1IDLA

The nmr solution structure of alpha-bungarotoxin
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the complex formed between alpha-bungarotoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica.
pubmed doi rcsb
molecule tags Toxin
molecule keywords ALPHA-BUNGAROTOXIN
total genus 2
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1idlA00
1TFSA 2H7ZA 1FASA 1F94A 1JGKA 1TXAA 1DRSA 2I9BE 2H62D 5DZ5A 2MUPA 2H64B 3LAQU 2JQPA 1IDLA 4HQPF 3PLCA 3NH7A 3KFDI 4IYEA 1HC9B 1LXGA 1B41B 1VB0A 2QJAC 2ABXA 1F8UB 6EBXA 2UWRA 1CDQA 4FAOC 1CCQA 2MJ4A 2BHIA 2H5FA 1KXIA 1TXBA 2J8BA 3KFDE 3BT2U 1L4WA 4AEAA 3U73U 1ERAA 3NEQA 1NYSA 1LX5B 2BTXA 1NORA 1CXNA 2JVEA 2QJBC 1H0JA 1PLOA 1W6BA 2CDXA 4LFTA 2X8BB 1BTEA 1COEA 2CCXA 4P7UA 1QM7A 2H8UA 2VLWA 3VTSA 1HAJA 1RGJA 1KFHA 3EVSC 1FSSB 1S4YA 1JBDA 5EBXA 1FSCA 1MAHF 1CREA 1LXHA 1KBAA 1ABTA 1NTNA 1NXBA 4XJJA 1IDHA 1NYUA 3QB4B 2GOOB 2PJYB 4EY8B 3ERAA 2CRTA 1YWHA 1KTZB 1CB9A 2H64C 1KL8A 1G6MA 1KC4A 4OM5A 1LJZA 1UG4A 1CXOA 2L5SA 2NBTA 1CODA 1CTXA 1HOYA 1ES7B 2FD6U 2GOOC 2PJYC 5IMTD 2QC1A 1IJCA 3BT1U 2K3GA 3FEVA 1HC9A 1TGXA 2H62C 1FRAA 1CDSA 1ZADA 1KBSA 2LA1A 1KS6A 1V6PA 2LCRA 2MHYA 1QKDA 5DU1A 1IDGA 4FAOE 1CRFA 2MUOA 2CRSA 1RL5A 1IKCA 1CDRA 1CHVS 1KU6B 3EBXA 4QTIU 3U74U 1IQ9A 2ERAA 4DO8A 4ZQYA 1REWC 1ONJA 2HLQA 5IMYC 1ERGA 1FFJA 1CDTA 1IK8A 1QKEA 2MJ0A 2MJYA 1KBTA 2H7ZB 4BDTB 1JE9A 1BXPA 3NDSA 2UX2A 2N99A 2OFSA 2CTXA 4UY2C 5DO6A 1IDIA 4RUDA 1M9ZA 1XT3A 2QJ9C 4BIKB 2L03A 4OM4A 1HAAA 1FF4A 3HH7A 1MR6A 1NEAA 1NTXA 2HLRA 1I02A 1CVOA 1LSIA 2MFAA
chains in the Genus database with same CATH superfamily
1TFSA 2H7ZA 1FASA 1F94A 1JGKA 1TXAA 1DRSA 2I9BE 2H62D 5DZ5A 2MUPA 2H64B 3LAQU 2JQPA 1IDLA 4HQPF 3PLCA 3NH7A 3KFDI 4IYEA 1HC9B 1LXGA 1B41B 1VB0A 2QJAC 2ABXA 1F8UB 6EBXA 2UWRA 1CDQA 4FAOC 1CCQA 2MJ4A 2BHIA 2H5FA 1KXIA 1TXBA 2J8BA 3KFDE 3BT2U 1L4WA 4AEAA 3U73U 1ERAA 3NEQA 1NYSA 1LX5B 2BTXA 1NORA 1CXNA 2JVEA 2QJBC 1H0JA 1PLOA 1W6BA 2CDXA 4LFTA 2X8BB 1BTEA 1COEA 2CCXA 4P7UA 1QM7A 2H8UA 2VLWA 3VTSA 1HAJA 1RGJA 1KFHA 3EVSC 1FSSB 1S4YA 1JBDA 5EBXA 1FSCA 1MAHF 1CREA 1LXHA 1KBAA 1ABTA 1NTNA 1NXBA 4XJJA 1IDHA 1NYUA 3QB4B 2GOOB 2PJYB 4EY8B 3ERAA 2CRTA 1YWHA 1KTZB 1CB9A 2H64C 1KL8A 1G6MA 1KC4A 4OM5A 1LJZA 1UG4A 1CXOA 2L5SA 2NBTA 1CODA 1CTXA 1HOYA 1ES7B 2FD6U 2GOOC 2PJYC 5IMTD 2QC1A 1IJCA 3BT1U 2K3GA 3FEVA 1HC9A 1TGXA 2H62C 1FRAA 1CDSA 1ZADA 1KBSA 2LA1A 1KS6A 1V6PA 2LCRA 2MHYA 1QKDA 5DU1A 1IDGA 4FAOE 1CRFA 2MUOA 2CRSA 1RL5A 1IKCA 1CDRA 1CHVS 1KU6B 3EBXA 4KSNA 4QTIU 3U74U 1IQ9A 2ERAA 4DO8A 4ZQYA 1REWC 1ONJA 2HLQA 5IMYC 1ERGA 1FFJA 1CDTA 1IK8A 1QKEA 2MJ0A 2MJYA 1KBTA 2H7ZB 4BDTB 1JE9A 1BXPA 3NDSA 2UX2A 2N99A 2OFSA 2CTXA 4UY2C 5DO6A 1IDIA 4RUDA 1M9ZA 1XT3A 2QJ9C 4BIKB 2L03A 4OM4A 1HAAA 1FF4A 3HH7A 1MR6A 1NEAA 1NTXA 2HLRA 1I02A 1CVOA 1LSIA 2MFAA
chains in the Genus database with same CATH topology
1TFSA 2H7ZA 1FASA 1F94A 1JGKA 1TXAA 1DRSA 2I9BE 2H62D 5DZ5A 2MUPA 2H64B 3LAQU 2JQPA 1IDLA 4HQPF 3PLCA 3NH7A 3KFDI 4IYEA 1HC9B 1LXGA 1B41B 1VB0A 2QJAC 2ABXA 1F8UB 6EBXA 2UWRA 1CDQA 4FAOC 1CCQA 2MJ4A 2BHIA 2H5FA 1KXIA 1TXBA 2J8BA 3KFDE 3BT2U 1L4WA 4AEAA 3U73U 1ERAA 3NEQA 1NYSA 1LX5B 2BTXA 1NORA 1CXNA 2JVEA 2QJBC 1H0JA 1PLOA 1W6BA 2CDXA 4LFTA 2X8BB 1BTEA 1COEA 2CCXA 4P7UA 1QM7A 2H8UA 2VLWA 3VTSA 1HAJA 1RGJA 1KFHA 3EVSC 1FSSB 1S4YA 1JBDA 5EBXA 1FSCA 1MAHF 1CREA 1LXHA 1KBAA 1ABTA 1NTNA 1NXBA 4XJJA 1IDHA 1NYUA 3QB4B 2GOOB 2PJYB 4EY8B 3ERAA 2CRTA 1YWHA 1KTZB 1CB9A 2H64C 1KL8A 1G6MA 1KC4A 4OM5A 1LJZA 1UG4A 1CXOA 2L5SA 2NBTA 1CODA 1CTXA 1HOYA 1ES7B 2FD6U 2GOOC 2PJYC 5IMTD 2QC1A 1IJCA 3BT1U 2K3GA 3FEVA 1HC9A 1TGXA 2H62C 1FRAA 1CDSA 1ZADA 1KBSA 2LA1A 1KS6A 1V6PA 2LCRA 2MHYA 1QKDA 5DU1A 1IDGA 4FAOE 1CRFA 2MUOA 2CRSA 1RL5A 1IKCA 1CDRA 1CHVS 1KU6B 3EBXA 4KSNA 4QTIU 3U74U 1IQ9A 2ERAA 4DO8A 4ZQYA 1REWC 1ONJA 2HLQA 5IMYC 1ERGA 1FFJA 1CDTA 1IK8A 1QKEA 2MJ0A 2MJYA 1KBTA 2H7ZB 4BDTB 1JE9A 1BXPA 3NDSA 2UX2A 2N99A 2OFSA 2CTXA 4UY2C 5DO6A 1IDIA 4RUDA 1M9ZA 1XT3A 2QJ9C 4BIKB 2L03A 4OM4A 1HAAA 1FF4A 3HH7A 1MR6A 1NEAA 1NTXA 2HLRA 1I02A 1CVOA 1LSIA 2MFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFS A;  2H7Z A;  1FAS A;  1F94 A;  1JGK A;  1TXA A;  1DRS A;  2I9B E;  2H62 D;  5DZ5 A;  2MUP A;  2H64 B;  3LAQ U;  2JQP A;  1IDL A;  4HQP F;  3PLC A;  3NH7 A;  3KFD I;  4IYE A;  1HC9 B;  1LXG A;  1B41 B;  1VB0 A;  2QJA C;  2ABX A;  1F8U B;  6EBX A;  2UWR A;  1CDQ A;  4FAO C;  1CCQ A;  2MJ4 A;  2BHI A;  2H5F A;  1KXI A;  1TXB A;  2J8B A;  3KFD E;  3BT2 U;  1L4W A;  4AEA A;  3U73 U;  1ERA A;  3NEQ A;  1NYS A;  1LX5 B;  2BTX A;  1NOR A;  1CXN A;  2JVE A;  2QJB C;  1H0J A;  1PLO A;  1W6B A;  2CDX A;  4LFT A;  2X8B B;  1BTE A;  1COE A;  2CCX A;  4P7U A;  1QM7 A;  2H8U A;  2VLW A;  3VTS A;  1HAJ A;  1RGJ A;  1KFH A;  3EVS C;  1FSS B;  1S4Y A;  1JBD A;  5EBX A;  1FSC A;  1MAH F;  1CRE A;  1LXH A;  1KBA A;  1ABT A;  1NTN A;  1NXB A;  4XJJ A;  1IDH A;  1NYU A;  3QB4 B;  2GOO B;  2PJY B;  4EY8 B;  3ERA A;  2CRT A;  1YWH A;  1KTZ B;  1CB9 A;  2H64 C;  1KL8 A;  1G6M A;  1KC4 A;  4OM5 A;  1LJZ A;  1UG4 A;  1CXO A;  2L5S A;  2NBT A;  1COD A;  1CTX A;  1HOY A;  1ES7 B;  2FD6 U;  2GOO C;  2PJY C;  5IMT D;  2QC1 A;  1IJC A;  3BT1 U;  2K3G A;  3FEV A;  1HC9 A;  1TGX A;  2H62 C;  1FRA A;  1CDS A;  1ZAD A;  1KBS A;  2LA1 A;  1KS6 A;  1V6P A;  2LCR A;  2MHY A;  1QKD A;  5DU1 A;  1IDG A;  4FAO E;  1CRF A;  2MUO A;  2CRS A;  1RL5 A;  1IKC A;  1CDR A;  1CHV S;  1KU6 B;  3EBX A;  4QTI U;  3U74 U;  1IQ9 A;  2ERA A;  4DO8 A;  4ZQY A;  1REW C;  1ONJ A;  2HLQ A;  5IMY C;  1ERG A;  1FFJ A;  1CDT A;  1IK8 A;  1QKE A;  2MJ0 A;  2MJY A;  1KBT A;  2H7Z B;  4BDT B;  1JE9 A;  1BXP A;  3NDS A;  2UX2 A;  2N99 A;  2OFS A;  2CTX A;  4UY2 C;  5DO6 A;  1IDI A;  4RUD A;  1M9Z A;  1XT3 A;  2QJ9 C;  4BIK B;  2L03 A;  4OM4 A;  1HAA A;  1FF4 A;  3HH7 A;  1MR6 A;  1NEA A;  1NTX A;  2HLR A;  1I02 A;  1CVO A;  1LSI A;  2MFA A; 
#chains in the Genus database with same CATH topology
 1TFS A;  2H7Z A;  1FAS A;  1F94 A;  1JGK A;  1TXA A;  1DRS A;  2I9B E;  2H62 D;  5DZ5 A;  2MUP A;  2H64 B;  3LAQ U;  2JQP A;  1IDL A;  4HQP F;  3PLC A;  3NH7 A;  3KFD I;  4IYE A;  1HC9 B;  1LXG A;  1B41 B;  1VB0 A;  2QJA C;  2ABX A;  1F8U B;  6EBX A;  2UWR A;  1CDQ A;  4FAO C;  1CCQ A;  2MJ4 A;  2BHI A;  2H5F A;  1KXI A;  1TXB A;  2J8B A;  3KFD E;  3BT2 U;  1L4W A;  4AEA A;  3U73 U;  1ERA A;  3NEQ A;  1NYS A;  1LX5 B;  2BTX A;  1NOR A;  1CXN A;  2JVE A;  2QJB C;  1H0J A;  1PLO A;  1W6B A;  2CDX A;  4LFT A;  2X8B B;  1BTE A;  1COE A;  2CCX A;  4P7U A;  1QM7 A;  2H8U A;  2VLW A;  3VTS A;  1HAJ A;  1RGJ A;  1KFH A;  3EVS C;  1FSS B;  1S4Y A;  1JBD A;  5EBX A;  1FSC A;  1MAH F;  1CRE A;  1LXH A;  1KBA A;  1ABT A;  1NTN A;  1NXB A;  4XJJ A;  1IDH A;  1NYU A;  3QB4 B;  2GOO B;  2PJY B;  4EY8 B;  3ERA A;  2CRT A;  1YWH A;  1KTZ B;  1CB9 A;  2H64 C;  1KL8 A;  1G6M A;  1KC4 A;  4OM5 A;  1LJZ A;  1UG4 A;  1CXO A;  2L5S A;  2NBT A;  1COD A;  1CTX A;  1HOY A;  1ES7 B;  2FD6 U;  2GOO C;  2PJY C;  5IMT D;  2QC1 A;  1IJC A;  3BT1 U;  2K3G A;  3FEV A;  1HC9 A;  1TGX A;  2H62 C;  1FRA A;  1CDS A;  1ZAD A;  1KBS A;  2LA1 A;  1KS6 A;  1V6P A;  2LCR A;  2MHY A;  1QKD A;  5DU1 A;  1IDG A;  4FAO E;  1CRF A;  2MUO A;  2CRS A;  1RL5 A;  1IKC A;  1CDR A;  1CHV S;  1KU6 B;  3EBX A;  4KSN A;  4QTI U;  3U74 U;  1IQ9 A;  2ERA A;  4DO8 A;  4ZQY A;  1REW C;  1ONJ A;  2HLQ A;  5IMY C;  1ERG A;  1FFJ A;  1CDT A;  1IK8 A;  1QKE A;  2MJ0 A;  2MJY A;  1KBT A;  2H7Z B;  4BDT B;  1JE9 A;  1BXP A;  3NDS A;  2UX2 A;  2N99 A;  2OFS A;  2CTX A;  4UY2 C;  5DO6 A;  1IDI A;  4RUD A;  1M9Z A;  1XT3 A;  2QJ9 C;  4BIK B;  2L03 A;  4OM4 A;  1HAA A;  1FF4 A;  3HH7 A;  1MR6 A;  1NEA A;  1NTX A;  2HLR A;  1I02 A;  1CVO A;  1LSI A;  2MFA A; 
#chains in the Genus database with same CATH homology
 1TFS A;  2H7Z A;  1FAS A;  1F94 A;  1JGK A;  1TXA A;  1DRS A;  2I9B E;  2H62 D;  5DZ5 A;  2MUP A;  2H64 B;  3LAQ U;  2JQP A;  1IDL A;  4HQP F;  3PLC A;  3NH7 A;  3KFD I;  4IYE A;  1HC9 B;  1LXG A;  1B41 B;  1VB0 A;  2QJA C;  2ABX A;  1F8U B;  6EBX A;  2UWR A;  1CDQ A;  4FAO C;  1CCQ A;  2MJ4 A;  2BHI A;  2H5F A;  1KXI A;  1TXB A;  2J8B A;  3KFD E;  3BT2 U;  1L4W A;  4AEA A;  3U73 U;  1ERA A;  3NEQ A;  1NYS A;  1LX5 B;  2BTX A;  1NOR A;  1CXN A;  2JVE A;  2QJB C;  1H0J A;  1PLO A;  1W6B A;  2CDX A;  4LFT A;  2X8B B;  1BTE A;  1COE A;  2CCX A;  4P7U A;  1QM7 A;  2H8U A;  2VLW A;  3VTS A;  1HAJ A;  1RGJ A;  1KFH A;  3EVS C;  1FSS B;  1S4Y A;  1JBD A;  5EBX A;  1FSC A;  1MAH F;  1CRE A;  1LXH A;  1KBA A;  1ABT A;  1NTN A;  1NXB A;  4XJJ A;  1IDH A;  1NYU A;  3QB4 B;  2GOO B;  2PJY B;  4EY8 B;  3ERA A;  2CRT A;  1YWH A;  1KTZ B;  1CB9 A;  2H64 C;  1KL8 A;  1G6M A;  1KC4 A;  4OM5 A;  1LJZ A;  1UG4 A;  1CXO A;  2L5S A;  2NBT A;  1COD A;  1CTX A;  1HOY A;  1ES7 B;  2FD6 U;  2GOO C;  2PJY C;  5IMT D;  2QC1 A;  1IJC A;  3BT1 U;  2K3G A;  3FEV A;  1HC9 A;  1TGX A;  2H62 C;  1FRA A;  1CDS A;  1ZAD A;  1KBS A;  2LA1 A;  1KS6 A;  1V6P A;  2LCR A;  2MHY A;  1QKD A;  5DU1 A;  1IDG A;  4FAO E;  1CRF A;  2MUO A;  2CRS A;  1RL5 A;  1IKC A;  1CDR A;  1CHV S;  1KU6 B;  3EBX A;  4KSN A;  4QTI U;  3U74 U;  1IQ9 A;  2ERA A;  4DO8 A;  4ZQY A;  1REW C;  1ONJ A;  2HLQ A;  5IMY C;  1ERG A;  1FFJ A;  1CDT A;  1IK8 A;  1QKE A;  2MJ0 A;  2MJY A;  1KBT A;  2H7Z B;  4BDT B;  1JE9 A;  1BXP A;  3NDS A;  2UX2 A;  2N99 A;  2OFS A;  2CTX A;  4UY2 C;  5DO6 A;  1IDI A;  4RUD A;  1M9Z A;  1XT3 A;  2QJ9 C;  4BIK B;  2L03 A;  4OM4 A;  1HAA A;  1FF4 A;  3HH7 A;  1MR6 A;  1NEA A;  1NTX A;  2HLR A;  1I02 A;  1CVO A;  1LSI A;  2MFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...