1CDRA

Structure of a soluble, glycosylated form of the human complement regulatory protein cd59
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
77
structure length
77
Chain Sequence
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a soluble, glycosylated form of the human complement regulatory protein CD59.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complement regulatory protein
molecule keywords CD59
total genus 5
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1994-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1cdrA00
2UX2A 2MJYA 1MR6A 1CXNA 4LFTA 2L03A 2MHYA 1IQ9A 2X8BB 1DRSA 4ZQYA 2K3GA 4BIKB 2QJ9C 1HOYA 4OM5A 2MFAA 2ERAA 4IYEA 1FFJA 1IDHA 1IJCA 2H64C 3HH7A 1ES7B 2CRTA 2N99A 1YWHA 1LJZA 1QM7A 1MAHF 1CDTA 1CVOA 4BDTB 2BHIA 3EVSC 1FSCA 1IDGA 1CDSA 2QC1A 1CCQA 1NYSA 2GOOC 5IMYC 1KBAA 2MJ0A 1F8UB 1QKEA 2MUPA 4EY8B 1FRAA 2FD6U 1CTXA 2UWRA 3LAQU 1FF4A 1LSIA 3KFDE 2L5SA 1HC9B 2NBTA 1B41B 1CDQA 1HAAA 1L4WA 1KL8A 2VLWA 3NEQA 1F94A 4UY2C 2H64B 2BTXA 5DZ5A 5IMTD 1JGKA 1FASA 1COEA 1IDLA 1HAJA 2MJ4A 1KBSA 2JQPA 1TFSA 3QB4B 4OM4A 3BT1U 4RUDA 1NORA 2CDXA 1IKCA 1KFHA 4HQPF 1CRFA 1S4YA 1KU6B 3VTSA 1H0JA 3ERAA 5DU1A 1KTZB 1VB0A 1IDIA 1V6PA 1PLOA 2HLQA 4P7UA 4AEAA 1KS6A 1NXBA 1BTEA 1NYUA 3KFDI 3PLCA 2ABXA 3NDSA 1XT3A 2CRSA 4XJJA 2GOOB 5DO6A 2H7ZB 1UG4A 2LA1A 1IK8A 1BXPA 1KBTA 1RL5A 1CHVS 1CB9A 1I02A 2J8BA 3NH7A 2JVEA 2I9BE 1RGJA 1HC9A 1KC4A 1QKDA 1NEAA 1CREA 1CODA 1W6BA 1REWC 1JE9A 1CDRA 2MUOA 1LXGA 4QTIU 2H8UA 3BT2U 4FAOC 1KXIA 1NTXA 4DO8A 1TXAA 2CTXA 2CCXA 1JBDA 1ONJA 1FSSB 2PJYC 2H7ZA 1TXBA 1LX5B 3U74U 1ABTA 3U73U 1G6MA 1ERGA 1TGXA 2H62D 2LCRA 2QJBC 2H5FA 3FEVA 1ZADA 5EBXA 2QJAC 1NTNA 1CXOA 1ERAA 2HLRA 6EBXA 2H62C 4FAOE 1LXHA 3EBXA 2PJYB 1M9ZA 2OFSA
chains in the Genus database with same CATH superfamily
2UX2A 2MJYA 1MR6A 1CXNA 4LFTA 2L03A 2MHYA 1IQ9A 2X8BB 1DRSA 4ZQYA 2K3GA 4BIKB 2QJ9C 1HOYA 4OM5A 2MFAA 2ERAA 4IYEA 1FFJA 1IDHA 1IJCA 2H64C 3HH7A 1ES7B 2CRTA 2N99A 1YWHA 1LJZA 1QM7A 1MAHF 1CDTA 1CVOA 4BDTB 2BHIA 3EVSC 1FSCA 1IDGA 1CDSA 2QC1A 1CCQA 1NYSA 2GOOC 5IMYC 1KBAA 2MJ0A 1F8UB 1QKEA 2MUPA 4EY8B 1FRAA 2FD6U 1CTXA 2UWRA 3LAQU 1FF4A 1LSIA 3KFDE 2L5SA 1HC9B 2NBTA 1B41B 1CDQA 1HAAA 1L4WA 1KL8A 2VLWA 3NEQA 1F94A 4UY2C 2H64B 2BTXA 5DZ5A 5IMTD 1JGKA 1FASA 1COEA 1IDLA 1HAJA 2MJ4A 1KBSA 2JQPA 1TFSA 3QB4B 4OM4A 3BT1U 4RUDA 1NORA 4KSNA 2CDXA 1IKCA 1KFHA 4HQPF 1CRFA 1S4YA 1KU6B 3VTSA 1H0JA 3ERAA 5DU1A 1KTZB 1VB0A 1IDIA 1V6PA 1PLOA 2HLQA 4P7UA 4AEAA 1KS6A 1NXBA 1BTEA 1NYUA 3KFDI 3PLCA 2ABXA 3NDSA 1XT3A 2CRSA 4XJJA 2GOOB 5DO6A 2H7ZB 1UG4A 2LA1A 1IK8A 1BXPA 1KBTA 1RL5A 1CHVS 1CB9A 1I02A 2J8BA 3NH7A 2JVEA 2I9BE 1RGJA 1HC9A 1KC4A 1QKDA 1NEAA 1CREA 1CODA 1W6BA 1REWC 1JE9A 1CDRA 2MUOA 1LXGA 4QTIU 2H8UA 3BT2U 4FAOC 1KXIA 1NTXA 4DO8A 1TXAA 2CTXA 2CCXA 1JBDA 1ONJA 1FSSB 2PJYC 2H7ZA 1TXBA 1LX5B 3U74U 1ABTA 3U73U 1G6MA 1ERGA 1TGXA 2H62D 2LCRA 2QJBC 2H5FA 3FEVA 1ZADA 5EBXA 2QJAC 1NTNA 1CXOA 1ERAA 2HLRA 6EBXA 2H62C 4FAOE 1LXHA 3EBXA 2PJYB 1M9ZA 2OFSA
chains in the Genus database with same CATH topology
2UX2A 2MJYA 1MR6A 1CXNA 4LFTA 2L03A 2MHYA 1IQ9A 2X8BB 1DRSA 4ZQYA 2K3GA 4BIKB 2QJ9C 1HOYA 4OM5A 2MFAA 2ERAA 4IYEA 1FFJA 1IDHA 1IJCA 2H64C 3HH7A 1ES7B 2CRTA 2N99A 1YWHA 1LJZA 1QM7A 1MAHF 1CDTA 1CVOA 4BDTB 2BHIA 3EVSC 1FSCA 1IDGA 1CDSA 2QC1A 1CCQA 1NYSA 2GOOC 5IMYC 1KBAA 2MJ0A 1F8UB 1QKEA 2MUPA 4EY8B 1FRAA 2FD6U 1CTXA 2UWRA 3LAQU 1FF4A 1LSIA 3KFDE 2L5SA 1HC9B 2NBTA 1B41B 1CDQA 1HAAA 1L4WA 1KL8A 2VLWA 3NEQA 1F94A 4UY2C 2H64B 2BTXA 5DZ5A 5IMTD 1JGKA 1FASA 1COEA 1IDLA 1HAJA 2MJ4A 1KBSA 2JQPA 1TFSA 3QB4B 4OM4A 3BT1U 4RUDA 1NORA 4KSNA 2CDXA 1IKCA 1KFHA 4HQPF 1CRFA 1S4YA 1KU6B 3VTSA 1H0JA 3ERAA 5DU1A 1KTZB 1VB0A 1IDIA 1V6PA 1PLOA 2HLQA 4P7UA 4AEAA 1KS6A 1NXBA 1BTEA 1NYUA 3KFDI 3PLCA 2ABXA 3NDSA 1XT3A 2CRSA 4XJJA 2GOOB 5DO6A 2H7ZB 1UG4A 2LA1A 1IK8A 1BXPA 1KBTA 1RL5A 1CHVS 1CB9A 1I02A 2J8BA 3NH7A 2JVEA 2I9BE 1RGJA 1HC9A 1KC4A 1QKDA 1NEAA 1CREA 1CODA 1W6BA 1REWC 1JE9A 1CDRA 2MUOA 1LXGA 4QTIU 2H8UA 3BT2U 4FAOC 1KXIA 1NTXA 4DO8A 1TXAA 2CTXA 2CCXA 1JBDA 1ONJA 1FSSB 2PJYC 2H7ZA 1TXBA 1LX5B 3U74U 1ABTA 3U73U 1G6MA 1ERGA 1TGXA 2H62D 2LCRA 2QJBC 2H5FA 3FEVA 1ZADA 5EBXA 2QJAC 1NTNA 1CXOA 1ERAA 2HLRA 6EBXA 2H62C 4FAOE 1LXHA 3EBXA 2PJYB 1M9ZA 2OFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UX2 A;  2MJY A;  1MR6 A;  1CXN A;  4LFT A;  2L03 A;  2MHY A;  1IQ9 A;  2X8B B;  1DRS A;  4ZQY A;  2K3G A;  4BIK B;  2QJ9 C;  1HOY A;  4OM5 A;  2MFA A;  2ERA A;  4IYE A;  1FFJ A;  1IDH A;  1IJC A;  2H64 C;  3HH7 A;  1ES7 B;  2CRT A;  2N99 A;  1YWH A;  1LJZ A;  1QM7 A;  1MAH F;  1CDT A;  1CVO A;  4BDT B;  2BHI A;  3EVS C;  1FSC A;  1IDG A;  1CDS A;  2QC1 A;  1CCQ A;  1NYS A;  2GOO C;  5IMY C;  1KBA A;  2MJ0 A;  1F8U B;  1QKE A;  2MUP A;  4EY8 B;  1FRA A;  2FD6 U;  1CTX A;  2UWR A;  3LAQ U;  1FF4 A;  1LSI A;  3KFD E;  2L5S A;  1HC9 B;  2NBT A;  1B41 B;  1CDQ A;  1HAA A;  1L4W A;  1KL8 A;  2VLW A;  3NEQ A;  1F94 A;  4UY2 C;  2H64 B;  2BTX A;  5DZ5 A;  5IMT D;  1JGK A;  1FAS A;  1COE A;  1IDL A;  1HAJ A;  2MJ4 A;  1KBS A;  2JQP A;  1TFS A;  3QB4 B;  4OM4 A;  3BT1 U;  4RUD A;  1NOR A;  2CDX A;  1IKC A;  1KFH A;  4HQP F;  1CRF A;  1S4Y A;  1KU6 B;  3VTS A;  1H0J A;  3ERA A;  5DU1 A;  1KTZ B;  1VB0 A;  1IDI A;  1V6P A;  1PLO A;  2HLQ A;  4P7U A;  4AEA A;  1KS6 A;  1NXB A;  1BTE A;  1NYU A;  3KFD I;  3PLC A;  2ABX A;  3NDS A;  1XT3 A;  2CRS A;  4XJJ A;  2GOO B;  5DO6 A;  2H7Z B;  1UG4 A;  2LA1 A;  1IK8 A;  1BXP A;  1KBT A;  1RL5 A;  1CHV S;  1CB9 A;  1I02 A;  2J8B A;  3NH7 A;  2JVE A;  2I9B E;  1RGJ A;  1HC9 A;  1KC4 A;  1QKD A;  1NEA A;  1CRE A;  1COD A;  1W6B A;  1REW C;  1JE9 A;  1CDR A;  2MUO A;  1LXG A;  4QTI U;  2H8U A;  3BT2 U;  4FAO C;  1KXI A;  1NTX A;  4DO8 A;  1TXA A;  2CTX A;  2CCX A;  1JBD A;  1ONJ A;  1FSS B;  2PJY C;  2H7Z A;  1TXB A;  1LX5 B;  3U74 U;  1ABT A;  3U73 U;  1G6M A;  1ERG A;  1TGX A;  2H62 D;  2LCR A;  2QJB C;  2H5F A;  3FEV A;  1ZAD A;  5EBX A;  2QJA C;  1NTN A;  1CXO A;  1ERA A;  2HLR A;  6EBX A;  2H62 C;  4FAO E;  1LXH A;  3EBX A;  2PJY B;  1M9Z A;  2OFS A; 
#chains in the Genus database with same CATH topology
 2UX2 A;  2MJY A;  1MR6 A;  1CXN A;  4LFT A;  2L03 A;  2MHY A;  1IQ9 A;  2X8B B;  1DRS A;  4ZQY A;  2K3G A;  4BIK B;  2QJ9 C;  1HOY A;  4OM5 A;  2MFA A;  2ERA A;  4IYE A;  1FFJ A;  1IDH A;  1IJC A;  2H64 C;  3HH7 A;  1ES7 B;  2CRT A;  2N99 A;  1YWH A;  1LJZ A;  1QM7 A;  1MAH F;  1CDT A;  1CVO A;  4BDT B;  2BHI A;  3EVS C;  1FSC A;  1IDG A;  1CDS A;  2QC1 A;  1CCQ A;  1NYS A;  2GOO C;  5IMY C;  1KBA A;  2MJ0 A;  1F8U B;  1QKE A;  2MUP A;  4EY8 B;  1FRA A;  2FD6 U;  1CTX A;  2UWR A;  3LAQ U;  1FF4 A;  1LSI A;  3KFD E;  2L5S A;  1HC9 B;  2NBT A;  1B41 B;  1CDQ A;  1HAA A;  1L4W A;  1KL8 A;  2VLW A;  3NEQ A;  1F94 A;  4UY2 C;  2H64 B;  2BTX A;  5DZ5 A;  5IMT D;  1JGK A;  1FAS A;  1COE A;  1IDL A;  1HAJ A;  2MJ4 A;  1KBS A;  2JQP A;  1TFS A;  3QB4 B;  4OM4 A;  3BT1 U;  4RUD A;  1NOR A;  4KSN A;  2CDX A;  1IKC A;  1KFH A;  4HQP F;  1CRF A;  1S4Y A;  1KU6 B;  3VTS A;  1H0J A;  3ERA A;  5DU1 A;  1KTZ B;  1VB0 A;  1IDI A;  1V6P A;  1PLO A;  2HLQ A;  4P7U A;  4AEA A;  1KS6 A;  1NXB A;  1BTE A;  1NYU A;  3KFD I;  3PLC A;  2ABX A;  3NDS A;  1XT3 A;  2CRS A;  4XJJ A;  2GOO B;  5DO6 A;  2H7Z B;  1UG4 A;  2LA1 A;  1IK8 A;  1BXP A;  1KBT A;  1RL5 A;  1CHV S;  1CB9 A;  1I02 A;  2J8B A;  3NH7 A;  2JVE A;  2I9B E;  1RGJ A;  1HC9 A;  1KC4 A;  1QKD A;  1NEA A;  1CRE A;  1COD A;  1W6B A;  1REW C;  1JE9 A;  1CDR A;  2MUO A;  1LXG A;  4QTI U;  2H8U A;  3BT2 U;  4FAO C;  1KXI A;  1NTX A;  4DO8 A;  1TXA A;  2CTX A;  2CCX A;  1JBD A;  1ONJ A;  1FSS B;  2PJY C;  2H7Z A;  1TXB A;  1LX5 B;  3U74 U;  1ABT A;  3U73 U;  1G6M A;  1ERG A;  1TGX A;  2H62 D;  2LCR A;  2QJB C;  2H5F A;  3FEV A;  1ZAD A;  5EBX A;  2QJA C;  1NTN A;  1CXO A;  1ERA A;  2HLR A;  6EBX A;  2H62 C;  4FAO E;  1LXH A;  3EBX A;  2PJY B;  1M9Z A;  2OFS A; 
#chains in the Genus database with same CATH homology
 2UX2 A;  2MJY A;  1MR6 A;  1CXN A;  4LFT A;  2L03 A;  2MHY A;  1IQ9 A;  2X8B B;  1DRS A;  4ZQY A;  2K3G A;  4BIK B;  2QJ9 C;  1HOY A;  4OM5 A;  2MFA A;  2ERA A;  4IYE A;  1FFJ A;  1IDH A;  1IJC A;  2H64 C;  3HH7 A;  1ES7 B;  2CRT A;  2N99 A;  1YWH A;  1LJZ A;  1QM7 A;  1MAH F;  1CDT A;  1CVO A;  4BDT B;  2BHI A;  3EVS C;  1FSC A;  1IDG A;  1CDS A;  2QC1 A;  1CCQ A;  1NYS A;  2GOO C;  5IMY C;  1KBA A;  2MJ0 A;  1F8U B;  1QKE A;  2MUP A;  4EY8 B;  1FRA A;  2FD6 U;  1CTX A;  2UWR A;  3LAQ U;  1FF4 A;  1LSI A;  3KFD E;  2L5S A;  1HC9 B;  2NBT A;  1B41 B;  1CDQ A;  1HAA A;  1L4W A;  1KL8 A;  2VLW A;  3NEQ A;  1F94 A;  4UY2 C;  2H64 B;  2BTX A;  5DZ5 A;  5IMT D;  1JGK A;  1FAS A;  1COE A;  1IDL A;  1HAJ A;  2MJ4 A;  1KBS A;  2JQP A;  1TFS A;  3QB4 B;  4OM4 A;  3BT1 U;  4RUD A;  1NOR A;  4KSN A;  2CDX A;  1IKC A;  1KFH A;  4HQP F;  1CRF A;  1S4Y A;  1KU6 B;  3VTS A;  1H0J A;  3ERA A;  5DU1 A;  1KTZ B;  1VB0 A;  1IDI A;  1V6P A;  1PLO A;  2HLQ A;  4P7U A;  4AEA A;  1KS6 A;  1NXB A;  1BTE A;  1NYU A;  3KFD I;  3PLC A;  2ABX A;  3NDS A;  1XT3 A;  2CRS A;  4XJJ A;  2GOO B;  5DO6 A;  2H7Z B;  1UG4 A;  2LA1 A;  1IK8 A;  1BXP A;  1KBT A;  1RL5 A;  1CHV S;  1CB9 A;  1I02 A;  2J8B A;  3NH7 A;  2JVE A;  2I9B E;  1RGJ A;  1HC9 A;  1KC4 A;  1QKD A;  1NEA A;  1CRE A;  1COD A;  1W6B A;  1REW C;  1JE9 A;  1CDR A;  2MUO A;  1LXG A;  4QTI U;  2H8U A;  3BT2 U;  4FAO C;  1KXI A;  1NTX A;  4DO8 A;  1TXA A;  2CTX A;  2CCX A;  1JBD A;  1ONJ A;  1FSS B;  2PJY C;  2H7Z A;  1TXB A;  1LX5 B;  3U74 U;  1ABT A;  3U73 U;  1G6M A;  1ERG A;  1TGX A;  2H62 D;  2LCR A;  2QJB C;  2H5F A;  3FEV A;  1ZAD A;  5EBX A;  2QJA C;  1NTN A;  1CXO A;  1ERA A;  2HLR A;  6EBX A;  2H62 C;  4FAO E;  1LXH A;  3EBX A;  2PJY B;  1M9Z A;  2OFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...