1KS6A

Transforming growth factor beta type ii receptor ligand binding domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
107
structure length
107
Chain Sequence
QLPRLCKFCDVKATTCSNQDQCTSNCNITSICEKNNEVCAAVWRRNDENVTLETICHDPQKRLYGHMLDDSSSEQCVMKEKKDDGGLMFMCSCTGEECNDVLIFSAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the chick TGFb type II receptor ligand binding domain
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hormone/growth factor
molecule keywords TRANSFORMING GROWTH FACTOR BETA TYPE II RECEPTOR
total genus 10
structure length 107
sequence length 107
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2002-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ks6A00
2H7ZB 1CXOA 1KBAA 3VTSA 1JBDA 1ERGA 2N99A 1CDRA 1FFJA 1QKEA 1HOYA 1CHVS 2H7ZA 2H62D 3KFDE 1CB9A 1F8UB 1ERAA 5EBXA 1HAAA 2UWRA 2CTXA 2H8UA 1IDIA 2PJYB 4BDTB 1IDGA 5IMYC 1TXBA 4RUDA 1IDLA 4UY2C 1S4YA 1CDQA 1FF4A 4FAOC 2H5FA 4XJJA 2QJ9C 1CTXA 2PJYC 1ABTA 2QC1A 1HC9A 4EY8B 1MAHF 2CRSA 1IDHA 1NTNA 4QTIU 2ABXA 1RGJA 1IKCA 2L5SA 1QKDA 2JVEA 3U73U 1NTXA 1PLOA 1HAJA 1FASA 1KTZB 2MUPA 1IK8A 1TXAA 1KL8A 1NYUA 2GOOB 4HQPF 3U74U 3KFDI 2CRTA 1DRSA 1NEAA 2UX2A 2VLWA 2FD6U 1TGXA 5DZ5A 1CVOA 1NXBA 2HLQA 1M9ZA 1L4WA 2H62C 2J8BA 1IQ9A 2GOOC 1VB0A 1ES7B 2CCXA 1QM7A 1JGKA 1CREA 1LJZA 3NH7A 1CDTA 2MHYA 1HC9B 2H64C 2OFSA 1KS6A 2LCRA 1CRFA 1BTEA 1KC4A 1NORA 2CDXA 2MJ0A 3EVSC 1H0JA 3EBXA 1KBSA 1KXIA 1NYSA 1IJCA 1W6BA 3ERAA 1LXHA 3FEVA 1ZADA 3QB4B 2BHIA 2LA1A 4IYEA 2QJAC 4FAOE 1LX5B 3NEQA 1COEA 2QJBC 3HH7A 1G6MA 1CXNA 2NBTA 4OM4A 1KBTA 5IMTD 1BXPA 2X8BB 1YWHA 1CODA 1ONJA 2BTXA 1JE9A 5DU1A 2JQPA 5DO6A 1UG4A 3NDSA 4P7UA 1CCQA 1REWC 1I02A 2H64B 1KFHA 1CDSA 2MJYA 4OM5A 1LSIA 2MFAA 1FSCA 1MR6A 2ERAA 3BT2U 2MUOA 4LFTA 1B41B 4ZQYA 4AEAA 4BIKB 1RL5A 1KU6B 3PLCA 1XT3A 2MJ4A 6EBXA 2I9BE 3BT1U 1F94A 2HLRA 3LAQU 1FRAA 2K3GA 1FSSB 1TFSA 1LXGA 2L03A 4DO8A 1V6PA
chains in the Genus database with same CATH superfamily
2H7ZB 1CXOA 1KBAA 3VTSA 1JBDA 1ERGA 2N99A 1CDRA 1FFJA 1QKEA 1HOYA 1CHVS 2H7ZA 2H62D 3KFDE 1CB9A 1F8UB 1ERAA 5EBXA 1HAAA 2UWRA 2CTXA 2H8UA 1IDIA 2PJYB 4BDTB 1IDGA 5IMYC 1TXBA 4RUDA 1IDLA 4UY2C 1S4YA 1CDQA 1FF4A 4FAOC 2H5FA 4XJJA 2QJ9C 1CTXA 2PJYC 1ABTA 2QC1A 1HC9A 4EY8B 1MAHF 2CRSA 1IDHA 1NTNA 4QTIU 2ABXA 1RGJA 1IKCA 2L5SA 1QKDA 2JVEA 3U73U 1NTXA 1PLOA 1HAJA 1FASA 1KTZB 2MUPA 1IK8A 1TXAA 1KL8A 1NYUA 2GOOB 4HQPF 3U74U 3KFDI 2CRTA 1DRSA 1NEAA 2UX2A 2VLWA 2FD6U 1TGXA 5DZ5A 1CVOA 1NXBA 2HLQA 1M9ZA 1L4WA 2H62C 2J8BA 1IQ9A 2GOOC 1VB0A 1ES7B 2CCXA 1QM7A 1JGKA 1CREA 1LJZA 3NH7A 1CDTA 2MHYA 1HC9B 2H64C 2OFSA 1KS6A 2LCRA 1CRFA 1BTEA 1KC4A 1NORA 2CDXA 2MJ0A 3EVSC 1H0JA 3EBXA 1KBSA 1KXIA 1NYSA 1IJCA 1W6BA 3ERAA 1LXHA 3FEVA 1ZADA 3QB4B 2BHIA 2LA1A 4IYEA 2QJAC 4FAOE 1LX5B 3NEQA 1COEA 2QJBC 3HH7A 1G6MA 1CXNA 2NBTA 4OM4A 1KBTA 5IMTD 4ZQYA 1BXPA 2X8BB 1YWHA 1CODA 1ONJA 2BTXA 1JE9A 5DU1A 2JQPA 5DO6A 1UG4A 3NDSA 4P7UA 1CCQA 1REWC 1I02A 2H64B 1KFHA 1CDSA 2MJYA 4OM5A 1LSIA 2MFAA 1FSCA 1MR6A 2ERAA 3BT2U 2MUOA 4KSNA 1B41B 4LFTA 4AEAA 4BIKB 1RL5A 1KU6B 3PLCA 1XT3A 2MJ4A 6EBXA 2I9BE 3BT1U 1F94A 2HLRA 3LAQU 1FRAA 2K3GA 1FSSB 1TFSA 1LXGA 2L03A 4DO8A 1V6PA
chains in the Genus database with same CATH topology
2H7ZB 1CXOA 1KBAA 3VTSA 1JBDA 1ERGA 2N99A 1CDRA 1FFJA 1QKEA 1HOYA 1CHVS 2H7ZA 2H62D 3KFDE 1CB9A 1F8UB 1ERAA 5EBXA 1HAAA 2UWRA 2CTXA 2H8UA 1IDIA 2PJYB 4BDTB 1IDGA 5IMYC 1TXBA 4RUDA 1IDLA 4UY2C 1S4YA 1CDQA 1FF4A 4FAOC 2H5FA 4XJJA 2QJ9C 1CTXA 2PJYC 1ABTA 2QC1A 1HC9A 4EY8B 1MAHF 2CRSA 1IDHA 1NTNA 4QTIU 2ABXA 1RGJA 1IKCA 2L5SA 1QKDA 2JVEA 3U73U 1NTXA 1PLOA 1HAJA 1FASA 1KTZB 2MUPA 1IK8A 1TXAA 1KL8A 1NYUA 2GOOB 4HQPF 3U74U 3KFDI 2CRTA 1DRSA 1NEAA 2UX2A 2VLWA 2FD6U 1TGXA 5DZ5A 1CVOA 1NXBA 2HLQA 1M9ZA 1L4WA 2H62C 2J8BA 1IQ9A 2GOOC 1VB0A 1ES7B 2CCXA 1QM7A 1JGKA 1CREA 1LJZA 3NH7A 1CDTA 2MHYA 1HC9B 2H64C 2OFSA 1KS6A 2LCRA 1CRFA 1BTEA 1KC4A 1NORA 2CDXA 2MJ0A 3EVSC 1H0JA 3EBXA 1KBSA 1KXIA 1NYSA 1IJCA 1W6BA 3ERAA 1LXHA 3FEVA 1ZADA 3QB4B 2BHIA 2LA1A 4IYEA 2QJAC 4FAOE 1LX5B 3NEQA 1COEA 2QJBC 3HH7A 1G6MA 1CXNA 2NBTA 4OM4A 1KBTA 5IMTD 4ZQYA 1BXPA 2X8BB 1YWHA 1CODA 1ONJA 2BTXA 1JE9A 5DU1A 2JQPA 5DO6A 1UG4A 3NDSA 4P7UA 1CCQA 1REWC 1I02A 2H64B 1KFHA 1CDSA 2MJYA 4OM5A 1LSIA 2MFAA 1FSCA 1MR6A 2ERAA 3BT2U 2MUOA 4KSNA 1B41B 4LFTA 4AEAA 4BIKB 1RL5A 1KU6B 3PLCA 1XT3A 2MJ4A 6EBXA 2I9BE 3BT1U 1F94A 2HLRA 3LAQU 1FRAA 2K3GA 1FSSB 1TFSA 1LXGA 2L03A 4DO8A 1V6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H7Z B;  1CXO A;  1KBA A;  3VTS A;  1JBD A;  1ERG A;  2N99 A;  1CDR A;  1FFJ A;  1QKE A;  1HOY A;  1CHV S;  2H7Z A;  2H62 D;  3KFD E;  1CB9 A;  1F8U B;  1ERA A;  5EBX A;  1HAA A;  2UWR A;  2CTX A;  2H8U A;  1IDI A;  2PJY B;  4BDT B;  1IDG A;  5IMY C;  1TXB A;  4RUD A;  1IDL A;  4UY2 C;  1S4Y A;  1CDQ A;  1FF4 A;  4FAO C;  2H5F A;  4XJJ A;  2QJ9 C;  1CTX A;  2PJY C;  1ABT A;  2QC1 A;  1HC9 A;  4EY8 B;  1MAH F;  2CRS A;  1IDH A;  1NTN A;  4QTI U;  2ABX A;  1RGJ A;  1IKC A;  2L5S A;  1QKD A;  2JVE A;  3U73 U;  1NTX A;  1PLO A;  1HAJ A;  1FAS A;  1KTZ B;  2MUP A;  1IK8 A;  1TXA A;  1KL8 A;  1NYU A;  2GOO B;  4HQP F;  3U74 U;  3KFD I;  2CRT A;  1DRS A;  1NEA A;  2UX2 A;  2VLW A;  2FD6 U;  1TGX A;  5DZ5 A;  1CVO A;  1NXB A;  2HLQ A;  1M9Z A;  1L4W A;  2H62 C;  2J8B A;  1IQ9 A;  2GOO C;  1VB0 A;  1ES7 B;  2CCX A;  1QM7 A;  1JGK A;  1CRE A;  1LJZ A;  3NH7 A;  1CDT A;  2MHY A;  1HC9 B;  2H64 C;  2OFS A;  1KS6 A;  2LCR A;  1CRF A;  1BTE A;  1KC4 A;  1NOR A;  2CDX A;  2MJ0 A;  3EVS C;  1H0J A;  3EBX A;  1KBS A;  1KXI A;  1NYS A;  1IJC A;  1W6B A;  3ERA A;  1LXH A;  3FEV A;  1ZAD A;  3QB4 B;  2BHI A;  2LA1 A;  4IYE A;  2QJA C;  4FAO E;  1LX5 B;  3NEQ A;  1COE A;  2QJB C;  3HH7 A;  1G6M A;  1CXN A;  2NBT A;  4OM4 A;  1KBT A;  5IMT D;  1BXP A;  2X8B B;  1YWH A;  1COD A;  1ONJ A;  2BTX A;  1JE9 A;  5DU1 A;  2JQP A;  5DO6 A;  1UG4 A;  3NDS A;  4P7U A;  1CCQ A;  1REW C;  1I02 A;  2H64 B;  1KFH A;  1CDS A;  2MJY A;  4OM5 A;  1LSI A;  2MFA A;  1FSC A;  1MR6 A;  2ERA A;  3BT2 U;  2MUO A;  4LFT A;  1B41 B;  4ZQY A;  4AEA A;  4BIK B;  1RL5 A;  1KU6 B;  3PLC A;  1XT3 A;  2MJ4 A;  6EBX A;  2I9B E;  3BT1 U;  1F94 A;  2HLR A;  3LAQ U;  1FRA A;  2K3G A;  1FSS B;  1TFS A;  1LXG A;  2L03 A;  4DO8 A;  1V6P A; 
#chains in the Genus database with same CATH topology
 2H7Z B;  1CXO A;  1KBA A;  3VTS A;  1JBD A;  1ERG A;  2N99 A;  1CDR A;  1FFJ A;  1QKE A;  1HOY A;  1CHV S;  2H7Z A;  2H62 D;  3KFD E;  1CB9 A;  1F8U B;  1ERA A;  5EBX A;  1HAA A;  2UWR A;  2CTX A;  2H8U A;  1IDI A;  2PJY B;  4BDT B;  1IDG A;  5IMY C;  1TXB A;  4RUD A;  1IDL A;  4UY2 C;  1S4Y A;  1CDQ A;  1FF4 A;  4FAO C;  2H5F A;  4XJJ A;  2QJ9 C;  1CTX A;  2PJY C;  1ABT A;  2QC1 A;  1HC9 A;  4EY8 B;  1MAH F;  2CRS A;  1IDH A;  1NTN A;  4QTI U;  2ABX A;  1RGJ A;  1IKC A;  2L5S A;  1QKD A;  2JVE A;  3U73 U;  1NTX A;  1PLO A;  1HAJ A;  1FAS A;  1KTZ B;  2MUP A;  1IK8 A;  1TXA A;  1KL8 A;  1NYU A;  2GOO B;  4HQP F;  3U74 U;  3KFD I;  2CRT A;  1DRS A;  1NEA A;  2UX2 A;  2VLW A;  2FD6 U;  1TGX A;  5DZ5 A;  1CVO A;  1NXB A;  2HLQ A;  1M9Z A;  1L4W A;  2H62 C;  2J8B A;  1IQ9 A;  2GOO C;  1VB0 A;  1ES7 B;  2CCX A;  1QM7 A;  1JGK A;  1CRE A;  1LJZ A;  3NH7 A;  1CDT A;  2MHY A;  1HC9 B;  2H64 C;  2OFS A;  1KS6 A;  2LCR A;  1CRF A;  1BTE A;  1KC4 A;  1NOR A;  2CDX A;  2MJ0 A;  3EVS C;  1H0J A;  3EBX A;  1KBS A;  1KXI A;  1NYS A;  1IJC A;  1W6B A;  3ERA A;  1LXH A;  3FEV A;  1ZAD A;  3QB4 B;  2BHI A;  2LA1 A;  4IYE A;  2QJA C;  4FAO E;  1LX5 B;  3NEQ A;  1COE A;  2QJB C;  3HH7 A;  1G6M A;  1CXN A;  2NBT A;  4OM4 A;  1KBT A;  5IMT D;  4ZQY A;  1BXP A;  2X8B B;  1YWH A;  1COD A;  1ONJ A;  2BTX A;  1JE9 A;  5DU1 A;  2JQP A;  5DO6 A;  1UG4 A;  3NDS A;  4P7U A;  1CCQ A;  1REW C;  1I02 A;  2H64 B;  1KFH A;  1CDS A;  2MJY A;  4OM5 A;  1LSI A;  2MFA A;  1FSC A;  1MR6 A;  2ERA A;  3BT2 U;  2MUO A;  4KSN A;  1B41 B;  4LFT A;  4AEA A;  4BIK B;  1RL5 A;  1KU6 B;  3PLC A;  1XT3 A;  2MJ4 A;  6EBX A;  2I9B E;  3BT1 U;  1F94 A;  2HLR A;  3LAQ U;  1FRA A;  2K3G A;  1FSS B;  1TFS A;  1LXG A;  2L03 A;  4DO8 A;  1V6P A; 
#chains in the Genus database with same CATH homology
 2H7Z B;  1CXO A;  1KBA A;  3VTS A;  1JBD A;  1ERG A;  2N99 A;  1CDR A;  1FFJ A;  1QKE A;  1HOY A;  1CHV S;  2H7Z A;  2H62 D;  3KFD E;  1CB9 A;  1F8U B;  1ERA A;  5EBX A;  1HAA A;  2UWR A;  2CTX A;  2H8U A;  1IDI A;  2PJY B;  4BDT B;  1IDG A;  5IMY C;  1TXB A;  4RUD A;  1IDL A;  4UY2 C;  1S4Y A;  1CDQ A;  1FF4 A;  4FAO C;  2H5F A;  4XJJ A;  2QJ9 C;  1CTX A;  2PJY C;  1ABT A;  2QC1 A;  1HC9 A;  4EY8 B;  1MAH F;  2CRS A;  1IDH A;  1NTN A;  4QTI U;  2ABX A;  1RGJ A;  1IKC A;  2L5S A;  1QKD A;  2JVE A;  3U73 U;  1NTX A;  1PLO A;  1HAJ A;  1FAS A;  1KTZ B;  2MUP A;  1IK8 A;  1TXA A;  1KL8 A;  1NYU A;  2GOO B;  4HQP F;  3U74 U;  3KFD I;  2CRT A;  1DRS A;  1NEA A;  2UX2 A;  2VLW A;  2FD6 U;  1TGX A;  5DZ5 A;  1CVO A;  1NXB A;  2HLQ A;  1M9Z A;  1L4W A;  2H62 C;  2J8B A;  1IQ9 A;  2GOO C;  1VB0 A;  1ES7 B;  2CCX A;  1QM7 A;  1JGK A;  1CRE A;  1LJZ A;  3NH7 A;  1CDT A;  2MHY A;  1HC9 B;  2H64 C;  2OFS A;  1KS6 A;  2LCR A;  1CRF A;  1BTE A;  1KC4 A;  1NOR A;  2CDX A;  2MJ0 A;  3EVS C;  1H0J A;  3EBX A;  1KBS A;  1KXI A;  1NYS A;  1IJC A;  1W6B A;  3ERA A;  1LXH A;  3FEV A;  1ZAD A;  3QB4 B;  2BHI A;  2LA1 A;  4IYE A;  2QJA C;  4FAO E;  1LX5 B;  3NEQ A;  1COE A;  2QJB C;  3HH7 A;  1G6M A;  1CXN A;  2NBT A;  4OM4 A;  1KBT A;  5IMT D;  4ZQY A;  1BXP A;  2X8B B;  1YWH A;  1COD A;  1ONJ A;  2BTX A;  1JE9 A;  5DU1 A;  2JQP A;  5DO6 A;  1UG4 A;  3NDS A;  4P7U A;  1CCQ A;  1REW C;  1I02 A;  2H64 B;  1KFH A;  1CDS A;  2MJY A;  4OM5 A;  1LSI A;  2MFA A;  1FSC A;  1MR6 A;  2ERA A;  3BT2 U;  2MUO A;  4KSN A;  1B41 B;  4LFT A;  4AEA A;  4BIK B;  1RL5 A;  1KU6 B;  3PLC A;  1XT3 A;  2MJ4 A;  6EBX A;  2I9B E;  3BT1 U;  1F94 A;  2HLR A;  3LAQ U;  1FRA A;  2K3G A;  1FSS B;  1TFS A;  1LXG A;  2L03 A;  4DO8 A;  1V6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...