1CRFA

Cardiotoxin ii from taiwan cobra venom, naja naja atra: structure in solution and comparision among homologous cardiotoxins
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cardiotoxin II from Taiwan cobra venom, Naja naja atra. Structure in solution and comparison among homologous cardiotoxins.
pubmed rcsb
source organism Naja atra
molecule tags Cardiotoxin
molecule keywords CARDIOTOXIN II
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1crfA00
1CDTA 1LJZA 2QJAC 2CDXA 1ONJA 2MUPA 1CB9A 2QJ9C 1ABTA 1LX5B 5DZ5A 3BT2U 3PLCA 1TXAA 2LA1A 3QB4B 1TFSA 1B41B 1JGKA 1KS6A 2MUOA 2PJYC 3NEQA 1IDHA 2H62C 1PLOA 1RL5A 1IKCA 2H62D 1CXOA 2H64C 1HOYA 1NEAA 4EY8B 1CDRA 1CTXA 2GOOC 1CDQA 1MR6A 2VLWA 1UG4A 1HAAA 2K3GA 2H5FA 1KL8A 1BTEA 1REWC 5DU1A 1MAHF 3EBXA 2CRSA 2LCRA 1TXBA 2X8BB 1LXHA 4OM5A 2GOOB 2MFAA 1FASA 1QKDA 4HQPF 2J8BA 4BIKB 1HC9B 2L03A 4FAOC 3KFDI 3EVSC 1COEA 2HLQA 1KFHA 1W6BA 2ABXA 1KXIA 4DO8A 1BXPA 3KFDE 1ES7B 2UWRA 5DO6A 1KTZB 2UX2A 4LFTA 1KBTA 1QM7A 1G6MA 1ERAA 1QKEA 1H0JA 2JVEA 1IK8A 1CREA 1CODA 1NORA 4UY2C 1FFJA 1CRFA 1LSIA 2QC1A 1KBSA 4RUDA 1IDIA 1KU6B 4XJJA 4QTIU 5IMYC 1CHVS 3VTSA 1M9ZA 1KC4A 1FRAA 1IDLA 3U73U 1TGXA 4IYEA 1KBAA 4P7UA 1FF4A 3NDSA 5IMTD 1CCQA 1HAJA 1NYSA 1JE9A 3LAQU 1ZADA 1CXNA 2H8UA 2CCXA 1F8UB 3BT1U 2I9BE 1NTNA 1NTXA 1V6PA 1FSSB 1RGJA 2MJ0A 2H7ZA 2MHYA 2H7ZB 2FD6U 3NH7A 1JBDA 1IJCA 2L5SA 1ERGA 1IQ9A 1DRSA 1FSCA 1LXGA 1VB0A 1I02A 1S4YA 4AEAA 6EBXA 1XT3A 2OFSA 1CDSA 4BDTB 1CVOA 3FEVA 1NYUA 4OM4A 1L4WA 1IDGA 2MJ4A 3U74U 2CRTA 2HLRA 2BHIA 2PJYB 1YWHA 4FAOE 2BTXA 1NXBA 2JQPA 2H64B 2N99A 1F94A 2MJYA 2QJBC 3HH7A 5EBXA 2ERAA 4ZQYA 1HC9A 3ERAA 2NBTA 2CTXA
chains in the Genus database with same CATH superfamily
1CDTA 1LJZA 2QJAC 2CDXA 1ONJA 2MUPA 1CB9A 2QJ9C 1ABTA 1LX5B 5DZ5A 3BT2U 3PLCA 1TXAA 2LA1A 3QB4B 1TFSA 1B41B 1JGKA 1KS6A 2MUOA 2PJYC 3NEQA 1IDHA 2H62C 1PLOA 1RL5A 1IKCA 2H62D 1CXOA 2H64C 1HOYA 1NEAA 4EY8B 1CDRA 1CTXA 2GOOC 1CDQA 1MR6A 2VLWA 1UG4A 1HAAA 2K3GA 2H5FA 1KL8A 1BTEA 1REWC 5DU1A 1MAHF 3EBXA 2CRSA 2LCRA 1TXBA 2X8BB 1LXHA 4OM5A 2GOOB 2MFAA 1FASA 1QKDA 4HQPF 2J8BA 4BIKB 1HC9B 2L03A 4FAOC 3KFDI 3EVSC 1COEA 2HLQA 1KFHA 1W6BA 2ABXA 1KXIA 4DO8A 1BXPA 3KFDE 1ES7B 2UWRA 5DO6A 1KTZB 2UX2A 4LFTA 1KBTA 1QM7A 1G6MA 1ERAA 1QKEA 1H0JA 2JVEA 1IK8A 1CREA 1CODA 1NORA 4UY2C 1FFJA 1CRFA 1LSIA 2QC1A 1KBSA 4RUDA 1IDIA 1KU6B 4XJJA 4QTIU 5IMYC 1CHVS 3VTSA 1M9ZA 1KC4A 1FRAA 1IDLA 3U73U 1TGXA 4IYEA 1KBAA 4P7UA 1FF4A 3NDSA 5IMTD 1CCQA 1HAJA 1NYSA 1JE9A 3LAQU 1ZADA 1CXNA 2H8UA 2CCXA 1F8UB 3BT1U 2I9BE 1NTNA 1NTXA 1V6PA 1FSSB 1RGJA 2MJ0A 2H7ZA 2MHYA 2H7ZB 2FD6U 3NH7A 1JBDA 1IJCA 2L5SA 1ERGA 1IQ9A 1DRSA 1FSCA 1LXGA 1VB0A 1I02A 1S4YA 4AEAA 6EBXA 1XT3A 2OFSA 1CDSA 4BDTB 1CVOA 3FEVA 1NYUA 4OM4A 1L4WA 1IDGA 2MJ4A 3U74U 2CRTA 2HLRA 2BHIA 2PJYB 1YWHA 4FAOE 2BTXA 1NXBA 2JQPA 2H64B 2N99A 1F94A 2MJYA 2QJBC 3HH7A 5EBXA 2ERAA 4ZQYA 1HC9A 3ERAA 4KSNA 2NBTA 2CTXA
chains in the Genus database with same CATH topology
1CDTA 1LJZA 2QJAC 2CDXA 1ONJA 2MUPA 1CB9A 2QJ9C 1ABTA 1LX5B 5DZ5A 3BT2U 3PLCA 1TXAA 2LA1A 3QB4B 1TFSA 1B41B 1JGKA 1KS6A 2MUOA 2PJYC 3NEQA 1IDHA 2H62C 1PLOA 1RL5A 1IKCA 2H62D 1CXOA 2H64C 1HOYA 1NEAA 4EY8B 1CDRA 1CTXA 2GOOC 1CDQA 1MR6A 2VLWA 1UG4A 1HAAA 2K3GA 2H5FA 1KL8A 1BTEA 1REWC 5DU1A 1MAHF 3EBXA 2CRSA 2LCRA 1TXBA 2X8BB 1LXHA 4OM5A 2GOOB 2MFAA 1FASA 1QKDA 4HQPF 2J8BA 4BIKB 1HC9B 2L03A 4FAOC 3KFDI 3EVSC 1COEA 2HLQA 1KFHA 1W6BA 2ABXA 1KXIA 4DO8A 1BXPA 3KFDE 1ES7B 2UWRA 5DO6A 1KTZB 2UX2A 4LFTA 1KBTA 1QM7A 1G6MA 1ERAA 1QKEA 1H0JA 2JVEA 1IK8A 1CREA 1CODA 1NORA 4UY2C 1FFJA 1CRFA 1LSIA 2QC1A 1KBSA 4RUDA 1IDIA 1KU6B 4XJJA 4QTIU 5IMYC 1CHVS 3VTSA 1M9ZA 1KC4A 1FRAA 1IDLA 3U73U 1TGXA 4IYEA 1KBAA 4P7UA 1FF4A 3NDSA 5IMTD 1CCQA 1HAJA 1NYSA 1JE9A 3LAQU 1ZADA 1CXNA 2H8UA 2CCXA 1F8UB 3BT1U 2I9BE 1NTNA 1NTXA 1V6PA 1FSSB 1RGJA 2MJ0A 2H7ZA 2MHYA 2H7ZB 2FD6U 3NH7A 1JBDA 1IJCA 2L5SA 1ERGA 1IQ9A 1DRSA 1FSCA 1LXGA 1VB0A 1I02A 1S4YA 4AEAA 6EBXA 1XT3A 2OFSA 1CDSA 4BDTB 1CVOA 3FEVA 1NYUA 4OM4A 1L4WA 1IDGA 2MJ4A 3U74U 2CRTA 2HLRA 2BHIA 2PJYB 1YWHA 4FAOE 2BTXA 1NXBA 2JQPA 2H64B 2N99A 1F94A 2MJYA 2QJBC 3HH7A 5EBXA 2ERAA 4ZQYA 1HC9A 3ERAA 4KSNA 2NBTA 2CTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CDT A;  1LJZ A;  2QJA C;  2CDX A;  1ONJ A;  2MUP A;  1CB9 A;  2QJ9 C;  1ABT A;  1LX5 B;  5DZ5 A;  3BT2 U;  3PLC A;  1TXA A;  2LA1 A;  3QB4 B;  1TFS A;  1B41 B;  1JGK A;  1KS6 A;  2MUO A;  2PJY C;  3NEQ A;  1IDH A;  2H62 C;  1PLO A;  1RL5 A;  1IKC A;  2H62 D;  1CXO A;  2H64 C;  1HOY A;  1NEA A;  4EY8 B;  1CDR A;  1CTX A;  2GOO C;  1CDQ A;  1MR6 A;  2VLW A;  1UG4 A;  1HAA A;  2K3G A;  2H5F A;  1KL8 A;  1BTE A;  1REW C;  5DU1 A;  1MAH F;  3EBX A;  2CRS A;  2LCR A;  1TXB A;  2X8B B;  1LXH A;  4OM5 A;  2GOO B;  2MFA A;  1FAS A;  1QKD A;  4HQP F;  2J8B A;  4BIK B;  1HC9 B;  2L03 A;  4FAO C;  3KFD I;  3EVS C;  1COE A;  2HLQ A;  1KFH A;  1W6B A;  2ABX A;  1KXI A;  4DO8 A;  1BXP A;  3KFD E;  1ES7 B;  2UWR A;  5DO6 A;  1KTZ B;  2UX2 A;  4LFT A;  1KBT A;  1QM7 A;  1G6M A;  1ERA A;  1QKE A;  1H0J A;  2JVE A;  1IK8 A;  1CRE A;  1COD A;  1NOR A;  4UY2 C;  1FFJ A;  1CRF A;  1LSI A;  2QC1 A;  1KBS A;  4RUD A;  1IDI A;  1KU6 B;  4XJJ A;  4QTI U;  5IMY C;  1CHV S;  3VTS A;  1M9Z A;  1KC4 A;  1FRA A;  1IDL A;  3U73 U;  1TGX A;  4IYE A;  1KBA A;  4P7U A;  1FF4 A;  3NDS A;  5IMT D;  1CCQ A;  1HAJ A;  1NYS A;  1JE9 A;  3LAQ U;  1ZAD A;  1CXN A;  2H8U A;  2CCX A;  1F8U B;  3BT1 U;  2I9B E;  1NTN A;  1NTX A;  1V6P A;  1FSS B;  1RGJ A;  2MJ0 A;  2H7Z A;  2MHY A;  2H7Z B;  2FD6 U;  3NH7 A;  1JBD A;  1IJC A;  2L5S A;  1ERG A;  1IQ9 A;  1DRS A;  1FSC A;  1LXG A;  1VB0 A;  1I02 A;  1S4Y A;  4AEA A;  6EBX A;  1XT3 A;  2OFS A;  1CDS A;  4BDT B;  1CVO A;  3FEV A;  1NYU A;  4OM4 A;  1L4W A;  1IDG A;  2MJ4 A;  3U74 U;  2CRT A;  2HLR A;  2BHI A;  2PJY B;  1YWH A;  4FAO E;  2BTX A;  1NXB A;  2JQP A;  2H64 B;  2N99 A;  1F94 A;  2MJY A;  2QJB C;  3HH7 A;  5EBX A;  2ERA A;  4ZQY A;  1HC9 A;  3ERA A;  2NBT A;  2CTX A; 
#chains in the Genus database with same CATH topology
 1CDT A;  1LJZ A;  2QJA C;  2CDX A;  1ONJ A;  2MUP A;  1CB9 A;  2QJ9 C;  1ABT A;  1LX5 B;  5DZ5 A;  3BT2 U;  3PLC A;  1TXA A;  2LA1 A;  3QB4 B;  1TFS A;  1B41 B;  1JGK A;  1KS6 A;  2MUO A;  2PJY C;  3NEQ A;  1IDH A;  2H62 C;  1PLO A;  1RL5 A;  1IKC A;  2H62 D;  1CXO A;  2H64 C;  1HOY A;  1NEA A;  4EY8 B;  1CDR A;  1CTX A;  2GOO C;  1CDQ A;  1MR6 A;  2VLW A;  1UG4 A;  1HAA A;  2K3G A;  2H5F A;  1KL8 A;  1BTE A;  1REW C;  5DU1 A;  1MAH F;  3EBX A;  2CRS A;  2LCR A;  1TXB A;  2X8B B;  1LXH A;  4OM5 A;  2GOO B;  2MFA A;  1FAS A;  1QKD A;  4HQP F;  2J8B A;  4BIK B;  1HC9 B;  2L03 A;  4FAO C;  3KFD I;  3EVS C;  1COE A;  2HLQ A;  1KFH A;  1W6B A;  2ABX A;  1KXI A;  4DO8 A;  1BXP A;  3KFD E;  1ES7 B;  2UWR A;  5DO6 A;  1KTZ B;  2UX2 A;  4LFT A;  1KBT A;  1QM7 A;  1G6M A;  1ERA A;  1QKE A;  1H0J A;  2JVE A;  1IK8 A;  1CRE A;  1COD A;  1NOR A;  4UY2 C;  1FFJ A;  1CRF A;  1LSI A;  2QC1 A;  1KBS A;  4RUD A;  1IDI A;  1KU6 B;  4XJJ A;  4QTI U;  5IMY C;  1CHV S;  3VTS A;  1M9Z A;  1KC4 A;  1FRA A;  1IDL A;  3U73 U;  1TGX A;  4IYE A;  1KBA A;  4P7U A;  1FF4 A;  3NDS A;  5IMT D;  1CCQ A;  1HAJ A;  1NYS A;  1JE9 A;  3LAQ U;  1ZAD A;  1CXN A;  2H8U A;  2CCX A;  1F8U B;  3BT1 U;  2I9B E;  1NTN A;  1NTX A;  1V6P A;  1FSS B;  1RGJ A;  2MJ0 A;  2H7Z A;  2MHY A;  2H7Z B;  2FD6 U;  3NH7 A;  1JBD A;  1IJC A;  2L5S A;  1ERG A;  1IQ9 A;  1DRS A;  1FSC A;  1LXG A;  1VB0 A;  1I02 A;  1S4Y A;  4AEA A;  6EBX A;  1XT3 A;  2OFS A;  1CDS A;  4BDT B;  1CVO A;  3FEV A;  1NYU A;  4OM4 A;  1L4W A;  1IDG A;  2MJ4 A;  3U74 U;  2CRT A;  2HLR A;  2BHI A;  2PJY B;  1YWH A;  4FAO E;  2BTX A;  1NXB A;  2JQP A;  2H64 B;  2N99 A;  1F94 A;  2MJY A;  2QJB C;  3HH7 A;  5EBX A;  2ERA A;  4ZQY A;  1HC9 A;  3ERA A;  4KSN A;  2NBT A;  2CTX A; 
#chains in the Genus database with same CATH homology
 1CDT A;  1LJZ A;  2QJA C;  2CDX A;  1ONJ A;  2MUP A;  1CB9 A;  2QJ9 C;  1ABT A;  1LX5 B;  5DZ5 A;  3BT2 U;  3PLC A;  1TXA A;  2LA1 A;  3QB4 B;  1TFS A;  1B41 B;  1JGK A;  1KS6 A;  2MUO A;  2PJY C;  3NEQ A;  1IDH A;  2H62 C;  1PLO A;  1RL5 A;  1IKC A;  2H62 D;  1CXO A;  2H64 C;  1HOY A;  1NEA A;  4EY8 B;  1CDR A;  1CTX A;  2GOO C;  1CDQ A;  1MR6 A;  2VLW A;  1UG4 A;  1HAA A;  2K3G A;  2H5F A;  1KL8 A;  1BTE A;  1REW C;  5DU1 A;  1MAH F;  3EBX A;  2CRS A;  2LCR A;  1TXB A;  2X8B B;  1LXH A;  4OM5 A;  2GOO B;  2MFA A;  1FAS A;  1QKD A;  4HQP F;  2J8B A;  4BIK B;  1HC9 B;  2L03 A;  4FAO C;  3KFD I;  3EVS C;  1COE A;  2HLQ A;  1KFH A;  1W6B A;  2ABX A;  1KXI A;  4DO8 A;  1BXP A;  3KFD E;  1ES7 B;  2UWR A;  5DO6 A;  1KTZ B;  2UX2 A;  4LFT A;  1KBT A;  1QM7 A;  1G6M A;  1ERA A;  1QKE A;  1H0J A;  2JVE A;  1IK8 A;  1CRE A;  1COD A;  1NOR A;  4UY2 C;  1FFJ A;  1CRF A;  1LSI A;  2QC1 A;  1KBS A;  4RUD A;  1IDI A;  1KU6 B;  4XJJ A;  4QTI U;  5IMY C;  1CHV S;  3VTS A;  1M9Z A;  1KC4 A;  1FRA A;  1IDL A;  3U73 U;  1TGX A;  4IYE A;  1KBA A;  4P7U A;  1FF4 A;  3NDS A;  5IMT D;  1CCQ A;  1HAJ A;  1NYS A;  1JE9 A;  3LAQ U;  1ZAD A;  1CXN A;  2H8U A;  2CCX A;  1F8U B;  3BT1 U;  2I9B E;  1NTN A;  1NTX A;  1V6P A;  1FSS B;  1RGJ A;  2MJ0 A;  2H7Z A;  2MHY A;  2H7Z B;  2FD6 U;  3NH7 A;  1JBD A;  1IJC A;  2L5S A;  1ERG A;  1IQ9 A;  1DRS A;  1FSC A;  1LXG A;  1VB0 A;  1I02 A;  1S4Y A;  4AEA A;  6EBX A;  1XT3 A;  2OFS A;  1CDS A;  4BDT B;  1CVO A;  3FEV A;  1NYU A;  4OM4 A;  1L4W A;  1IDG A;  2MJ4 A;  3U74 U;  2CRT A;  2HLR A;  2BHI A;  2PJY B;  1YWH A;  4FAO E;  2BTX A;  1NXB A;  2JQP A;  2H64 B;  2N99 A;  1F94 A;  2MJY A;  2QJB C;  3HH7 A;  5EBX A;  2ERA A;  4ZQY A;  1HC9 A;  3ERA A;  4KSN A;  2NBT A;  2CTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...