1FRAA

Tertiary structure of erabutoxin b in aqueous solution elucidated by two-dimensional nuclear magnetic resonance
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure of erabutoxin b in aqueous solution as elucidated by two-dimensional nuclear magnetic resonance.
pubmed doi rcsb
source organism Laticauda semifasciata
molecule tags Toxin
molecule keywords ERABUTOXIN B
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1994-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1fraA00
1IKCA 2MJ0A 1W6BA 3EVSC 2MJYA 2CTXA 2LCRA 1QM7A 2MHYA 1IQ9A 1NTNA 1CREA 1CDRA 1ERAA 1CB9A 1CXNA 1F94A 1BXPA 2MUPA 4XJJA 2UWRA 1CDTA 4FAOE 1FRAA 1KU6B 2MFAA 1RL5A 2QJ9C 2PJYC 4BDTB 1COEA 2NBTA 1IDLA 1I02A 2PJYB 1VB0A 1JBDA 2MJ4A 1NEAA 4ZQYA 1IJCA 1MR6A 6EBXA 1TGXA 1HAAA 1M9ZA 4HQPF 2ERAA 2QC1A 1HAJA 3QB4B 1NTXA 1IDIA 1FSSB 1KXIA 2H7ZB 1RGJA 1BTEA 2MUOA 1CVOA 2CRTA 1YWHA 1QKDA 1F8UB 4DO8A 1KS6A 1LSIA 2HLQA 4QTIU 1UG4A 4IYEA 1G6MA 1MAHF 1ES7B 2H5FA 2X8BB 1FFJA 1XT3A 2JVEA 1CXOA 1IDGA 2CCXA 5DO6A 2H62C 2FD6U 1REWC 2QJBC 1HC9B 2LA1A 4FAOC 1L4WA 3LAQU 1ONJA 5DZ5A 2GOOB 4OM4A 1V6PA 2ABXA 4BIKB 5IMTD 1IK8A 2H8UA 3KFDI 3KFDE 2BHIA 3NDSA 4AEAA 2HLRA 1TXBA 1NORA 1CDSA 2GOOC 1KBAA 1HC9A 1ZADA 3FEVA 1ERGA 1CHVS 5DU1A 1FASA 2H64B 1S4YA 3U73U 2L03A 2OFSA 3EBXA 1H0JA 2UX2A 1KBTA 2JQPA 1LJZA 4OM5A 1LX5B 1NYUA 1JE9A 2VLWA 1CODA 2H62D 4RUDA 3NH7A 1TFSA 1FSCA 2I9BE 1NXBA 3PLCA 4P7UA 1KTZB 4EY8B 1NYSA 1DRSA 1TXAA 1KFHA 1ABTA 2J8BA 1CTXA 1JGKA 2QJAC 3HH7A 1KC4A 1KBSA 1LXGA 2K3GA 1FF4A 5EBXA 1QKEA 3ERAA 3NEQA 3U74U 1CRFA 2H7ZA 1PLOA 4LFTA 2BTXA 2H64C 1IDHA 1HOYA 1LXHA 5IMYC 2L5SA 4UY2C 3VTSA 1CDQA 1CCQA 2N99A 3BT2U 2CRSA 3BT1U 1KL8A 1B41B 2CDXA
chains in the Genus database with same CATH superfamily
1IKCA 2MJ0A 1W6BA 3EVSC 2MJYA 2CTXA 2LCRA 1QM7A 2MHYA 1IQ9A 1NTNA 1CREA 1CDRA 1ERAA 1CB9A 1CXNA 1F94A 1BXPA 2MUPA 4XJJA 2UWRA 1CDTA 4FAOE 1FRAA 1KU6B 2MFAA 1RL5A 2QJ9C 2PJYC 4BDTB 1COEA 2NBTA 1IDLA 1I02A 2PJYB 1VB0A 1JBDA 2MJ4A 1NEAA 4ZQYA 1IJCA 1MR6A 6EBXA 1TGXA 1HAAA 1M9ZA 4HQPF 2ERAA 2QC1A 1HAJA 3QB4B 1NTXA 1IDIA 1FSSB 1KXIA 2H7ZB 1RGJA 1BTEA 2MUOA 4KSNA 1CVOA 2CRTA 1YWHA 1QKDA 1F8UB 4DO8A 1KS6A 1LSIA 2HLQA 4QTIU 1UG4A 4IYEA 1G6MA 1MAHF 1ES7B 2H5FA 2X8BB 1FFJA 1XT3A 2JVEA 1CXOA 1IDGA 2CCXA 5DO6A 2H62C 2FD6U 1REWC 2QJBC 1HC9B 2LA1A 4FAOC 1L4WA 3LAQU 1ONJA 5DZ5A 2GOOB 4OM4A 1V6PA 2ABXA 4BIKB 5IMTD 1IK8A 2H8UA 3KFDI 3KFDE 2BHIA 3NDSA 4AEAA 2HLRA 1TXBA 1NORA 1CDSA 2GOOC 1KBAA 1HC9A 1ZADA 3FEVA 1ERGA 1CHVS 5DU1A 1FASA 2H64B 1S4YA 3U73U 2L03A 2OFSA 3EBXA 1H0JA 2UX2A 1KBTA 2JQPA 1LJZA 4OM5A 1LX5B 1NYUA 1JE9A 2VLWA 1CODA 2H62D 4RUDA 3NH7A 1TFSA 1FSCA 2I9BE 1NXBA 3PLCA 4P7UA 1KTZB 4EY8B 1NYSA 1DRSA 1TXAA 1KFHA 1ABTA 2J8BA 1CTXA 1JGKA 2QJAC 3HH7A 1KC4A 1KBSA 1LXGA 2K3GA 1FF4A 5EBXA 1QKEA 3ERAA 3NEQA 3U74U 1CRFA 2H7ZA 1PLOA 4LFTA 2BTXA 2H64C 1IDHA 1HOYA 1LXHA 5IMYC 2L5SA 4UY2C 3VTSA 1CDQA 1CCQA 2N99A 3BT2U 2CRSA 3BT1U 1KL8A 1B41B 2CDXA
chains in the Genus database with same CATH topology
1IKCA 2MJ0A 1W6BA 3EVSC 2MJYA 2CTXA 2LCRA 1QM7A 2MHYA 1IQ9A 1NTNA 1CREA 1CDRA 1ERAA 1CB9A 1CXNA 1F94A 1BXPA 2MUPA 4XJJA 2UWRA 1CDTA 4FAOE 1FRAA 1KU6B 2MFAA 1RL5A 2QJ9C 2PJYC 4BDTB 1COEA 2NBTA 1IDLA 1I02A 2PJYB 1VB0A 1JBDA 2MJ4A 1NEAA 4ZQYA 1IJCA 1MR6A 6EBXA 1TGXA 1HAAA 1M9ZA 4HQPF 2ERAA 2QC1A 1HAJA 3QB4B 1NTXA 1IDIA 1FSSB 1KXIA 2H7ZB 1RGJA 1BTEA 2MUOA 4KSNA 1CVOA 2CRTA 1YWHA 1QKDA 1F8UB 4DO8A 1KS6A 1LSIA 2HLQA 4QTIU 1UG4A 4IYEA 1G6MA 1MAHF 1ES7B 2H5FA 2X8BB 1FFJA 1XT3A 2JVEA 1CXOA 1IDGA 2CCXA 5DO6A 2H62C 2FD6U 1REWC 2QJBC 1HC9B 2LA1A 4FAOC 1L4WA 3LAQU 1ONJA 5DZ5A 2GOOB 4OM4A 1V6PA 2ABXA 4BIKB 5IMTD 1IK8A 2H8UA 3KFDI 3KFDE 2BHIA 3NDSA 4AEAA 2HLRA 1TXBA 1NORA 1CDSA 2GOOC 1KBAA 1HC9A 1ZADA 3FEVA 1ERGA 1CHVS 5DU1A 1FASA 2H64B 1S4YA 3U73U 2L03A 2OFSA 3EBXA 1H0JA 2UX2A 1KBTA 2JQPA 1LJZA 4OM5A 1LX5B 1NYUA 1JE9A 2VLWA 1CODA 2H62D 4RUDA 3NH7A 1TFSA 1FSCA 2I9BE 1NXBA 3PLCA 4P7UA 1KTZB 4EY8B 1NYSA 1DRSA 1TXAA 1KFHA 1ABTA 2J8BA 1CTXA 1JGKA 2QJAC 3HH7A 1KC4A 1KBSA 1LXGA 2K3GA 1FF4A 5EBXA 1QKEA 3ERAA 3NEQA 3U74U 1CRFA 2H7ZA 1PLOA 4LFTA 2BTXA 2H64C 1IDHA 1HOYA 1LXHA 5IMYC 2L5SA 4UY2C 3VTSA 1CDQA 1CCQA 2N99A 3BT2U 2CRSA 3BT1U 1KL8A 1B41B 2CDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKC A;  2MJ0 A;  1W6B A;  3EVS C;  2MJY A;  2CTX A;  2LCR A;  1QM7 A;  2MHY A;  1IQ9 A;  1NTN A;  1CRE A;  1CDR A;  1ERA A;  1CB9 A;  1CXN A;  1F94 A;  1BXP A;  2MUP A;  4XJJ A;  2UWR A;  1CDT A;  4FAO E;  1FRA A;  1KU6 B;  2MFA A;  1RL5 A;  2QJ9 C;  2PJY C;  4BDT B;  1COE A;  2NBT A;  1IDL A;  1I02 A;  2PJY B;  1VB0 A;  1JBD A;  2MJ4 A;  1NEA A;  4ZQY A;  1IJC A;  1MR6 A;  6EBX A;  1TGX A;  1HAA A;  1M9Z A;  4HQP F;  2ERA A;  2QC1 A;  1HAJ A;  3QB4 B;  1NTX A;  1IDI A;  1FSS B;  1KXI A;  2H7Z B;  1RGJ A;  1BTE A;  2MUO A;  1CVO A;  2CRT A;  1YWH A;  1QKD A;  1F8U B;  4DO8 A;  1KS6 A;  1LSI A;  2HLQ A;  4QTI U;  1UG4 A;  4IYE A;  1G6M A;  1MAH F;  1ES7 B;  2H5F A;  2X8B B;  1FFJ A;  1XT3 A;  2JVE A;  1CXO A;  1IDG A;  2CCX A;  5DO6 A;  2H62 C;  2FD6 U;  1REW C;  2QJB C;  1HC9 B;  2LA1 A;  4FAO C;  1L4W A;  3LAQ U;  1ONJ A;  5DZ5 A;  2GOO B;  4OM4 A;  1V6P A;  2ABX A;  4BIK B;  5IMT D;  1IK8 A;  2H8U A;  3KFD I;  3KFD E;  2BHI A;  3NDS A;  4AEA A;  2HLR A;  1TXB A;  1NOR A;  1CDS A;  2GOO C;  1KBA A;  1HC9 A;  1ZAD A;  3FEV A;  1ERG A;  1CHV S;  5DU1 A;  1FAS A;  2H64 B;  1S4Y A;  3U73 U;  2L03 A;  2OFS A;  3EBX A;  1H0J A;  2UX2 A;  1KBT A;  2JQP A;  1LJZ A;  4OM5 A;  1LX5 B;  1NYU A;  1JE9 A;  2VLW A;  1COD A;  2H62 D;  4RUD A;  3NH7 A;  1TFS A;  1FSC A;  2I9B E;  1NXB A;  3PLC A;  4P7U A;  1KTZ B;  4EY8 B;  1NYS A;  1DRS A;  1TXA A;  1KFH A;  1ABT A;  2J8B A;  1CTX A;  1JGK A;  2QJA C;  3HH7 A;  1KC4 A;  1KBS A;  1LXG A;  2K3G A;  1FF4 A;  5EBX A;  1QKE A;  3ERA A;  3NEQ A;  3U74 U;  1CRF A;  2H7Z A;  1PLO A;  4LFT A;  2BTX A;  2H64 C;  1IDH A;  1HOY A;  1LXH A;  5IMY C;  2L5S A;  4UY2 C;  3VTS A;  1CDQ A;  1CCQ A;  2N99 A;  3BT2 U;  2CRS A;  3BT1 U;  1KL8 A;  1B41 B;  2CDX A; 
#chains in the Genus database with same CATH topology
 1IKC A;  2MJ0 A;  1W6B A;  3EVS C;  2MJY A;  2CTX A;  2LCR A;  1QM7 A;  2MHY A;  1IQ9 A;  1NTN A;  1CRE A;  1CDR A;  1ERA A;  1CB9 A;  1CXN A;  1F94 A;  1BXP A;  2MUP A;  4XJJ A;  2UWR A;  1CDT A;  4FAO E;  1FRA A;  1KU6 B;  2MFA A;  1RL5 A;  2QJ9 C;  2PJY C;  4BDT B;  1COE A;  2NBT A;  1IDL A;  1I02 A;  2PJY B;  1VB0 A;  1JBD A;  2MJ4 A;  1NEA A;  4ZQY A;  1IJC A;  1MR6 A;  6EBX A;  1TGX A;  1HAA A;  1M9Z A;  4HQP F;  2ERA A;  2QC1 A;  1HAJ A;  3QB4 B;  1NTX A;  1IDI A;  1FSS B;  1KXI A;  2H7Z B;  1RGJ A;  1BTE A;  2MUO A;  4KSN A;  1CVO A;  2CRT A;  1YWH A;  1QKD A;  1F8U B;  4DO8 A;  1KS6 A;  1LSI A;  2HLQ A;  4QTI U;  1UG4 A;  4IYE A;  1G6M A;  1MAH F;  1ES7 B;  2H5F A;  2X8B B;  1FFJ A;  1XT3 A;  2JVE A;  1CXO A;  1IDG A;  2CCX A;  5DO6 A;  2H62 C;  2FD6 U;  1REW C;  2QJB C;  1HC9 B;  2LA1 A;  4FAO C;  1L4W A;  3LAQ U;  1ONJ A;  5DZ5 A;  2GOO B;  4OM4 A;  1V6P A;  2ABX A;  4BIK B;  5IMT D;  1IK8 A;  2H8U A;  3KFD I;  3KFD E;  2BHI A;  3NDS A;  4AEA A;  2HLR A;  1TXB A;  1NOR A;  1CDS A;  2GOO C;  1KBA A;  1HC9 A;  1ZAD A;  3FEV A;  1ERG A;  1CHV S;  5DU1 A;  1FAS A;  2H64 B;  1S4Y A;  3U73 U;  2L03 A;  2OFS A;  3EBX A;  1H0J A;  2UX2 A;  1KBT A;  2JQP A;  1LJZ A;  4OM5 A;  1LX5 B;  1NYU A;  1JE9 A;  2VLW A;  1COD A;  2H62 D;  4RUD A;  3NH7 A;  1TFS A;  1FSC A;  2I9B E;  1NXB A;  3PLC A;  4P7U A;  1KTZ B;  4EY8 B;  1NYS A;  1DRS A;  1TXA A;  1KFH A;  1ABT A;  2J8B A;  1CTX A;  1JGK A;  2QJA C;  3HH7 A;  1KC4 A;  1KBS A;  1LXG A;  2K3G A;  1FF4 A;  5EBX A;  1QKE A;  3ERA A;  3NEQ A;  3U74 U;  1CRF A;  2H7Z A;  1PLO A;  4LFT A;  2BTX A;  2H64 C;  1IDH A;  1HOY A;  1LXH A;  5IMY C;  2L5S A;  4UY2 C;  3VTS A;  1CDQ A;  1CCQ A;  2N99 A;  3BT2 U;  2CRS A;  3BT1 U;  1KL8 A;  1B41 B;  2CDX A; 
#chains in the Genus database with same CATH homology
 1IKC A;  2MJ0 A;  1W6B A;  3EVS C;  2MJY A;  2CTX A;  2LCR A;  1QM7 A;  2MHY A;  1IQ9 A;  1NTN A;  1CRE A;  1CDR A;  1ERA A;  1CB9 A;  1CXN A;  1F94 A;  1BXP A;  2MUP A;  4XJJ A;  2UWR A;  1CDT A;  4FAO E;  1FRA A;  1KU6 B;  2MFA A;  1RL5 A;  2QJ9 C;  2PJY C;  4BDT B;  1COE A;  2NBT A;  1IDL A;  1I02 A;  2PJY B;  1VB0 A;  1JBD A;  2MJ4 A;  1NEA A;  4ZQY A;  1IJC A;  1MR6 A;  6EBX A;  1TGX A;  1HAA A;  1M9Z A;  4HQP F;  2ERA A;  2QC1 A;  1HAJ A;  3QB4 B;  1NTX A;  1IDI A;  1FSS B;  1KXI A;  2H7Z B;  1RGJ A;  1BTE A;  2MUO A;  4KSN A;  1CVO A;  2CRT A;  1YWH A;  1QKD A;  1F8U B;  4DO8 A;  1KS6 A;  1LSI A;  2HLQ A;  4QTI U;  1UG4 A;  4IYE A;  1G6M A;  1MAH F;  1ES7 B;  2H5F A;  2X8B B;  1FFJ A;  1XT3 A;  2JVE A;  1CXO A;  1IDG A;  2CCX A;  5DO6 A;  2H62 C;  2FD6 U;  1REW C;  2QJB C;  1HC9 B;  2LA1 A;  4FAO C;  1L4W A;  3LAQ U;  1ONJ A;  5DZ5 A;  2GOO B;  4OM4 A;  1V6P A;  2ABX A;  4BIK B;  5IMT D;  1IK8 A;  2H8U A;  3KFD I;  3KFD E;  2BHI A;  3NDS A;  4AEA A;  2HLR A;  1TXB A;  1NOR A;  1CDS A;  2GOO C;  1KBA A;  1HC9 A;  1ZAD A;  3FEV A;  1ERG A;  1CHV S;  5DU1 A;  1FAS A;  2H64 B;  1S4Y A;  3U73 U;  2L03 A;  2OFS A;  3EBX A;  1H0J A;  2UX2 A;  1KBT A;  2JQP A;  1LJZ A;  4OM5 A;  1LX5 B;  1NYU A;  1JE9 A;  2VLW A;  1COD A;  2H62 D;  4RUD A;  3NH7 A;  1TFS A;  1FSC A;  2I9B E;  1NXB A;  3PLC A;  4P7U A;  1KTZ B;  4EY8 B;  1NYS A;  1DRS A;  1TXA A;  1KFH A;  1ABT A;  2J8B A;  1CTX A;  1JGK A;  2QJA C;  3HH7 A;  1KC4 A;  1KBS A;  1LXG A;  2K3G A;  1FF4 A;  5EBX A;  1QKE A;  3ERA A;  3NEQ A;  3U74 U;  1CRF A;  2H7Z A;  1PLO A;  4LFT A;  2BTX A;  2H64 C;  1IDH A;  1HOY A;  1LXH A;  5IMY C;  2L5S A;  4UY2 C;  3VTS A;  1CDQ A;  1CCQ A;  2N99 A;  3BT2 U;  2CRS A;  3BT1 U;  1KL8 A;  1B41 B;  2CDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...