1IDLA

The nmr solution structure of alpha-bungarotoxin
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
74
structure length
74
Chain Sequence
b'IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-BUNGAROTOXIN
publication title The solution structure of the complex formed between alpha-bungarotoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica.
pubmed doi rcsb
molecule tags Toxin
total genus 2
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1idlA00
2VLWA 1CREA 1MAHF 1CDTA 1BXPA 2UWRA 4FAOC 1XT3A 1LXHA 1PLOA 1BTEA 1NXBA 2H8UA 1KL8A 1YWHA 5DZ5A 2UX2A 1G6MA 4OM5A 2MJ4A 1CDSA 2LCRA 3NH7A 2H62D 1HC9B 3EBXA 2GOOC 2L5SA 1KBAA 1HOYA 1H0JA 2ABXA 3U73U 2H7ZB 1COEA 1L4WA 3U74U 2CTXA 1ES7B 1KU6B 3FEVA 1ABTA 1LJZA 2J8BA 2QJ9C 2QC1A 1FRAA 4LFTA 4RUDA 1ONJA 2CDXA 2H64B 1NTNA 1W6BA 1ERAA 5DU1A 1NYSA 2LA1A 1IJCA 1LXGA 2QJAC 4BIKB 5EBXA 3KFDI 1HAJA 1FSSB 2FD6U 1RGJA 1CRFA 1QM7A 1UG4A 2CRTA 2MUOA 3QB4B 1CB9A 3VTSA 1ZADA 1M9ZA 1FFJA 2BHIA 1MR6A 2OFSA 1QKDA 1KTZB 1IQ9A 1FSCA 3BT2U 3HH7A 4QTIU 5DO6A 1KC4A 1F8UB 1CHVS 2JQPA 4EY8B 4OM4A 1NYUA 2MUPA 1CVOA 3KFDE 1CXOA 2PJYB 3ERAA 4HQPF 1CDRA 1CTXA 6EBXA 1FASA 1NEAA 1IDIA 1F94A 1HAAA 3NDSA 4P7UA 1JBDA 2I9BE 5IMYC 1TXBA 2CCXA 1NTXA 1KFHA 2X8BB 2K3GA 1CODA 1S4YA 1CCQA 2HLRA 1REWC 1KXIA 1CXNA 2H62C 1DRSA 1IK8A 5IMTD 2ERAA 4ZQYA 1FF4A 1IDGA 4XJJA 1KBTA 1VB0A 1JGKA 1IDLA 3BT1U 2JVEA 2H7ZA 1LSIA 4FAOE 1KBSA 2HLQA 1CDQA 1QKEA 1TGXA 4UY2C 4AEAA 4DO8A 1IDHA 1ERGA 2MHYA 2PJYC 3EVSC 4IYEA 2N99A 2H64C 2CRSA 2GOOB 1JE9A 1TFSA 3NEQA 1NORA 1IKCA 2NBTA 1TXAA 3PLCA 4BDTB 2MJ0A 2QJBC 1V6PA 3LAQU 2MJYA 1KS6A 2MFAA 2BTXA 1HC9A 1LX5B 1RL5A 1B41B 1I02A 2L03A 2H5FA
chains in the Genus database with same CATH superfamily
2VLWA 1CREA 1MAHF 1CDTA 1BXPA 2UWRA 4FAOC 1XT3A 1LXHA 1PLOA 1BTEA 1NXBA 2H8UA 1KL8A 1YWHA 5DZ5A 2UX2A 1G6MA 4OM5A 2MJ4A 1CDSA 2LCRA 3NH7A 2H62D 1HC9B 3EBXA 2GOOC 2L5SA 1KBAA 1HOYA 1H0JA 2ABXA 3U73U 2H7ZB 1COEA 1L4WA 3U74U 2CTXA 1ES7B 1KU6B 3FEVA 1ABTA 1LJZA 2J8BA 2QJ9C 2QC1A 1FRAA 4LFTA 4RUDA 1ONJA 2CDXA 2H64B 1NTNA 1W6BA 1ERAA 5DU1A 1NYSA 2LA1A 1IJCA 1LXGA 2QJAC 4BIKB 5EBXA 3KFDI 1HAJA 1FSSB 2FD6U 1RGJA 1CRFA 1QM7A 1UG4A 2CRTA 2MUOA 3QB4B 1CB9A 3VTSA 1ZADA 1M9ZA 1FFJA 2BHIA 1MR6A 2OFSA 1QKDA 1KTZB 1IQ9A 1FSCA 3BT2U 3HH7A 4QTIU 5DO6A 1KC4A 1F8UB 1CHVS 2JQPA 4EY8B 4OM4A 1NYUA 2MUPA 1CVOA 3KFDE 1CXOA 2PJYB 3ERAA 4HQPF 1CDRA 1CTXA 6EBXA 1FASA 1NEAA 1IDIA 1F94A 1HAAA 3NDSA 4P7UA 1JBDA 2I9BE 5IMYC 1TXBA 2CCXA 1NTXA 1KFHA 2X8BB 2K3GA 1CODA 1S4YA 1CCQA 2HLRA 1REWC 1KXIA 1CXNA 2H62C 1DRSA 1IK8A 5IMTD 2ERAA 4ZQYA 1FF4A 1IDGA 4XJJA 1KBTA 1VB0A 1JGKA 1IDLA 3BT1U 2JVEA 2H7ZA 1LSIA 4FAOE 1KBSA 2HLQA 1CDQA 1QKEA 1TGXA 4UY2C 4AEAA 4DO8A 1IDHA 1ERGA 2MHYA 2PJYC 3EVSC 4IYEA 2N99A 2H64C 2CRSA 2GOOB 4KSNA 1JE9A 1TFSA 3NEQA 1NORA 1IKCA 2NBTA 1TXAA 3PLCA 4BDTB 2MJ0A 2QJBC 1V6PA 3LAQU 2MJYA 1KS6A 2MFAA 2BTXA 1HC9A 1LX5B 1RL5A 1B41B 1I02A 2L03A 2H5FA
chains in the Genus database with same CATH topology
2VLWA 1CREA 1MAHF 1CDTA 1BXPA 2UWRA 4FAOC 1XT3A 1LXHA 1PLOA 1BTEA 1NXBA 2H8UA 1KL8A 1YWHA 5DZ5A 2UX2A 1G6MA 4OM5A 2MJ4A 1CDSA 2LCRA 3NH7A 2H62D 1HC9B 3EBXA 2GOOC 2L5SA 1KBAA 1HOYA 1H0JA 2ABXA 3U73U 2H7ZB 1COEA 1L4WA 3U74U 2CTXA 1ES7B 1KU6B 3FEVA 1ABTA 1LJZA 2J8BA 2QJ9C 2QC1A 1FRAA 4LFTA 4RUDA 1ONJA 2CDXA 2H64B 1NTNA 1W6BA 1ERAA 5DU1A 1NYSA 2LA1A 1IJCA 1LXGA 2QJAC 4BIKB 5EBXA 3KFDI 1HAJA 1FSSB 2FD6U 1RGJA 1CRFA 1QM7A 1UG4A 2CRTA 2MUOA 3QB4B 1CB9A 3VTSA 1ZADA 1M9ZA 1FFJA 2BHIA 1MR6A 2OFSA 1QKDA 1KTZB 1IQ9A 1FSCA 3BT2U 3HH7A 4QTIU 5DO6A 1KC4A 1F8UB 1CHVS 2JQPA 4EY8B 4OM4A 1NYUA 2MUPA 1CVOA 3KFDE 1CXOA 2PJYB 3ERAA 4HQPF 1CDRA 1CTXA 6EBXA 1FASA 1NEAA 1IDIA 1F94A 1HAAA 3NDSA 4P7UA 1JBDA 2I9BE 5IMYC 1TXBA 2CCXA 1NTXA 1KFHA 2X8BB 2K3GA 1CODA 1S4YA 1CCQA 2HLRA 1REWC 1KXIA 1CXNA 2H62C 1DRSA 1IK8A 5IMTD 2ERAA 4ZQYA 1FF4A 1IDGA 4XJJA 1KBTA 1VB0A 1JGKA 1IDLA 3BT1U 2JVEA 2H7ZA 1LSIA 4FAOE 1KBSA 2HLQA 1CDQA 1QKEA 1TGXA 4UY2C 4AEAA 4DO8A 1IDHA 1ERGA 2MHYA 2PJYC 3EVSC 4IYEA 2N99A 2H64C 2CRSA 2GOOB 4KSNA 1JE9A 1TFSA 3NEQA 1NORA 1IKCA 2NBTA 1TXAA 3PLCA 4BDTB 2MJ0A 2QJBC 1V6PA 3LAQU 2MJYA 1KS6A 2MFAA 2BTXA 1HC9A 1LX5B 1RL5A 1B41B 1I02A 2L03A 2H5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLW A;  1CRE A;  1MAH F;  1CDT A;  1BXP A;  2UWR A;  4FAO C;  1XT3 A;  1LXH A;  1PLO A;  1BTE A;  1NXB A;  2H8U A;  1KL8 A;  1YWH A;  5DZ5 A;  2UX2 A;  1G6M A;  4OM5 A;  2MJ4 A;  1CDS A;  2LCR A;  3NH7 A;  2H62 D;  1HC9 B;  3EBX A;  2GOO C;  2L5S A;  1KBA A;  1HOY A;  1H0J A;  2ABX A;  3U73 U;  2H7Z B;  1COE A;  1L4W A;  3U74 U;  2CTX A;  1ES7 B;  1KU6 B;  3FEV A;  1ABT A;  1LJZ A;  2J8B A;  2QJ9 C;  2QC1 A;  1FRA A;  4LFT A;  4RUD A;  1ONJ A;  2CDX A;  2H64 B;  1NTN A;  1W6B A;  1ERA A;  5DU1 A;  1NYS A;  2LA1 A;  1IJC A;  1LXG A;  2QJA C;  4BIK B;  5EBX A;  3KFD I;  1HAJ A;  1FSS B;  2FD6 U;  1RGJ A;  1CRF A;  1QM7 A;  1UG4 A;  2CRT A;  2MUO A;  3QB4 B;  1CB9 A;  3VTS A;  1ZAD A;  1M9Z A;  1FFJ A;  2BHI A;  1MR6 A;  2OFS A;  1QKD A;  1KTZ B;  1IQ9 A;  1FSC A;  3BT2 U;  3HH7 A;  4QTI U;  5DO6 A;  1KC4 A;  1F8U B;  1CHV S;  2JQP A;  4EY8 B;  4OM4 A;  1NYU A;  2MUP A;  1CVO A;  3KFD E;  1CXO A;  2PJY B;  3ERA A;  4HQP F;  1CDR A;  1CTX A;  6EBX A;  1FAS A;  1NEA A;  1IDI A;  1F94 A;  1HAA A;  3NDS A;  4P7U A;  1JBD A;  2I9B E;  5IMY C;  1TXB A;  2CCX A;  1NTX A;  1KFH A;  2X8B B;  2K3G A;  1COD A;  1S4Y A;  1CCQ A;  2HLR A;  1REW C;  1KXI A;  1CXN A;  2H62 C;  1DRS A;  1IK8 A;  5IMT D;  2ERA A;  4ZQY A;  1FF4 A;  1IDG A;  4XJJ A;  1KBT A;  1VB0 A;  1JGK A;  1IDL A;  3BT1 U;  2JVE A;  2H7Z A;  1LSI A;  4FAO E;  1KBS A;  2HLQ A;  1CDQ A;  1QKE A;  1TGX A;  4UY2 C;  4AEA A;  4DO8 A;  1IDH A;  1ERG A;  2MHY A;  2PJY C;  3EVS C;  4IYE A;  2N99 A;  2H64 C;  2CRS A;  2GOO B;  1JE9 A;  1TFS A;  3NEQ A;  1NOR A;  1IKC A;  2NBT A;  1TXA A;  3PLC A;  4BDT B;  2MJ0 A;  2QJB C;  1V6P A;  3LAQ U;  2MJY A;  1KS6 A;  2MFA A;  2BTX A;  1HC9 A;  1LX5 B;  1RL5 A;  1B41 B;  1I02 A;  2L03 A;  2H5F A; 
#chains in the Genus database with same CATH topology
 2VLW A;  1CRE A;  1MAH F;  1CDT A;  1BXP A;  2UWR A;  4FAO C;  1XT3 A;  1LXH A;  1PLO A;  1BTE A;  1NXB A;  2H8U A;  1KL8 A;  1YWH A;  5DZ5 A;  2UX2 A;  1G6M A;  4OM5 A;  2MJ4 A;  1CDS A;  2LCR A;  3NH7 A;  2H62 D;  1HC9 B;  3EBX A;  2GOO C;  2L5S A;  1KBA A;  1HOY A;  1H0J A;  2ABX A;  3U73 U;  2H7Z B;  1COE A;  1L4W A;  3U74 U;  2CTX A;  1ES7 B;  1KU6 B;  3FEV A;  1ABT A;  1LJZ A;  2J8B A;  2QJ9 C;  2QC1 A;  1FRA A;  4LFT A;  4RUD A;  1ONJ A;  2CDX A;  2H64 B;  1NTN A;  1W6B A;  1ERA A;  5DU1 A;  1NYS A;  2LA1 A;  1IJC A;  1LXG A;  2QJA C;  4BIK B;  5EBX A;  3KFD I;  1HAJ A;  1FSS B;  2FD6 U;  1RGJ A;  1CRF A;  1QM7 A;  1UG4 A;  2CRT A;  2MUO A;  3QB4 B;  1CB9 A;  3VTS A;  1ZAD A;  1M9Z A;  1FFJ A;  2BHI A;  1MR6 A;  2OFS A;  1QKD A;  1KTZ B;  1IQ9 A;  1FSC A;  3BT2 U;  3HH7 A;  4QTI U;  5DO6 A;  1KC4 A;  1F8U B;  1CHV S;  2JQP A;  4EY8 B;  4OM4 A;  1NYU A;  2MUP A;  1CVO A;  3KFD E;  1CXO A;  2PJY B;  3ERA A;  4HQP F;  1CDR A;  1CTX A;  6EBX A;  1FAS A;  1NEA A;  1IDI A;  1F94 A;  1HAA A;  3NDS A;  4P7U A;  1JBD A;  2I9B E;  5IMY C;  1TXB A;  2CCX A;  1NTX A;  1KFH A;  2X8B B;  2K3G A;  1COD A;  1S4Y A;  1CCQ A;  2HLR A;  1REW C;  1KXI A;  1CXN A;  2H62 C;  1DRS A;  1IK8 A;  5IMT D;  2ERA A;  4ZQY A;  1FF4 A;  1IDG A;  4XJJ A;  1KBT A;  1VB0 A;  1JGK A;  1IDL A;  3BT1 U;  2JVE A;  2H7Z A;  1LSI A;  4FAO E;  1KBS A;  2HLQ A;  1CDQ A;  1QKE A;  1TGX A;  4UY2 C;  4AEA A;  4DO8 A;  1IDH A;  1ERG A;  2MHY A;  2PJY C;  3EVS C;  4IYE A;  2N99 A;  2H64 C;  2CRS A;  2GOO B;  4KSN A;  1JE9 A;  1TFS A;  3NEQ A;  1NOR A;  1IKC A;  2NBT A;  1TXA A;  3PLC A;  4BDT B;  2MJ0 A;  2QJB C;  1V6P A;  3LAQ U;  2MJY A;  1KS6 A;  2MFA A;  2BTX A;  1HC9 A;  1LX5 B;  1RL5 A;  1B41 B;  1I02 A;  2L03 A;  2H5F A; 
#chains in the Genus database with same CATH homology
 2VLW A;  1CRE A;  1MAH F;  1CDT A;  1BXP A;  2UWR A;  4FAO C;  1XT3 A;  1LXH A;  1PLO A;  1BTE A;  1NXB A;  2H8U A;  1KL8 A;  1YWH A;  5DZ5 A;  2UX2 A;  1G6M A;  4OM5 A;  2MJ4 A;  1CDS A;  2LCR A;  3NH7 A;  2H62 D;  1HC9 B;  3EBX A;  2GOO C;  2L5S A;  1KBA A;  1HOY A;  1H0J A;  2ABX A;  3U73 U;  2H7Z B;  1COE A;  1L4W A;  3U74 U;  2CTX A;  1ES7 B;  1KU6 B;  3FEV A;  1ABT A;  1LJZ A;  2J8B A;  2QJ9 C;  2QC1 A;  1FRA A;  4LFT A;  4RUD A;  1ONJ A;  2CDX A;  2H64 B;  1NTN A;  1W6B A;  1ERA A;  5DU1 A;  1NYS A;  2LA1 A;  1IJC A;  1LXG A;  2QJA C;  4BIK B;  5EBX A;  3KFD I;  1HAJ A;  1FSS B;  2FD6 U;  1RGJ A;  1CRF A;  1QM7 A;  1UG4 A;  2CRT A;  2MUO A;  3QB4 B;  1CB9 A;  3VTS A;  1ZAD A;  1M9Z A;  1FFJ A;  2BHI A;  1MR6 A;  2OFS A;  1QKD A;  1KTZ B;  1IQ9 A;  1FSC A;  3BT2 U;  3HH7 A;  4QTI U;  5DO6 A;  1KC4 A;  1F8U B;  1CHV S;  2JQP A;  4EY8 B;  4OM4 A;  1NYU A;  2MUP A;  1CVO A;  3KFD E;  1CXO A;  2PJY B;  3ERA A;  4HQP F;  1CDR A;  1CTX A;  6EBX A;  1FAS A;  1NEA A;  1IDI A;  1F94 A;  1HAA A;  3NDS A;  4P7U A;  1JBD A;  2I9B E;  5IMY C;  1TXB A;  2CCX A;  1NTX A;  1KFH A;  2X8B B;  2K3G A;  1COD A;  1S4Y A;  1CCQ A;  2HLR A;  1REW C;  1KXI A;  1CXN A;  2H62 C;  1DRS A;  1IK8 A;  5IMT D;  2ERA A;  4ZQY A;  1FF4 A;  1IDG A;  4XJJ A;  1KBT A;  1VB0 A;  1JGK A;  1IDL A;  3BT1 U;  2JVE A;  2H7Z A;  1LSI A;  4FAO E;  1KBS A;  2HLQ A;  1CDQ A;  1QKE A;  1TGX A;  4UY2 C;  4AEA A;  4DO8 A;  1IDH A;  1ERG A;  2MHY A;  2PJY C;  3EVS C;  4IYE A;  2N99 A;  2H64 C;  2CRS A;  2GOO B;  4KSN A;  1JE9 A;  1TFS A;  3NEQ A;  1NOR A;  1IKC A;  2NBT A;  1TXA A;  3PLC A;  4BDT B;  2MJ0 A;  2QJB C;  1V6P A;  3LAQ U;  2MJY A;  1KS6 A;  2MFA A;  2BTX A;  1HC9 A;  1LX5 B;  1RL5 A;  1B41 B;  1I02 A;  2L03 A;  2H5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...