP F;  5IMT D;  2UX2 A;  2QJB C;  1MR6 A;  1CDS A;  2CDX A;  2HLQ A;  1IKC A;  1LXH A;  2H62 C;  1JE9 A;  1IDI A;  1HC9 A;  5DO6 A;  1L4W A;  1HC9 B;  1F8U B;  1YWH A;  1KFH A;  2MJY A;  2VLW A;  1CB9 A;  1QKE A;  1CXO A;  1COD A;  3FEV A;  1BXP A;  2LA1 A;  1TXA A;  1ZAD A;  3BT1 U;  1IDG A;  2BTX A;  3NDS A;  3QB4 B;  2H7Z B;  1HOY A;  2MUP A;  1ONJ A;  2H7Z A;  4FAO E;  1CRE A;  3KFD E;  1HAJ A;  1TXB A;  1RL5 A;  2L03 A;  4EY8 B;  3NEQ A;  1REW C;  2MFA A;  3HH7 A;  1FF4 A;  2OFS A;  2BHI A;  1CXN A;  3EBX A;  4RUD A;  3BT2 U;  2J8B A;  1S4Y A;  1COE A;  1NOR A;  3EVS C;  1KBA A;  4BIK B;  1FSC A;  1CCQ A;  1H0J A;  5DZ5 A;  4UY2 C;  2I9B E;  1LXG A;  1RGJ A;  3KFD I;  1NTN A; 
#chains in the Genus database with same CATH homology
 2N99 A;  1QKD A;  2JQP A;  2CTX A;  2JVE A;  5DU1 A;  3U74 U;  2X8B B;  4DO8 A;  1IK8 A;  1KC4 A;  2UWR A;  5IMY C;  1VB0 A;  2MHY A;  1G6M A;  1CDT A;  2K3G A;  2MUO A;  3LAQ U;  1LSI A;  4OM4 A;  1NEA A;  1TFS A;  2HLR A;  1KXI A;  1NYU A;  2QJA C;  1JBD A;  1BTE A;  1KU6 B;  2PJY B;  4AEA A;  3PLC A;  3U73 U;  1CDR A;  1XT3 A;  1I02 A;  1HAA A;  1B41 B;  2H5F A;  1CRF A;  2H64 C;  3ERA A;  2CRS A;  1PLO A;  1ABT A;  2QJ9 C;  2LCR A;  2H62 D;  4KSN A;  4LFT A;  2H64 B;  1CTX A;  1ERA A;  1V6P A;  4QTI U;  2CCX A;  4XJJ A;  1NXB A;  1NYS A;  1FSS B;  1FAS A;  2NBT A;  1IJC A;  1MAH F;  1CDQ A;  1CHV S;  1LJZ A;  2CRT A;  2MJ0 A;  1FFJ A;  2ABX A;  2GOO B;  1FRA A;  1IDL A;  1KBS A;  1QM7 A;  2L5S A;  1M9Z A;  2MJ4 A;  2H8U A;  1KS6 A;  1LX5 B;  2ERA A;  2GOO C;  4P7U A;  5EBX A;  1DRS A;  1JGK A;  3NH7 A;  1F94 A;  3VTS A;  4FAO C;  1IDH A;  2FD6 U;  4BDT B;  1ERG A;  1TGX A;  1KBT A;  4ZQY A;  1ES7 B;  4IYE A;  1KTZ B;  1W6B A;  1CVO A;  6EBX A;  2QC1 A;  1KL8 A;  1UG4 A;  2PJY C;  1IQ9 A;  1NTX A;  4OM5 A;  4HQP F;  5IMT D;  2UX2 A;  2QJB C;  1MR6 A;  1CDS A;  2CDX A;  2HLQ A;  1IKC A;  1LXH A;  2H62 C;  1JE9 A;  1IDI A;  1HC9 A;  5DO6 A;  1L4W A;  1HC9 B;  1F8U B;  1YWH A;  1KFH A;  2MJY A;  2VLW A;  1CB9 A;  1QKE A;  1CXO A;  1COD A;  3FEV A;  1BXP A;  2LA1 A;  1TXA A;  1ZAD A;  3BT1 U;  1IDG A;  2BTX A;  3NDS A;  3QB4 B;  2H7Z B;  1HOY A;  2MUP A;  1ONJ A;  2H7Z A;  4FAO E;  1CRE A;  3KFD E;  1HAJ A;  1TXB A;  1RL5 A;  2L03 A;  4EY8 B;  3NEQ A;  1REW C;  2MFA A;  3HH7 A;  1FF4 A;  2OFS A;  2BHI A;  1CXN A;  3EBX A;  4RUD A;  3BT2 U;  2J8B A;  1S4Y A;  1COE A;  1NOR A;  3EVS C;  1KBA A;  4BIK B;  1FSC A;  1CCQ A;  1H0J A;  5DZ5 A;  4UY2 C;  2I9B E;  1LXG A;  1RGJ A;  3KFD I;  1NTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...