1IJCA

Solution structure of bucandin, a neurotoxin from the venom of the malayan krait
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
63
Chain Sequence
MECYRCGVSGCHLKITCSAEETFCYKWLNKISNERWLGCAKTCTEIDTWNVYNKCCTTNLCNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of bucandin, a neurotoxin from the venom of the Malayan krait (Bungarus candidus).
pubmed doi rcsb
molecule tags Toxin
molecule keywords bucandin
total genus 6
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2001-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ijcA00
2HLQA 1CXNA 1LX5B 4LFTA 4EY8B 4UY2C 1CDRA 4BIKB 1NTNA 1KU6B 1F8UB 3VTSA 3EVSC 1RL5A 1KBSA 3LAQU 2JQPA 2X8BB 1G6MA 1CREA 1IJCA 2MUPA 2LCRA 1ES7B 1LJZA 1MAHF 3NEQA 3EBXA 1HAAA 1FSCA 1HC9A 3BT1U 2PJYC 1LSIA 4QTIU 2VLWA 2HLRA 2MHYA 3PLCA 2MJ0A 2H64B 1QKEA 4BDTB 2J8BA 2NBTA 4OM5A 1HOYA 3NH7A 1NYSA 2H62C 2PJYB 5IMYC 1CTXA 2N99A 1HC9B 2H5FA 2MJYA 2CCXA 3BT2U 1IDGA 2QJBC 1REWC 2FD6U 2UWRA 4RUDA 1BXPA 1JBDA 1B41B 3KFDI 1KTZB 4OM4A 1CVOA 3KFDE 3FEVA 1ERAA 5DZ5A 2LA1A 1CODA 2ABXA 2H64C 3HH7A 2QJ9C 1XT3A 2QJAC 1FSSB 2GOOB 5IMTD 1IK8A 1BTEA 2MJ4A 2ERAA 1ERGA 2I9BE 1KS6A 5DO6A 1KFHA 2H7ZA 2L03A 2CRSA 1KBTA 1PLOA 1TXAA 2OFSA 1IQ9A 1KL8A 2MUOA 1IDLA 1IDHA 1MR6A 1FF4A 2CDXA 2JVEA 1NXBA 1TGXA 1HAJA 2L5SA 1IDIA 1QKDA 1FRAA 1NEAA 1S4YA 4ZQYA 1NYUA 1VB0A 1FFJA 1TFSA 1LXGA 1LXHA 1CDQA 1KC4A 1F94A 4IYEA 5DU1A 2BHIA 1ZADA 2MFAA 1CDTA 3NDSA 1NTXA 4DO8A 2GOOC 1I02A 2K3GA 3QB4B 1NORA 1W6BA 3U73U 1YWHA 4XJJA 2H7ZB 4FAOC 2CTXA 2QC1A 1CDSA 1KBAA 1ABTA 2H8UA 1ONJA 1JE9A 4FAOE 2BTXA 1TXBA 2UX2A 4P7UA 1CRFA 2CRTA 1COEA 1JGKA 3ERAA 1UG4A 1KXIA 6EBXA 3U74U 1V6PA 1CCQA 1CB9A 1CHVS 4HQPF 1M9ZA 4AEAA 1H0JA 1IKCA 1QM7A 2H62D 1DRSA 1FASA 1RGJA 5EBXA 1CXOA 1L4WA
chains in the Genus database with same CATH superfamily
2HLQA 1CXNA 1LX5B 4LFTA 4EY8B 4UY2C 1CDRA 4BIKB 1NTNA 1KU6B 1F8UB 3VTSA 3EVSC 1RL5A 1KBSA 3LAQU 2JQPA 2X8BB 1G6MA 1CREA 1IJCA 2MUPA 2LCRA 1ES7B 1LJZA 1MAHF 3NEQA 3EBXA 1HAAA 1FSCA 1HC9A 3BT1U 2PJYC 1LSIA 4QTIU 2VLWA 2HLRA 2MHYA 3PLCA 2MJ0A 2H64B 1QKEA 4BDTB 2J8BA 2NBTA 4OM5A 1HOYA 3NH7A 1NYSA 2H62C 2PJYB 5IMYC 1CTXA 2N99A 1HC9B 2H5FA 2MJYA 2CCXA 3BT2U 1IDGA 2QJBC 1REWC 2FD6U 2UWRA 4RUDA 1BXPA 1JBDA 1B41B 3KFDI 1KTZB 4OM4A 1CVOA 3KFDE 3FEVA 1ERAA 5DZ5A 2LA1A 1CODA 2ABXA 2H64C 3HH7A 2QJ9C 1XT3A 2QJAC 1FSSB 2GOOB 5IMTD 1IK8A 1BTEA 2MJ4A 2ERAA 1ERGA 2I9BE 1KS6A 4KSNA 5DO6A 1KFHA 2H7ZA 2L03A 2CRSA 1KBTA 1PLOA 1TXAA 2OFSA 1IQ9A 1KL8A 2MUOA 1IDLA 1IDHA 1MR6A 1FF4A 2CDXA 2JVEA 1NXBA 1TGXA 1HAJA 2L5SA 1IDIA 1QKDA 1FRAA 1NEAA 1S4YA 4ZQYA 1NYUA 1VB0A 1FFJA 1TFSA 1LXGA 1LXHA 1CDQA 1KC4A 1F94A 4IYEA 5DU1A 2BHIA 1ZADA 2MFAA 1CDTA 3NDSA 1NTXA 4DO8A 2GOOC 1I02A 2K3GA 3QB4B 1NORA 1W6BA 3U73U 1YWHA 4XJJA 2H7ZB 4FAOC 2CTXA 2QC1A 1CDSA 1KBAA 1ABTA 2H8UA 1ONJA 1JE9A 4FAOE 2BTXA 1TXBA 2UX2A 4P7UA 1CRFA 2CRTA 1COEA 1JGKA 3ERAA 1UG4A 1KXIA 6EBXA 3U74U 1V6PA 1CCQA 1CB9A 1CHVS 4HQPF 1M9ZA 4AEAA 1H0JA 1IKCA 1QM7A 2H62D 1DRSA 1FASA 1RGJA 5EBXA 1CXOA 1L4WA
chains in the Genus database with same CATH topology
2HLQA 1CXNA 1LX5B 4LFTA 4EY8B 4UY2C 1CDRA 4BIKB 1NTNA 1KU6B 1F8UB 3VTSA 3EVSC 1RL5A 1KBSA 3LAQU 2JQPA 2X8BB 1G6MA 1CREA 1IJCA 2MUPA 2LCRA 1ES7B 1LJZA 1MAHF 3NEQA 3EBXA 1HAAA 1FSCA 1HC9A 3BT1U 2PJYC 1LSIA 4QTIU 2VLWA 2HLRA 2MHYA 3PLCA 2MJ0A 2H64B 1QKEA 4BDTB 2J8BA 2NBTA 4OM5A 1HOYA 3NH7A 1NYSA 2H62C 2PJYB 5IMYC 1CTXA 2N99A 1HC9B 2H5FA 2MJYA 2CCXA 3BT2U 1IDGA 2QJBC 1REWC 2FD6U 2UWRA 4RUDA 1BXPA 1JBDA 1B41B 3KFDI 1KTZB 4OM4A 1CVOA 3KFDE 3FEVA 1ERAA 5DZ5A 2LA1A 1CODA 2ABXA 2H64C 3HH7A 2QJ9C 1XT3A 2QJAC 1FSSB 2GOOB 5IMTD 1IK8A 1BTEA 2MJ4A 2ERAA 1ERGA 2I9BE 1KS6A 4KSNA 5DO6A 1KFHA 2H7ZA 2L03A 2CRSA 1KBTA 1PLOA 1TXAA 2OFSA 1IQ9A 1KL8A 2MUOA 1IDLA 1IDHA 1MR6A 1FF4A 2CDXA 2JVEA 1NXBA 1TGXA 1HAJA 2L5SA 1IDIA 1QKDA 1FRAA 1NEAA 1S4YA 4ZQYA 1NYUA 1VB0A 1FFJA 1TFSA 1LXGA 1LXHA 1CDQA 1KC4A 1F94A 4IYEA 5DU1A 2BHIA 1ZADA 2MFAA 1CDTA 3NDSA 1NTXA 4DO8A 2GOOC 1I02A 2K3GA 3QB4B 1NORA 1W6BA 3U73U 1YWHA 4XJJA 2H7ZB 4FAOC 2CTXA 2QC1A 1CDSA 1KBAA 1ABTA 2H8UA 1ONJA 1JE9A 4FAOE 2BTXA 1TXBA 2UX2A 4P7UA 1CRFA 2CRTA 1COEA 1JGKA 3ERAA 1UG4A 1KXIA 6EBXA 3U74U 1V6PA 1CCQA 1CB9A 1CHVS 4HQPF 1M9ZA 4AEAA 1H0JA 1IKCA 1QM7A 2H62D 1DRSA 1FASA 1RGJA 5EBXA 1CXOA 1L4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HLQ A;  1CXN A;  1LX5 B;  4LFT A;  4EY8 B;  4UY2 C;  1CDR A;  4BIK B;  1NTN A;  1KU6 B;  1F8U B;  3VTS A;  3EVS C;  1RL5 A;  1KBS A;  3LAQ U;  2JQP A;  2X8B B;  1G6M A;  1CRE A;  1IJC A;  2MUP A;  2LCR A;  1ES7 B;  1LJZ A;  1MAH F;  3NEQ A;  3EBX A;  1HAA A;  1FSC A;  1HC9 A;  3BT1 U;  2PJY C;  1LSI A;  4QTI U;  2VLW A;  2HLR A;  2MHY A;  3PLC A;  2MJ0 A;  2H64 B;  1QKE A;  4BDT B;  2J8B A;  2NBT A;  4OM5 A;  1HOY A;  3NH7 A;  1NYS A;  2H62 C;  2PJY B;  5IMY C;  1CTX A;  2N99 A;  1HC9 B;  2H5F A;  2MJY A;  2CCX A;  3BT2 U;  1IDG A;  2QJB C;  1REW C;  2FD6 U;  2UWR A;  4RUD A;  1BXP A;  1JBD A;  1B41 B;  3KFD I;  1KTZ B;  4OM4 A;  1CVO A;  3KFD E;  3FEV A;  1ERA A;  5DZ5 A;  2LA1 A;  1COD A;  2ABX A;  2H64 C;  3HH7 A;  2QJ9 C;  1XT3 A;  2QJA C;  1FSS B;  2GOO B;  5IMT D;  1IK8 A;  1BTE A;  2MJ4 A;  2ERA A;  1ERG A;  2I9B E;  1KS6 A;  5DO6 A;  1KFH A;  2H7Z A;  2L03 A;  2CRS A;  1KBT A;  1PLO A;  1TXA A;  2OFS A;  1IQ9 A;  1KL8 A;  2MUO A;  1IDL A;  1IDH A;  1MR6 A;  1FF4 A;  2CDX A;  2JVE A;  1NXB A;  1TGX A;  1HAJ A;  2L5S A;  1IDI A;  1QKD A;  1FRA A;  1NEA A;  1S4Y A;  4ZQY A;  1NYU A;  1VB0 A;  1FFJ A;  1TFS A;  1LXG A;  1LXH A;  1CDQ A;  1KC4 A;  1F94 A;  4IYE A;  5DU1 A;  2BHI A;  1ZAD A;  2MFA A;  1CDT A;  3NDS A;  1NTX A;  4DO8 A;  2GOO C;  1I02 A;  2K3G A;  3QB4 B;  1NOR A;  1W6B A;  3U73 U;  1YWH A;  4XJJ A;  2H7Z B;  4FAO C;  2CTX A;  2QC1 A;  1CDS A;  1KBA A;  1ABT A;  2H8U A;  1ONJ A;  1JE9 A;  4FAO E;  2BTX A;  1TXB A;  2UX2 A;  4P7U A;  1CRF A;  2CRT A;  1COE A;  1JGK A;  3ERA A;  1UG4 A;  1KXI A;  6EBX A;  3U74 U;  1V6P A;  1CCQ A;  1CB9 A;  1CHV S;  4HQP F;  1M9Z A;  4AEA A;  1H0J A;  1IKC A;  1QM7 A;  2H62 D;  1DRS A;  1FAS A;  1RGJ A;  5EBX A;  1CXO A;  1L4W A; 
#chains in the Genus database with same CATH topology
 2HLQ A;  1CXN A;  1LX5 B;  4LFT A;  4EY8 B;  4UY2 C;  1CDR A;  4BIK B;  1NTN A;  1KU6 B;  1F8U B;  3VTS A;  3EVS C;  1RL5 A;  1KBS A;  3LAQ U;  2JQP A;  2X8B B;  1G6M A;  1CRE A;  1IJC A;  2MUP A;  2LCR A;  1ES7 B;  1LJZ A;  1MAH F;  3NEQ A;  3EBX A;  1HAA A;  1FSC A;  1HC9 A;  3BT1 U;  2PJY C;  1LSI A;  4QTI U;  2VLW A;  2HLR A;  2MHY A;  3PLC A;  2MJ0 A;  2H64 B;  1QKE A;  4BDT B;  2J8B A;  2NBT A;  4OM5 A;  1HOY A;  3NH7 A;  1NYS A;  2H62 C;  2PJY B;  5IMY C;  1CTX A;  2N99 A;  1HC9 B;  2H5F A;  2MJY A;  2CCX A;  3BT2 U;  1IDG A;  2QJB C;  1REW C;  2FD6 U;  2UWR A;  4RUD A;  1BXP A;  1JBD A;  1B41 B;  3KFD I;  1KTZ B;  4OM4 A;  1CVO A;  3KFD E;  3FEV A;  1ERA A;  5DZ5 A;  2LA1 A;  1COD A;  2ABX A;  2H64 C;  3HH7 A;  2QJ9 C;  1XT3 A;  2QJA C;  1FSS B;  2GOO B;  5IMT D;  1IK8 A;  1BTE A;  2MJ4 A;  2ERA A;  1ERG A;  2I9B E;  1KS6 A;  4KSN A;  5DO6 A;  1KFH A;  2H7Z A;  2L03 A;  2CRS A;  1KBT A;  1PLO A;  1TXA A;  2OFS A;  1IQ9 A;  1KL8 A;  2MUO A;  1IDL A;  1IDH A;  1MR6 A;  1FF4 A;  2CDX A;  2JVE A;  1NXB A;  1TGX A;  1HAJ A;  2L5S A;  1IDI A;  1QKD A;  1FRA A;  1NEA A;  1S4Y A;  4ZQY A;  1NYU A;  1VB0 A;  1FFJ A;  1TFS A;  1LXG A;  1LXH A;  1CDQ A;  1KC4 A;  1F94 A;  4IYE A;  5DU1 A;  2BHI A;  1ZAD A;  2MFA A;  1CDT A;  3NDS A;  1NTX A;  4DO8 A;  2GOO C;  1I02 A;  2K3G A;  3QB4 B;  1NOR A;  1W6B A;  3U73 U;  1YWH A;  4XJJ A;  2H7Z B;  4FAO C;  2CTX A;  2QC1 A;  1CDS A;  1KBA A;  1ABT A;  2H8U A;  1ONJ A;  1JE9 A;  4FAO E;  2BTX A;  1TXB A;  2UX2 A;  4P7U A;  1CRF A;  2CRT A;  1COE A;  1JGK A;  3ERA A;  1UG4 A;  1KXI A;  6EBX A;  3U74 U;  1V6P A;  1CCQ A;  1CB9 A;  1CHV S;  4HQP F;  1M9Z A;  4AEA A;  1H0J A;  1IKC A;  1QM7 A;  2H62 D;  1DRS A;  1FAS A;  1RGJ A;  5EBX A;  1CXO A;  1L4W A; 
#chains in the Genus database with same CATH homology
 2HLQ A;  1CXN A;  1LX5 B;  4LFT A;  4EY8 B;  4UY2 C;  1CDR A;  4BIK B;  1NTN A;  1KU6 B;  1F8U B;  3VTS A;  3EVS C;  1RL5 A;  1KBS A;  3LAQ U;  2JQP A;  2X8B B;  1G6M A;  1CRE A;  1IJC A;  2MUP A;  2LCR A;  1ES7 B;  1LJZ A;  1MAH F;  3NEQ A;  3EBX A;  1HAA A;  1FSC A;  1HC9 A;  3BT1 U;  2PJY C;  1LSI A;  4QTI U;  2VLW A;  2HLR A;  2MHY A;  3PLC A;  2MJ0 A;  2H64 B;  1QKE A;  4BDT B;  2J8B A;  2NBT A;  4OM5 A;  1HOY A;  3NH7 A;  1NYS A;  2H62 C;  2PJY B;  5IMY C;  1CTX A;  2N99 A;  1HC9 B;  2H5F A;  2MJY A;  2CCX A;  3BT2 U;  1IDG A;  2QJB C;  1REW C;  2FD6 U;  2UWR A;  4RUD A;  1BXP A;  1JBD A;  1B41 B;  3KFD I;  1KTZ B;  4OM4 A;  1CVO A;  3KFD E;  3FEV A;  1ERA A;  5DZ5 A;  2LA1 A;  1COD A;  2ABX A;  2H64 C;  3HH7 A;  2QJ9 C;  1XT3 A;  2QJA C;  1FSS B;  2GOO B;  5IMT D;  1IK8 A;  1BTE A;  2MJ4 A;  2ERA A;  1ERG A;  2I9B E;  1KS6 A;  4KSN A;  5DO6 A;  1KFH A;  2H7Z A;  2L03 A;  2CRS A;  1KBT A;  1PLO A;  1TXA A;  2OFS A;  1IQ9 A;  1KL8 A;  2MUO A;  1IDL A;  1IDH A;  1MR6 A;  1FF4 A;  2CDX A;  2JVE A;  1NXB A;  1TGX A;  1HAJ A;  2L5S A;  1IDI A;  1QKD A;  1FRA A;  1NEA A;  1S4Y A;  4ZQY A;  1NYU A;  1VB0 A;  1FFJ A;  1TFS A;  1LXG A;  1LXH A;  1CDQ A;  1KC4 A;  1F94 A;  4IYE A;  5DU1 A;  2BHI A;  1ZAD A;  2MFA A;  1CDT A;  3NDS A;  1NTX A;  4DO8 A;  2GOO C;  1I02 A;  2K3G A;  3QB4 B;  1NOR A;  1W6B A;  3U73 U;  1YWH A;  4XJJ A;  2H7Z B;  4FAO C;  2CTX A;  2QC1 A;  1CDS A;  1KBA A;  1ABT A;  2H8U A;  1ONJ A;  1JE9 A;  4FAO E;  2BTX A;  1TXB A;  2UX2 A;  4P7U A;  1CRF A;  2CRT A;  1COE A;  1JGK A;  3ERA A;  1UG4 A;  1KXI A;  6EBX A;  3U74 U;  1V6P A;  1CCQ A;  1CB9 A;  1CHV S;  4HQP F;  1M9Z A;  4AEA A;  1H0J A;  1IKC A;  1QM7 A;  2H62 D;  1DRS A;  1FAS A;  1RGJ A;  5EBX A;  1CXO A;  1L4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...