5IMTD

Toxin receptor complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
77
structure length
77
Chain Sequence
LQCYNCPNPTADCKTAVNCSSAFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Receptor Recognition by the Human CD59-Responsive Cholesterol-Dependent Cytolysins.
pubmed doi rcsb
source organism Streptococcus intermedius
molecule tags Toxin
molecule keywords Intermedilysin
total genus 18
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2016-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 5imtD00
1PLOA 4OM5A 3EBXA 4FAOC 1CB9A 2GOOB 2QJBC 1QM7A 1TXAA 1IDIA 2MUOA 1CDSA 2MUPA 5DU1A 3NDSA 1QKEA 5IMTD 1ONJA 2CRSA 2N99A 1LXGA 1ERAA 4RUDA 1F8UB 2CCXA 1KTZB 1IDLA 1MAHF 1G6MA 2H62C 1LX5B 4IYEA 1FASA 4EY8B 1V6PA 1CXNA 1HOYA 1IDGA 2K3GA 1F94A 1L4WA 1ERGA 3BT1U 1NEAA 2FD6U 2QJ9C 2JQPA 1IK8A 3NH7A 1NYSA 3ERAA 1ZADA 4LFTA 1IJCA 1CODA 1COEA 2MJ4A 1KC4A 1IKCA 2MHYA 1XT3A 1NORA 1BTEA 1VB0A 4ZQYA 1LSIA 1I02A 1NTNA 2L03A 3LAQU 1CXOA 1ABTA 1M9ZA 1CHVS 1KS6A 5DZ5A 3FEVA 2MJYA 1ES7B 6EBXA 4DO8A 1DRSA 1TFSA 3KFDE 1IDHA 2MFAA 1FRAA 2LCRA 3EVSC 1RGJA 1JGKA 1CVOA 1H0JA 2JVEA 4AEAA 1FFJA 3VTSA 2QJAC 3QB4B 2ABXA 1BXPA 1KBSA 4QTIU 1HAAA 1B41B 1KFHA 1UG4A 1NYUA 5EBXA 1KBTA 1REWC 3U74U 2MJ0A 1FSSB 4HQPF 1YWHA 1HC9B 4FAOE 1KL8A 1KBAA 2OFSA 1KXIA 1JE9A 1LJZA 2H8UA 2H64C 1CRFA 1NTXA 2H64B 2UWRA 2LA1A 5DO6A 1CDQA 1QKDA 2ERAA 1RL5A 2J8BA 5IMYC 1CDTA 2H7ZB 2PJYC 2HLRA 4BDTB 1TXBA 2BHIA 1TGXA 2CDXA 1S4YA 2CRTA 2H62D 3U73U 1CCQA 4UY2C 1JBDA 1HC9A 1CDRA 2BTXA 2I9BE 2PJYB 2H5FA 3NEQA 2QC1A 4P7UA 1LXHA 1FSCA 1NXBA 2CTXA 3KFDI 1CREA 1KU6B 3HH7A 1FF4A 1IQ9A 2GOOC 2UX2A 3BT2U 4XJJA 2H7ZA 4OM4A 2X8BB 1MR6A 1CTXA 2HLQA 2VLWA 1HAJA 4BIKB 3PLCA 1W6BA 2NBTA 2L5SA
chains in the Genus database with same CATH superfamily
1PLOA 4OM5A 3EBXA 4FAOC 1CB9A 2GOOB 2QJBC 1QM7A 1TXAA 1IDIA 2MUOA 1CDSA 2MUPA 5DU1A 3NDSA 1QKEA 5IMTD 1ONJA 2CRSA 2N99A 1LXGA 1ERAA 4RUDA 1F8UB 2CCXA 1KTZB 1IDLA 1MAHF 1G6MA 2H62C 1LX5B 4IYEA 1FASA 4EY8B 1V6PA 1CXNA 1HOYA 1IDGA 2K3GA 1F94A 1L4WA 1ERGA 3BT1U 1NEAA 2FD6U 2QJ9C 2JQPA 1IK8A 3NH7A 1NYSA 3ERAA 1ZADA 4LFTA 1IJCA 1CODA 1COEA 2MJ4A 1KC4A 1IKCA 2MHYA 1XT3A 1NORA 1BTEA 1VB0A 4ZQYA 1LSIA 1I02A 1NTNA 2L03A 3LAQU 1CXOA 1ABTA 1M9ZA 1CHVS 1KS6A 5DZ5A 3FEVA 2MJYA 1ES7B 6EBXA 4DO8A 1DRSA 1TFSA 3KFDE 1IDHA 2MFAA 1FRAA 2LCRA 3EVSC 1RGJA 1JGKA 1CVOA 1H0JA 2JVEA 4AEAA 1FFJA 3VTSA 2QJAC 3QB4B 2ABXA 1BXPA 1KBSA 4QTIU 1HAAA 1B41B 1KFHA 1UG4A 1NYUA 5EBXA 1KBTA 1REWC 3U74U 2MJ0A 1FSSB 4HQPF 1YWHA 1HC9B 4FAOE 1KL8A 1KBAA 2OFSA 1KXIA 1JE9A 1LJZA 2H8UA 2H64C 1CRFA 1NTXA 2H64B 2UWRA 2LA1A 5DO6A 1CDQA 1QKDA 2ERAA 1RL5A 2J8BA 5IMYC 1CDTA 2H7ZB 4KSNA 2PJYC 2HLRA 4BDTB 1TXBA 2BHIA 1TGXA 2CDXA 1S4YA 2CRTA 2H62D 3U73U 1CCQA 4UY2C 1JBDA 1HC9A 1CDRA 2BTXA 2I9BE 2PJYB 2H5FA 3NEQA 2QC1A 4P7UA 1LXHA 1FSCA 1NXBA 2CTXA 3KFDI 1CREA 1KU6B 3HH7A 1FF4A 1IQ9A 2GOOC 2UX2A 3BT2U 4XJJA 2H7ZA 4OM4A 2X8BB 1MR6A 1CTXA 2HLQA 2VLWA 1HAJA 4BIKB 3PLCA 1W6BA 2NBTA 2L5SA
chains in the Genus database with same CATH topology
1PLOA 4OM5A 3EBXA 4FAOC 1CB9A 2GOOB 2QJBC 1QM7A 1TXAA 1IDIA 2MUOA 1CDSA 2MUPA 5DU1A 3NDSA 1QKEA 5IMTD 1ONJA 2CRSA 2N99A 1LXGA 1ERAA 4RUDA 1F8UB 2CCXA 1KTZB 1IDLA 1MAHF 1G6MA 2H62C 1LX5B 4IYEA 1FASA 4EY8B 1V6PA 1CXNA 1HOYA 1IDGA 2K3GA 1F94A 1L4WA 1ERGA 3BT1U 1NEAA 2FD6U 2QJ9C 2JQPA 1IK8A 3NH7A 1NYSA 3ERAA 1ZADA 4LFTA 1IJCA 1CODA 1COEA 2MJ4A 1KC4A 1IKCA 2MHYA 1XT3A 1NORA 1BTEA 1VB0A 4ZQYA 1LSIA 1I02A 1NTNA 2L03A 3LAQU 1CXOA 1ABTA 1M9ZA 1CHVS 1KS6A 5DZ5A 3FEVA 2MJYA 1ES7B 6EBXA 4DO8A 1DRSA 1TFSA 3KFDE 1IDHA 2MFAA 1FRAA 2LCRA 3EVSC 1RGJA 1JGKA 1CVOA 1H0JA 2JVEA 4AEAA 1FFJA 3VTSA 2QJAC 3QB4B 2ABXA 1BXPA 1KBSA 4QTIU 1HAAA 1B41B 1KFHA 1UG4A 1NYUA 5EBXA 1KBTA 1REWC 3U74U 2MJ0A 1FSSB 4HQPF 1YWHA 1HC9B 4FAOE 1KL8A 1KBAA 2OFSA 1KXIA 1JE9A 1LJZA 2H8UA 2H64C 1CRFA 1NTXA 2H64B 2UWRA 2LA1A 5DO6A 1CDQA 1QKDA 2ERAA 1RL5A 2J8BA 5IMYC 1CDTA 2H7ZB 4KSNA 2PJYC 2HLRA 4BDTB 1TXBA 2BHIA 1TGXA 2CDXA 1S4YA 2CRTA 2H62D 3U73U 1CCQA 4UY2C 1JBDA 1HC9A 1CDRA 2BTXA 2I9BE 2PJYB 2H5FA 3NEQA 2QC1A 4P7UA 1LXHA 1FSCA 1NXBA 2CTXA 3KFDI 1CREA 1KU6B 3HH7A 1FF4A 1IQ9A 2GOOC 2UX2A 3BT2U 4XJJA 2H7ZA 4OM4A 2X8BB 1MR6A 1CTXA 2HLQA 2VLWA 1HAJA 4BIKB 3PLCA 1W6BA 2NBTA 2L5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PLO A;  4OM5 A;  3EBX A;  4FAO C;  1CB9 A;  2GOO B;  2QJB C;  1QM7 A;  1TXA A;  1IDI A;  2MUO A;  1CDS A;  2MUP A;  5DU1 A;  3NDS A;  1QKE A;  5IMT D;  1ONJ A;  2CRS A;  2N99 A;  1LXG A;  1ERA A;  4RUD A;  1F8U B;  2CCX A;  1KTZ B;  1IDL A;  1MAH F;  1G6M A;  2H62 C;  1LX5 B;  4IYE A;  1FAS A;  4EY8 B;  1V6P A;  1CXN A;  1HOY A;  1IDG A;  2K3G A;  1F94 A;  1L4W A;  1ERG A;  3BT1 U;  1NEA A;  2FD6 U;  2QJ9 C;  2JQP A;  1IK8 A;  3NH7 A;  1NYS A;  3ERA A;  1ZAD A;  4LFT A;  1IJC A;  1COD A;  1COE A;  2MJ4 A;  1KC4 A;  1IKC A;  2MHY A;  1XT3 A;  1NOR A;  1BTE A;  1VB0 A;  4ZQY A;  1LSI A;  1I02 A;  1NTN A;  2L03 A;  3LAQ U;  1CXO A;  1ABT A;  1M9Z A;  1CHV S;  1KS6 A;  5DZ5 A;  3FEV A;  2MJY A;  1ES7 B;  6EBX A;  4DO8 A;  1DRS A;  1TFS A;  3KFD E;  1IDH A;  2MFA A;  1FRA A;  2LCR A;  3EVS C;  1RGJ A;  1JGK A;  1CVO A;  1H0J A;  2JVE A;  4AEA A;  1FFJ A;  3VTS A;  2QJA C;  3QB4 B;  2ABX A;  1BXP A;  1KBS A;  4QTI U;  1HAA A;  1B41 B;  1KFH A;  1UG4 A;  1NYU A;  5EBX A;  1KBT A;  1REW C;  3U74 U;  2MJ0 A;  1FSS B;  4HQP F;  1YWH A;  1HC9 B;  4FAO E;  1KL8 A;  1KBA A;  2OFS A;  1KXI A;  1JE9 A;  1LJZ A;  2H8U A;  2H64 C;  1CRF A;  1NTX A;  2H64 B;  2UWR A;  2LA1 A;  5DO6 A;  1CDQ A;  1QKD A;  2ERA A;  1RL5 A;  2J8B A;  5IMY C;  1CDT A;  2H7Z B;  2PJY C;  2HLR A;  4BDT B;  1TXB A;  2BHI A;  1TGX A;  2CDX A;  1S4Y A;  2CRT A;  2H62 D;  3U73 U;  1CCQ A;  4UY2 C;  1JBD A;  1HC9 A;  1CDR A;  2BTX A;  2I9B E;  2PJY B;  2H5F A;  3NEQ A;  2QC1 A;  4P7U A;  1LXH A;  1FSC A;  1NXB A;  2CTX A;  3KFD I;  1CRE A;  1KU6 B;  3HH7 A;  1FF4 A;  1IQ9 A;  2GOO C;  2UX2 A;  3BT2 U;  4XJJ A;  2H7Z A;  4OM4 A;  2X8B B;  1MR6 A;  1CTX A;  2HLQ A;  2VLW A;  1HAJ A;  4BIK B;  3PLC A;  1W6B A;  2NBT A;  2L5S A; 
#chains in the Genus database with same CATH topology
 1PLO A;  4OM5 A;  3EBX A;  4FAO C;  1CB9 A;  2GOO B;  2QJB C;  1QM7 A;  1TXA A;  1IDI A;  2MUO A;  1CDS A;  2MUP A;  5DU1 A;  3NDS A;  1QKE A;  5IMT D;  1ONJ A;  2CRS A;  2N99 A;  1LXG A;  1ERA A;  4RUD A;  1F8U B;  2CCX A;  1KTZ B;  1IDL A;  1MAH F;  1G6M A;  2H62 C;  1LX5 B;  4IYE A;  1FAS A;  4EY8 B;  1V6P A;  1CXN A;  1HOY A;  1IDG A;  2K3G A;  1F94 A;  1L4W A;  1ERG A;  3BT1 U;  1NEA A;  2FD6 U;  2QJ9 C;  2JQP A;  1IK8 A;  3NH7 A;  1NYS A;  3ERA A;  1ZAD A;  4LFT A;  1IJC A;  1COD A;  1COE A;  2MJ4 A;  1KC4 A;  1IKC A;  2MHY A;  1XT3 A;  1NOR A;  1BTE A;  1VB0 A;  4ZQY A;  1LSI A;  1I02 A;  1NTN A;  2L03 A;  3LAQ U;  1CXO A;  1ABT A;  1M9Z A;  1CHV S;  1KS6 A;  5DZ5 A;  3FEV A;  2MJY A;  1ES7 B;  6EBX A;  4DO8 A;  1DRS A;  1TFS A;  3KFD E;  1IDH A;  2MFA A;  1FRA A;  2LCR A;  3EVS C;  1RGJ A;  1JGK A;  1CVO A;  1H0J A;  2JVE A;  4AEA A;  1FFJ A;  3VTS A;  2QJA C;  3QB4 B;  2ABX A;  1BXP A;  1KBS A;  4QTI U;  1HAA A;  1B41 B;  1KFH A;  1UG4 A;  1NYU A;  5EBX A;  1KBT A;  1REW C;  3U74 U;  2MJ0 A;  1FSS B;  4HQP F;  1YWH A;  1HC9 B;  4FAO E;  1KL8 A;  1KBA A;  2OFS A;  1KXI A;  1JE9 A;  1LJZ A;  2H8U A;  2H64 C;  1CRF A;  1NTX A;  2H64 B;  2UWR A;  2LA1 A;  5DO6 A;  1CDQ A;  1QKD A;  2ERA A;  1RL5 A;  2J8B A;  5IMY C;  1CDT A;  2H7Z B;  4KSN A;  2PJY C;  2HLR A;  4BDT B;  1TXB A;  2BHI A;  1TGX A;  2CDX A;  1S4Y A;  2CRT A;  2H62 D;  3U73 U;  1CCQ A;  4UY2 C;  1JBD A;  1HC9 A;  1CDR A;  2BTX A;  2I9B E;  2PJY B;  2H5F A;  3NEQ A;  2QC1 A;  4P7U A;  1LXH A;  1FSC A;  1NXB A;  2CTX A;  3KFD I;  1CRE A;  1KU6 B;  3HH7 A;  1FF4 A;  1IQ9 A;  2GOO C;  2UX2 A;  3BT2 U;  4XJJ A;  2H7Z A;  4OM4 A;  2X8B B;  1MR6 A;  1CTX A;  2HLQ A;  2VLW A;  1HAJ A;  4BIK B;  3PLC A;  1W6B A;  2NBT A;  2L5S A; 
#chains in the Genus database with same CATH homology
 1PLO A;  4OM5 A;  3EBX A;  4FAO C;  1CB9 A;  2GOO B;  2QJB C;  1QM7 A;  1TXA A;  1IDI A;  2MUO A;  1CDS A;  2MUP A;  5DU1 A;  3NDS A;  1QKE A;  5IMT D;  1ONJ A;  2CRS A;  2N99 A;  1LXG A;  1ERA A;  4RUD A;  1F8U B;  2CCX A;  1KTZ B;  1IDL A;  1MAH F;  1G6M A;  2H62 C;  1LX5 B;  4IYE A;  1FAS A;  4EY8 B;  1V6P A;  1CXN A;  1HOY A;  1IDG A;  2K3G A;  1F94 A;  1L4W A;  1ERG A;  3BT1 U;  1NEA A;  2FD6 U;  2QJ9 C;  2JQP A;  1IK8 A;  3NH7 A;  1NYS A;  3ERA A;  1ZAD A;  4LFT A;  1IJC A;  1COD A;  1COE A;  2MJ4 A;  1KC4 A;  1IKC A;  2MHY A;  1XT3 A;  1NOR A;  1BTE A;  1VB0 A;  4ZQY A;  1LSI A;  1I02 A;  1NTN A;  2L03 A;  3LAQ U;  1CXO A;  1ABT A;  1M9Z A;  1CHV S;  1KS6 A;  5DZ5 A;  3FEV A;  2MJY A;  1ES7 B;  6EBX A;  4DO8 A;  1DRS A;  1TFS A;  3KFD E;  1IDH A;  2MFA A;  1FRA A;  2LCR A;  3EVS C;  1RGJ A;  1JGK A;  1CVO A;  1H0J A;  2JVE A;  4AEA A;  1FFJ A;  3VTS A;  2QJA C;  3QB4 B;  2ABX A;  1BXP A;  1KBS A;  4QTI U;  1HAA A;  1B41 B;  1KFH A;  1UG4 A;  1NYU A;  5EBX A;  1KBT A;  1REW C;  3U74 U;  2MJ0 A;  1FSS B;  4HQP F;  1YWH A;  1HC9 B;  4FAO E;  1KL8 A;  1KBA A;  2OFS A;  1KXI A;  1JE9 A;  1LJZ A;  2H8U A;  2H64 C;  1CRF A;  1NTX A;  2H64 B;  2UWR A;  2LA1 A;  5DO6 A;  1CDQ A;  1QKD A;  2ERA A;  1RL5 A;  2J8B A;  5IMY C;  1CDT A;  2H7Z B;  4KSN A;  2PJY C;  2HLR A;  4BDT B;  1TXB A;  2BHI A;  1TGX A;  2CDX A;  1S4Y A;  2CRT A;  2H62 D;  3U73 U;  1CCQ A;  4UY2 C;  1JBD A;  1HC9 A;  1CDR A;  2BTX A;  2I9B E;  2PJY B;  2H5F A;  3NEQ A;  2QC1 A;  4P7U A;  1LXH A;  1FSC A;  1NXB A;  2CTX A;  3KFD I;  1CRE A;  1KU6 B;  3HH7 A;  1FF4 A;  1IQ9 A;  2GOO C;  2UX2 A;  3BT2 U;  4XJJ A;  2H7Z A;  4OM4 A;  2X8B B;  1MR6 A;  1CTX A;  2HLQ A;  2VLW A;  1HAJ A;  4BIK B;  3PLC A;  1W6B A;  2NBT A;  2L5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...