2BWXA

His354ala escherichia coli aminopeptidase p
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSAWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
total genus 159
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwxA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwxA02
3PEBA 3TAVA 2P9AA 1BOAA 1Y1NA 1WL9A 4IDYA 2ZSGA 2NQ6A 3FM3A 2EA2A 3IG4A 4U6ZA 2GGBA 1QXWA 4FO7A 1WN1A 3PKBA 1W7VA 2GG2A 2IW2A 3RVAA 1WKMA 5CDVA 1WY2A 1C22A 4IF7A 1KQ9A 3OOOA 2V3YA 2BHCA 2V6CA 5CIKA 2BB7A 1C24A 3PN9A 2GG7A 4FUKA 2GU5A 3MATA 3CB6A 4RZZA 2EVOA 4ZNGA 1XGOA 2GG0A 1PV9A 2GG9A 2BWWA 2V3ZA 3S6BA 2GTXA 3Q6DA 1YW8A 5D6FA 4MATA 1QXZA 3PKAA 4S01A 2BHDA 1XGNA 3FMQA 5E5BA 2BWXA 2GG3A 4U70A 1R5GA 4RGZ1 2ADUA 4HXXA 2BWUA 2EVMA 3MX6A 2G6PA 3O5VA 5CNXA 5CDLA 4RZYA 2V3XA 4KM3A 4FLKA 1R5HA 1C23A 1O0XA 2OAZA 1W2MA 2GGCA 2BWTA 1XGMA 3IU8A 3QOCA 3TB5A 3I7MA 4S2TP 1XNZA 3PKDA 5E2CA 1R58A 3IL0A 3IU9A 1YW9A 4FO8A 1KP0A 3PKEA 4IKTA 2HOWA 5CDEA 2B3LA 1C27A 2NQ7A 3MR1A 1WL6A 4A6VA 4U6JA 4S2RP 1MATA 3PKCA 4IKUA 3D27A 2Q94A 1CHMA 1YJ3A 4FKCA 1YW7A 2BH3A 2GU6A 4ZWPA 4EGEA 1QXYA 2MATA 4FLIA 5FCFA 4Z7MA 4U6CA 4IKRA 2B3KA 3BIQA 2BHAA 3FMRA 3RORA 4IKSA 1B59A 1B6AA 3OVKA 4PV4A 4IPAA 1M35A 1XGSA 5JFRA 4A6WA 4U6WA 2Q93A 4U76A 5D6EA 1C21A 1KQ0A 1JAWA 4ZWUA 4IECA 1A16A 2BWYA 2GU7A 3BITA 5FCHA 2BN7A 2Q95A 5CLSA 5JI6A 1WBQA 2GA2A 4PNCA 3CB5A 4FLLA 4U75A 5CE6A 1BN5A 2B3HA 4ZWOA 1QZYA 1YVMA 4U73A 1WLRA 2P98A 2Q92A 4FLJA 2Q96A 3CTZA 4JUQA 2BWSA 2GG5A 2P99A 2BWVA 2EA4A 4S00A 1N51A 2DFIA 4U1BA 2BHBA 4IU6A 3L24A 4OOKA 4U69A 2OKNA 2GG8A 4R60A 2GZ5A 4U71A 2Q8KA 4U6EA 4B28A 3BIPA 2GU4A 3L7GA 4QR8A 2EVCA 3IU7A 5JHUA
chains in the Genus database with same CATH superfamily
3PEBA 3TAVA 2P9AA 1BOAA 1Y1NA 1WL9A 4IDYA 2ZSGA 2NQ6A 3FM3A 2EA2A 3IG4A 4U6ZA 2GGBA 1QXWA 4FO7A 1WN1A 3PKBA 1W7VA 2GG2A 2IW2A 3RVAA 1WKMA 5CDVA 1WY2A 1C22A 4IF7A 1KQ9A 3OOOA 2V3YA 2BHCA 2V6CA 5CIKA 2BB7A 1C24A 3PN9A 2GG7A 4FUKA 2GU5A 3MATA 3CB6A 4RZZA 2EVOA 4ZNGA 1XGOA 2GG0A 1PV9A 2GG9A 2BWWA 2V3ZA 3S6BA 2GTXA 3Q6DA 1YW8A 5D6FA 4MATA 1QXZA 3PKAA 4S01A 2BHDA 1XGNA 3FMQA 5E5BA 2BWXA 2GG3A 4U70A 1R5GA 4RGZ1 2ADUA 4HXXA 2BWUA 2EVMA 3MX6A 2G6PA 3O5VA 5CNXA 5CDLA 4RZYA 2V3XA 4KM3A 4FLKA 1R5HA 1C23A 1O0XA 2OAZA 1W2MA 2GGCA 2BWTA 1XGMA 3IU8A 3QOCA 3TB5A 3I7MA 4S2TP 1XNZA 3PKDA 5E2CA 1R58A 3IL0A 3IU9A 1YW9A 4FO8A 1KP0A 3PKEA 4IKTA 2HOWA 5CDEA 2B3LA 1C27A 2NQ7A 3MR1A 1WL6A 4A6VA 4U6JA 4S2RP 1MATA 3PKCA 4IKUA 3D27A 2Q94A 1CHMA 1YJ3A 4FKCA 1YW7A 2BH3A 2GU6A 4ZWPA 4EGEA 1QXYA 2MATA 4FLIA 5FCFA 4Z7MA 4U6CA 4IKRA 2B3KA 3BIQA 2BHAA 3FMRA 3RORA 4IKSA 1B59A 1B6AA 3OVKA 4PV4A 4IPAA 1M35A 1XGSA 5JFRA 4A6WA 4U6WA 2Q93A 4U76A 5D6EA 1C21A 1KQ0A 1JAWA 4ZWUA 4IECA 1A16A 2BWYA 2GU7A 3BITA 5FCHA 2BN7A 2Q95A 5CLSA 5JI6A 1WBQA 2GA2A 4PNCA 3CB5A 4FLLA 4U75A 5CE6A 1BN5A 2B3HA 4ZWOA 1QZYA 1YVMA 4U73A 1WLRA 2P98A 2Q92A 4FLJA 2Q96A 3CTZA 4JUQA 2BWSA 2GG5A 2P99A 2BWVA 2EA4A 4S00A 1N51A 2DFIA 4U1BA 2BHBA 4IU6A 3L24A 4OOKA 4U69A 2OKNA 2GG8A 4R60A 2GZ5A 4U71A 2Q8KA 4U6EA 4B28A 3BIPA 2GU4A 3L7GA 4QR8A 2EVCA 3IU7A 5JHUA
chains in the Genus database with same CATH topology
3PEBA 3TAVA 2P9AA 1BOAA 1Y1NA 1WL9A 4IDYA 2ZSGA 2NQ6A 3FM3A 2EA2A 3IG4A 4U6ZA 2GGBA 1QXWA 4FO7A 1WN1A 3PKBA 1W7VA 2GG2A 2IW2A 3RVAA 1WKMA 5CDVA 1WY2A 1C22A 4IF7A 1KQ9A 3OOOA 2V3YA 2BHCA 2V6CA 5CIKA 2BB7A 1C24A 3PN9A 2GG7A 4FUKA 2GU5A 3MATA 3CB6A 4RZZA 2EVOA 4ZNGA 1XGOA 2GG0A 1PV9A 2GG9A 2BWWA 2V3ZA 3S6BA 2GTXA 3Q6DA 1YW8A 5D6FA 4MATA 1QXZA 3PKAA 4S01A 2BHDA 1XGNA 3FMQA 5E5BA 2BWXA 2GG3A 4U70A 1R5GA 4RGZ1 2ADUA 4HXXA 2BWUA 2EVMA 3MX6A 2G6PA 3O5VA 5CNXA 5CDLA 4RZYA 2V3XA 4KM3A 4FLKA 1R5HA 1C23A 1O0XA 2OAZA 1W2MA 2GGCA 2BWTA 1XGMA 3IU8A 3QOCA 3TB5A 3I7MA 4S2TP 1XNZA 3PKDA 5E2CA 1R58A 3IL0A 3IU9A 1YW9A 4FO8A 1KP0A 3PKEA 4IKTA 2HOWA 5CDEA 2B3LA 1C27A 2NQ7A 3MR1A 1WL6A 4A6VA 4U6JA 4S2RP 1MATA 3PKCA 4IKUA 3D27A 2Q94A 1CHMA 1YJ3A 4FKCA 1YW7A 2BH3A 2GU6A 4ZWPA 4EGEA 1QXYA 2MATA 4FLIA 5FCFA 4Z7MA 4U6CA 4IKRA 2B3KA 3BIQA 2BHAA 3FMRA 3RORA 4IKSA 1B59A 1B6AA 3OVKA 4PV4A 4IPAA 1M35A 1XGSA 5JFRA 4A6WA 4U6WA 2Q93A 4U76A 5D6EA 1C21A 1KQ0A 1JAWA 4ZWUA 4IECA 1A16A 2BWYA 2GU7A 3BITA 5FCHA 2BN7A 2Q95A 5CLSA 5JI6A 1WBQA 2GA2A 4PNCA 3CB5A 4FLLA 4U75A 5CE6A 1BN5A 2B3HA 4ZWOA 1QZYA 1YVMA 4U73A 1WLRA 2P98A 2Q92A 4FLJA 2Q96A 3CTZA 4JUQA 2BWSA 2GG5A 2P99A 2BWVA 2EA4A 4S00A 1N51A 2DFIA 4U1BA 2BHBA 4IU6A 3L24A 4OOKA 4U69A 2OKNA 2GG8A 4R60A 2GZ5A 4U71A 2Q8KA 4U6EA 4B28A 3BIPA 2GU4A 3L7GA 4QR8A 2EVCA 3IU7A 5JHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEB A;  3TAV A;  2P9A A;  1BOA A;  1Y1N A;  1WL9 A;  4IDY A;  2ZSG A;  2NQ6 A;  3FM3 A;  2EA2 A;  3IG4 A;  4U6Z A;  2GGB A;  1QXW A;  4FO7 A;  1WN1 A;  3PKB A;  1W7V A;  2GG2 A;  2IW2 A;  3RVA A;  1WKM A;  5CDV A;  1WY2 A;  1C22 A;  4IF7 A;  1KQ9 A;  3OOO A;  2V3Y A;  2BHC A;  2V6C A;  5CIK A;  2BB7 A;  1C24 A;  3PN9 A;  2GG7 A;  4FUK A;  2GU5 A;  3MAT A;  3CB6 A;  4RZZ A;  2EVO A;  4ZNG A;  1XGO A;  2GG0 A;  1PV9 A;  2GG9 A;  2BWW A;  2V3Z A;  3S6B A;  2GTX A;  3Q6D A;  1YW8 A;  5D6F A;  4MAT A;  1QXZ A;  3PKA A;  4S01 A;  2BHD A;  1XGN A;  3FMQ A;  5E5B A;  2BWX A;  2GG3 A;  4U70 A;  1R5G A;  4RGZ 1;  2ADU A;  4HXX A;  2BWU A;  2EVM A;  3MX6 A;  2G6P A;  3O5V A;  5CNX A;  5CDL A;  4RZY A;  2V3X A;  4KM3 A;  4FLK A;  1R5H A;  1C23 A;  1O0X A;  2OAZ A;  1W2M A;  2GGC A;  2BWT A;  1XGM A;  3IU8 A;  3QOC A;  3TB5 A;  3I7M A;  4S2T P;  1XNZ A;  3PKD A;  5E2C A;  1R58 A;  3IL0 A;  3IU9 A;  1YW9 A;  4FO8 A;  1KP0 A;  3PKE A;  4IKT A;  2HOW A;  5CDE A;  2B3L A;  1C27 A;  2NQ7 A;  3MR1 A;  1WL6 A;  4A6V A;  4U6J A;  4S2R P;  1MAT A;  3PKC A;  4IKU A;  3D27 A;  2Q94 A;  1CHM A;  1YJ3 A;  4FKC A;  1YW7 A;  2BH3 A;  2GU6 A;  4ZWP A;  4EGE A;  1QXY A;  2MAT A;  4FLI A;  5FCF A;  4Z7M A;  4U6C A;  4IKR A;  2B3K A;  3BIQ A;  2BHA A;  3FMR A;  3ROR A;  4IKS A;  1B59 A;  1B6A A;  3OVK A;  4PV4 A;  4IPA A;  1M35 A;  1XGS A;  5JFR A;  4A6W A;  4U6W A;  2Q93 A;  4U76 A;  5D6E A;  1C21 A;  1KQ0 A;  1JAW A;  4ZWU A;  4IEC A;  1A16 A;  2BWY A;  2GU7 A;  3BIT A;  5FCH A;  2BN7 A;  2Q95 A;  5CLS A;  5JI6 A;  1WBQ A;  2GA2 A;  4PNC A;  3CB5 A;  4FLL A;  4U75 A;  5CE6 A;  1BN5 A;  2B3H A;  4ZWO A;  1QZY A;  1YVM A;  4U73 A;  1WLR A;  2P98 A;  2Q92 A;  4FLJ A;  2Q96 A;  3CTZ A;  4JUQ A;  2BWS A;  2GG5 A;  2P99 A;  2BWV A;  2EA4 A;  4S00 A;  1N51 A;  2DFI A;  4U1B A;  2BHB A;  4IU6 A;  3L24 A;  4OOK A;  4U69 A;  2OKN A;  2GG8 A;  4R60 A;  2GZ5 A;  4U71 A;  2Q8K A;  4U6E A;  4B28 A;  3BIP A;  2GU4 A;  3L7G A;  4QR8 A;  2EVC A;  3IU7 A;  5JHU A; 
#chains in the Genus database with same CATH topology
 3PEB A;  3TAV A;  2P9A A;  1BOA A;  1Y1N A;  1WL9 A;  4IDY A;  2ZSG A;  2NQ6 A;  3FM3 A;  2EA2 A;  3IG4 A;  4U6Z A;  2GGB A;  1QXW A;  4FO7 A;  1WN1 A;  3PKB A;  1W7V A;  2GG2 A;  2IW2 A;  3RVA A;  1WKM A;  5CDV A;  1WY2 A;  1C22 A;  4IF7 A;  1KQ9 A;  3OOO A;  2V3Y A;  2BHC A;  2V6C A;  5CIK A;  2BB7 A;  1C24 A;  3PN9 A;  2GG7 A;  4FUK A;  2GU5 A;  3MAT A;  3CB6 A;  4RZZ A;  2EVO A;  4ZNG A;  1XGO A;  2GG0 A;  1PV9 A;  2GG9 A;  2BWW A;  2V3Z A;  3S6B A;  2GTX A;  3Q6D A;  1YW8 A;  5D6F A;  4MAT A;  1QXZ A;  3PKA A;  4S01 A;  2BHD A;  1XGN A;  3FMQ A;  5E5B A;  2BWX A;  2GG3 A;  4U70 A;  1R5G A;  4RGZ 1;  2ADU A;  4HXX A;  2BWU A;  2EVM A;  3MX6 A;  2G6P A;  3O5V A;  5CNX A;  5CDL A;  4RZY A;  2V3X A;  4KM3 A;  4FLK A;  1R5H A;  1C23 A;  1O0X A;  2OAZ A;  1W2M A;  2GGC A;  2BWT A;  1XGM A;  3IU8 A;  3QOC A;  3TB5 A;  3I7M A;  4S2T P;  1XNZ A;  3PKD A;  5E2C A;  1R58 A;  3IL0 A;  3IU9 A;  1YW9 A;  4FO8 A;  1KP0 A;  3PKE A;  4IKT A;  2HOW A;  5CDE A;  2B3L A;  1C27 A;  2NQ7 A;  3MR1 A;  1WL6 A;  4A6V A;  4U6J A;  4S2R P;  1MAT A;  3PKC A;  4IKU A;  3D27 A;  2Q94 A;  1CHM A;  1YJ3 A;  4FKC A;  1YW7 A;  2BH3 A;  2GU6 A;  4ZWP A;  4EGE A;  1QXY A;  2MAT A;  4FLI A;  5FCF A;  4Z7M A;  4U6C A;  4IKR A;  2B3K A;  3BIQ A;  2BHA A;  3FMR A;  3ROR A;  4IKS A;  1B59 A;  1B6A A;  3OVK A;  4PV4 A;  4IPA A;  1M35 A;  1XGS A;  5JFR A;  4A6W A;  4U6W A;  2Q93 A;  4U76 A;  5D6E A;  1C21 A;  1KQ0 A;  1JAW A;  4ZWU A;  4IEC A;  1A16 A;  2BWY A;  2GU7 A;  3BIT A;  5FCH A;  2BN7 A;  2Q95 A;  5CLS A;  5JI6 A;  1WBQ A;  2GA2 A;  4PNC A;  3CB5 A;  4FLL A;  4U75 A;  5CE6 A;  1BN5 A;  2B3H A;  4ZWO A;  1QZY A;  1YVM A;  4U73 A;  1WLR A;  2P98 A;  2Q92 A;  4FLJ A;  2Q96 A;  3CTZ A;  4JUQ A;  2BWS A;  2GG5 A;  2P99 A;  2BWV A;  2EA4 A;  4S00 A;  1N51 A;  2DFI A;  4U1B A;  2BHB A;  4IU6 A;  3L24 A;  4OOK A;  4U69 A;  2OKN A;  2GG8 A;  4R60 A;  2GZ5 A;  4U71 A;  2Q8K A;  4U6E A;  4B28 A;  3BIP A;  2GU4 A;  3L7G A;  4QR8 A;  2EVC A;  3IU7 A;  5JHU A; 
#chains in the Genus database with same CATH homology
 3PEB A;  3TAV A;  2P9A A;  1BOA A;  1Y1N A;  1WL9 A;  4IDY A;  2ZSG A;  2NQ6 A;  3FM3 A;  2EA2 A;  3IG4 A;  4U6Z A;  2GGB A;  1QXW A;  4FO7 A;  1WN1 A;  3PKB A;  1W7V A;  2GG2 A;  2IW2 A;  3RVA A;  1WKM A;  5CDV A;  1WY2 A;  1C22 A;  4IF7 A;  1KQ9 A;  3OOO A;  2V3Y A;  2BHC A;  2V6C A;  5CIK A;  2BB7 A;  1C24 A;  3PN9 A;  2GG7 A;  4FUK A;  2GU5 A;  3MAT A;  3CB6 A;  4RZZ A;  2EVO A;  4ZNG A;  1XGO A;  2GG0 A;  1PV9 A;  2GG9 A;  2BWW A;  2V3Z A;  3S6B A;  2GTX A;  3Q6D A;  1YW8 A;  5D6F A;  4MAT A;  1QXZ A;  3PKA A;  4S01 A;  2BHD A;  1XGN A;  3FMQ A;  5E5B A;  2BWX A;  2GG3 A;  4U70 A;  1R5G A;  4RGZ 1;  2ADU A;  4HXX A;  2BWU A;  2EVM A;  3MX6 A;  2G6P A;  3O5V A;  5CNX A;  5CDL A;  4RZY A;  2V3X A;  4KM3 A;  4FLK A;  1R5H A;  1C23 A;  1O0X A;  2OAZ A;  1W2M A;  2GGC A;  2BWT A;  1XGM A;  3IU8 A;  3QOC A;  3TB5 A;  3I7M A;  4S2T P;  1XNZ A;  3PKD A;  5E2C A;  1R58 A;  3IL0 A;  3IU9 A;  1YW9 A;  4FO8 A;  1KP0 A;  3PKE A;  4IKT A;  2HOW A;  5CDE A;  2B3L A;  1C27 A;  2NQ7 A;  3MR1 A;  1WL6 A;  4A6V A;  4U6J A;  4S2R P;  1MAT A;  3PKC A;  4IKU A;  3D27 A;  2Q94 A;  1CHM A;  1YJ3 A;  4FKC A;  1YW7 A;  2BH3 A;  2GU6 A;  4ZWP A;  4EGE A;  1QXY A;  2MAT A;  4FLI A;  5FCF A;  4Z7M A;  4U6C A;  4IKR A;  2B3K A;  3BIQ A;  2BHA A;  3FMR A;  3ROR A;  4IKS A;  1B59 A;  1B6A A;  3OVK A;  4PV4 A;  4IPA A;  1M35 A;  1XGS A;  5JFR A;  4A6W A;  4U6W A;  2Q93 A;  4U76 A;  5D6E A;  1C21 A;  1KQ0 A;  1JAW A;  4ZWU A;  4IEC A;  1A16 A;  2BWY A;  2GU7 A;  3BIT A;  5FCH A;  2BN7 A;  2Q95 A;  5CLS A;  5JI6 A;  1WBQ A;  2GA2 A;  4PNC A;  3CB5 A;  4FLL A;  4U75 A;  5CE6 A;  1BN5 A;  2B3H A;  4ZWO A;  1QZY A;  1YVM A;  4U73 A;  1WLR A;  2P98 A;  2Q92 A;  4FLJ A;  2Q96 A;  3CTZ A;  4JUQ A;  2BWS A;  2GG5 A;  2P99 A;  2BWV A;  2EA4 A;  4S00 A;  1N51 A;  2DFI A;  4U1B A;  2BHB A;  4IU6 A;  3L24 A;  4OOK A;  4U69 A;  2OKN A;  2GG8 A;  4R60 A;  2GZ5 A;  4U71 A;  2Q8K A;  4U6E A;  4B28 A;  3BIP A;  2GU4 A;  3L7G A;  4QR8 A;  2EVC A;  3IU7 A;  5JHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...