4FKCA

Recombinant prolidase from thermococcus sibiricus
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
370
structure length
370
Chain Sequence
HHHGSMDYKRRIHKFQAHFGKKGFEGALVAPGSNFYYLTGFNPLGTLERLFVLILPSEGLLTAIAPRLYEKELEEFNGEVVLWSDSENPYKIFATKIKETFKEGEKLLIDDTMPVGVFLKAKDIFDKYSLHPISPVISELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEFGADDVSFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGPPSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGEYFIHRTGHGLGIDVHEEPYISPGNKKILKDGMVFTIEPGIYLQGKFGVRIEDDVALVDKKGIRLTNADRELITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Influence of intermolecular contacts on the structure of recombinant prolidase from Thermococcus sibiricus.
pubmed doi rcsb
source organism Thermococcus sibiricus
molecule tags Hydrolase
molecule keywords Xaa-Pro aminopeptidase
total genus 122
structure length 370
sequence length 370
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4fkcA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fkcA02
2B3LA 4U75A 3PEBA 3PKDA 1A16A 4IU6A 3MR1A 4U69A 3OOOA 1PV9A 5JFRA 3IU9A 4U73A 1KQ0A 1WL9A 1WL6A 4IF7A 3MX6A 1CHMA 1WLRA 2BWWA 2GU5A 4IKTA 4FLLA 3MATA 2GG7A 1WBQA 3IG4A 1B6AA 2NQ7A 5CNXA 2GTXA 5JHUA 2V3XA 4MATA 5D6FA 1YW7A 5FCFA 5CLSA 2GA2A 4U6JA 2EVMA 2B3KA 3S6BA 2BWTA 5CDLA 3PN9A 1WKMA 4PV4A 4U70A 3CB6A 4U1BA 3OVKA 1QXWA 2GU4A 1O0XA 3BIPA 2OAZA 2BHCA 1BOAA 4PNCA 2BWYA 4RZYA 3TAVA 3CTZA 1W7VA 1C27A 1YW9A 5CDVA 2Q95A 1N51A 1C24A 3RORA 4S2RP 3IU7A 2GZ5A 4ZWPA 4S00A 1XGSA 4FLJA 2BH3A 1R58A 4U6WA 4IPAA 4A6WA 2ZSGA 1QXYA 2P98A 3PKCA 4U76A 2GG0A 2GG3A 2BWUA 2Q92A 4IECA 3BITA 3QOCA 1XGMA 2GG5A 4FUKA 3D27A 2GU6A 1YW8A 2P9AA 4B28A 1QXZA 1KQ9A 2BB7A 3O5VA 1BN5A 4Z7MA 3FM3A 1YVMA 4ZWOA 4U6CA 1C23A 2Q94A 5CE6A 4S01A 5E2CA 4U71A 2HOWA 2B3HA 4QR8A 3PKBA 4OOKA 1R5HA 4IKUA 5E5BA 2ADUA 3L7GA 3RVAA 4U6ZA 3L24A 3Q6DA 2MATA 3PKEA 1KP0A 4FKCA 3I7MA 4FLKA 4FO8A 3BIQA 3IL0A 5FCHA 5CDEA 4JUQA 5D6EA 3TB5A 4IKRA 1Y1NA 1C22A 1R5GA 1XGOA 4FO7A 4RZZA 1WN1A 4R60A 4FLIA 3PKAA 4HXXA 2BWVA 2P99A 2EA4A 4A6VA 2GG9A 2Q96A 2EVOA 1B59A 2NQ6A 4IKSA 2V3YA 2BN7A 2EVCA 2DFIA 2GU7A 1WY2A 2GG8A 1JAWA 1XGNA 4ZNGA 2V3ZA 4EGEA 2V6CA 1W2MA 2GGBA 2G6PA 2GG2A 4U6EA 1M35A 2Q8KA 2IW2A 1MATA 2Q93A 2EA2A 2BHAA 2BHBA 4ZWUA 1XNZA 2GGCA 2BWSA 1C21A 4IDYA 3FMRA 1QZYA 3FMQA 4KM3A 3IU8A 4S2TP 4RGZ1 3CB5A 2BWXA 1YJ3A 5JI6A 2BHDA 2OKNA 5CIKA
chains in the Genus database with same CATH superfamily
2B3LA 4U75A 3PEBA 3PKDA 1A16A 4IU6A 3MR1A 4U69A 3OOOA 1PV9A 5JFRA 3IU9A 4U73A 1KQ0A 1WL9A 1WL6A 4IF7A 3MX6A 1CHMA 1WLRA 2BWWA 2GU5A 4IKTA 4FLLA 3MATA 2GG7A 1WBQA 3IG4A 1B6AA 2NQ7A 5CNXA 2GTXA 5JHUA 2V3XA 4MATA 5D6FA 1YW7A 5FCFA 5CLSA 2GA2A 4U6JA 2EVMA 2B3KA 3S6BA 2BWTA 5CDLA 3PN9A 1WKMA 4PV4A 4U70A 3CB6A 4U1BA 3OVKA 1QXWA 2GU4A 1O0XA 3BIPA 2OAZA 2BHCA 1BOAA 4PNCA 2BWYA 4RZYA 3TAVA 3CTZA 1W7VA 1C27A 1YW9A 5CDVA 2Q95A 1N51A 1C24A 3RORA 4S2RP 3IU7A 2GZ5A 4ZWPA 4S00A 1XGSA 4FLJA 2BH3A 1R58A 4U6WA 4IPAA 4A6WA 2ZSGA 1QXYA 2P98A 3PKCA 4U76A 2GG0A 2GG3A 2BWUA 2Q92A 4IECA 3BITA 3QOCA 1XGMA 2GG5A 4FUKA 3D27A 2GU6A 1YW8A 2P9AA 4B28A 1QXZA 1KQ9A 2BB7A 3O5VA 1BN5A 4Z7MA 3FM3A 1YVMA 4ZWOA 4U6CA 1C23A 2Q94A 5CE6A 4S01A 5E2CA 4U71A 2HOWA 2B3HA 4QR8A 3PKBA 4OOKA 1R5HA 4IKUA 5E5BA 2ADUA 3L7GA 3RVAA 4U6ZA 3L24A 3Q6DA 2MATA 3PKEA 1KP0A 4FKCA 3I7MA 4FLKA 4FO8A 3BIQA 3IL0A 5FCHA 5CDEA 4JUQA 5D6EA 3TB5A 4IKRA 1Y1NA 1C22A 1R5GA 1XGOA 4FO7A 4RZZA 1WN1A 4R60A 4FLIA 3PKAA 4HXXA 2BWVA 2P99A 2EA4A 4A6VA 2GG9A 2Q96A 2EVOA 1B59A 2NQ6A 4IKSA 2V3YA 2BN7A 2EVCA 2DFIA 2GU7A 1WY2A 2GG8A 1JAWA 1XGNA 4ZNGA 2V3ZA 4EGEA 2V6CA 1W2MA 2GGBA 2G6PA 2GG2A 4U6EA 1M35A 2Q8KA 2IW2A 1MATA 2Q93A 2EA2A 2BHAA 2BHBA 4ZWUA 1XNZA 2GGCA 2BWSA 1C21A 4IDYA 3FMRA 1QZYA 3FMQA 4KM3A 3IU8A 4S2TP 4RGZ1 3CB5A 2BWXA 1YJ3A 5JI6A 2BHDA 2OKNA 5CIKA
chains in the Genus database with same CATH topology
2B3LA 4U75A 3PEBA 3PKDA 1A16A 4IU6A 3MR1A 4U69A 3OOOA 1PV9A 5JFRA 3IU9A 4U73A 1KQ0A 1WL9A 1WL6A 4IF7A 3MX6A 1CHMA 1WLRA 2BWWA 2GU5A 4IKTA 4FLLA 3MATA 2GG7A 1WBQA 3IG4A 1B6AA 2NQ7A 5CNXA 2GTXA 5JHUA 2V3XA 4MATA 5D6FA 1YW7A 5FCFA 5CLSA 2GA2A 4U6JA 2EVMA 2B3KA 3S6BA 2BWTA 5CDLA 3PN9A 1WKMA 4PV4A 4U70A 3CB6A 4U1BA 3OVKA 1QXWA 2GU4A 1O0XA 3BIPA 2OAZA 2BHCA 1BOAA 4PNCA 2BWYA 4RZYA 3TAVA 3CTZA 1W7VA 1C27A 1YW9A 5CDVA 2Q95A 1N51A 1C24A 3RORA 4S2RP 3IU7A 2GZ5A 4ZWPA 4S00A 1XGSA 4FLJA 2BH3A 1R58A 4U6WA 4IPAA 4A6WA 2ZSGA 1QXYA 2P98A 3PKCA 4U76A 2GG0A 2GG3A 2BWUA 2Q92A 4IECA 3BITA 3QOCA 1XGMA 2GG5A 4FUKA 3D27A 2GU6A 1YW8A 2P9AA 4B28A 1QXZA 1KQ9A 2BB7A 3O5VA 1BN5A 4Z7MA 3FM3A 1YVMA 4ZWOA 4U6CA 1C23A 2Q94A 5CE6A 4S01A 5E2CA 4U71A 2HOWA 2B3HA 4QR8A 3PKBA 4OOKA 1R5HA 4IKUA 5E5BA 2ADUA 3L7GA 3RVAA 4U6ZA 3L24A 3Q6DA 2MATA 3PKEA 1KP0A 4FKCA 3I7MA 4FLKA 4FO8A 3BIQA 3IL0A 5FCHA 5CDEA 4JUQA 5D6EA 3TB5A 4IKRA 1Y1NA 1C22A 1R5GA 1XGOA 4FO7A 4RZZA 1WN1A 4R60A 4FLIA 3PKAA 4HXXA 2BWVA 2P99A 2EA4A 4A6VA 2GG9A 2Q96A 2EVOA 1B59A 2NQ6A 4IKSA 2V3YA 2BN7A 2EVCA 2DFIA 2GU7A 1WY2A 2GG8A 1JAWA 1XGNA 4ZNGA 2V3ZA 4EGEA 2V6CA 1W2MA 2GGBA 2G6PA 2GG2A 4U6EA 1M35A 2Q8KA 2IW2A 1MATA 2Q93A 2EA2A 2BHAA 2BHBA 4ZWUA 1XNZA 2GGCA 2BWSA 1C21A 4IDYA 3FMRA 1QZYA 3FMQA 4KM3A 3IU8A 4S2TP 4RGZ1 3CB5A 2BWXA 1YJ3A 5JI6A 2BHDA 2OKNA 5CIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3L A;  4U75 A;  3PEB A;  3PKD A;  1A16 A;  4IU6 A;  3MR1 A;  4U69 A;  3OOO A;  1PV9 A;  5JFR A;  3IU9 A;  4U73 A;  1KQ0 A;  1WL9 A;  1WL6 A;  4IF7 A;  3MX6 A;  1CHM A;  1WLR A;  2BWW A;  2GU5 A;  4IKT A;  4FLL A;  3MAT A;  2GG7 A;  1WBQ A;  3IG4 A;  1B6A A;  2NQ7 A;  5CNX A;  2GTX A;  5JHU A;  2V3X A;  4MAT A;  5D6F A;  1YW7 A;  5FCF A;  5CLS A;  2GA2 A;  4U6J A;  2EVM A;  2B3K A;  3S6B A;  2BWT A;  5CDL A;  3PN9 A;  1WKM A;  4PV4 A;  4U70 A;  3CB6 A;  4U1B A;  3OVK A;  1QXW A;  2GU4 A;  1O0X A;  3BIP A;  2OAZ A;  2BHC A;  1BOA A;  4PNC A;  2BWY A;  4RZY A;  3TAV A;  3CTZ A;  1W7V A;  1C27 A;  1YW9 A;  5CDV A;  2Q95 A;  1N51 A;  1C24 A;  3ROR A;  4S2R P;  3IU7 A;  2GZ5 A;  4ZWP A;  4S00 A;  1XGS A;  4FLJ A;  2BH3 A;  1R58 A;  4U6W A;  4IPA A;  4A6W A;  2ZSG A;  1QXY A;  2P98 A;  3PKC A;  4U76 A;  2GG0 A;  2GG3 A;  2BWU A;  2Q92 A;  4IEC A;  3BIT A;  3QOC A;  1XGM A;  2GG5 A;  4FUK A;  3D27 A;  2GU6 A;  1YW8 A;  2P9A A;  4B28 A;  1QXZ A;  1KQ9 A;  2BB7 A;  3O5V A;  1BN5 A;  4Z7M A;  3FM3 A;  1YVM A;  4ZWO A;  4U6C A;  1C23 A;  2Q94 A;  5CE6 A;  4S01 A;  5E2C A;  4U71 A;  2HOW A;  2B3H A;  4QR8 A;  3PKB A;  4OOK A;  1R5H A;  4IKU A;  5E5B A;  2ADU A;  3L7G A;  3RVA A;  4U6Z A;  3L24 A;  3Q6D A;  2MAT A;  3PKE A;  1KP0 A;  4FKC A;  3I7M A;  4FLK A;  4FO8 A;  3BIQ A;  3IL0 A;  5FCH A;  5CDE A;  4JUQ A;  5D6E A;  3TB5 A;  4IKR A;  1Y1N A;  1C22 A;  1R5G A;  1XGO A;  4FO7 A;  4RZZ A;  1WN1 A;  4R60 A;  4FLI A;  3PKA A;  4HXX A;  2BWV A;  2P99 A;  2EA4 A;  4A6V A;  2GG9 A;  2Q96 A;  2EVO A;  1B59 A;  2NQ6 A;  4IKS A;  2V3Y A;  2BN7 A;  2EVC A;  2DFI A;  2GU7 A;  1WY2 A;  2GG8 A;  1JAW A;  1XGN A;  4ZNG A;  2V3Z A;  4EGE A;  2V6C A;  1W2M A;  2GGB A;  2G6P A;  2GG2 A;  4U6E A;  1M35 A;  2Q8K A;  2IW2 A;  1MAT A;  2Q93 A;  2EA2 A;  2BHA A;  2BHB A;  4ZWU A;  1XNZ A;  2GGC A;  2BWS A;  1C21 A;  4IDY A;  3FMR A;  1QZY A;  3FMQ A;  4KM3 A;  3IU8 A;  4S2T P;  4RGZ 1;  3CB5 A;  2BWX A;  1YJ3 A;  5JI6 A;  2BHD A;  2OKN A;  5CIK A; 
#chains in the Genus database with same CATH topology
 2B3L A;  4U75 A;  3PEB A;  3PKD A;  1A16 A;  4IU6 A;  3MR1 A;  4U69 A;  3OOO A;  1PV9 A;  5JFR A;  3IU9 A;  4U73 A;  1KQ0 A;  1WL9 A;  1WL6 A;  4IF7 A;  3MX6 A;  1CHM A;  1WLR A;  2BWW A;  2GU5 A;  4IKT A;  4FLL A;  3MAT A;  2GG7 A;  1WBQ A;  3IG4 A;  1B6A A;  2NQ7 A;  5CNX A;  2GTX A;  5JHU A;  2V3X A;  4MAT A;  5D6F A;  1YW7 A;  5FCF A;  5CLS A;  2GA2 A;  4U6J A;  2EVM A;  2B3K A;  3S6B A;  2BWT A;  5CDL A;  3PN9 A;  1WKM A;  4PV4 A;  4U70 A;  3CB6 A;  4U1B A;  3OVK A;  1QXW A;  2GU4 A;  1O0X A;  3BIP A;  2OAZ A;  2BHC A;  1BOA A;  4PNC A;  2BWY A;  4RZY A;  3TAV A;  3CTZ A;  1W7V A;  1C27 A;  1YW9 A;  5CDV A;  2Q95 A;  1N51 A;  1C24 A;  3ROR A;  4S2R P;  3IU7 A;  2GZ5 A;  4ZWP A;  4S00 A;  1XGS A;  4FLJ A;  2BH3 A;  1R58 A;  4U6W A;  4IPA A;  4A6W A;  2ZSG A;  1QXY A;  2P98 A;  3PKC A;  4U76 A;  2GG0 A;  2GG3 A;  2BWU A;  2Q92 A;  4IEC A;  3BIT A;  3QOC A;  1XGM A;  2GG5 A;  4FUK A;  3D27 A;  2GU6 A;  1YW8 A;  2P9A A;  4B28 A;  1QXZ A;  1KQ9 A;  2BB7 A;  3O5V A;  1BN5 A;  4Z7M A;  3FM3 A;  1YVM A;  4ZWO A;  4U6C A;  1C23 A;  2Q94 A;  5CE6 A;  4S01 A;  5E2C A;  4U71 A;  2HOW A;  2B3H A;  4QR8 A;  3PKB A;  4OOK A;  1R5H A;  4IKU A;  5E5B A;  2ADU A;  3L7G A;  3RVA A;  4U6Z A;  3L24 A;  3Q6D A;  2MAT A;  3PKE A;  1KP0 A;  4FKC A;  3I7M A;  4FLK A;  4FO8 A;  3BIQ A;  3IL0 A;  5FCH A;  5CDE A;  4JUQ A;  5D6E A;  3TB5 A;  4IKR A;  1Y1N A;  1C22 A;  1R5G A;  1XGO A;  4FO7 A;  4RZZ A;  1WN1 A;  4R60 A;  4FLI A;  3PKA A;  4HXX A;  2BWV A;  2P99 A;  2EA4 A;  4A6V A;  2GG9 A;  2Q96 A;  2EVO A;  1B59 A;  2NQ6 A;  4IKS A;  2V3Y A;  2BN7 A;  2EVC A;  2DFI A;  2GU7 A;  1WY2 A;  2GG8 A;  1JAW A;  1XGN A;  4ZNG A;  2V3Z A;  4EGE A;  2V6C A;  1W2M A;  2GGB A;  2G6P A;  2GG2 A;  4U6E A;  1M35 A;  2Q8K A;  2IW2 A;  1MAT A;  2Q93 A;  2EA2 A;  2BHA A;  2BHB A;  4ZWU A;  1XNZ A;  2GGC A;  2BWS A;  1C21 A;  4IDY A;  3FMR A;  1QZY A;  3FMQ A;  4KM3 A;  3IU8 A;  4S2T P;  4RGZ 1;  3CB5 A;  2BWX A;  1YJ3 A;  5JI6 A;  2BHD A;  2OKN A;  5CIK A; 
#chains in the Genus database with same CATH homology
 2B3L A;  4U75 A;  3PEB A;  3PKD A;  1A16 A;  4IU6 A;  3MR1 A;  4U69 A;  3OOO A;  1PV9 A;  5JFR A;  3IU9 A;  4U73 A;  1KQ0 A;  1WL9 A;  1WL6 A;  4IF7 A;  3MX6 A;  1CHM A;  1WLR A;  2BWW A;  2GU5 A;  4IKT A;  4FLL A;  3MAT A;  2GG7 A;  1WBQ A;  3IG4 A;  1B6A A;  2NQ7 A;  5CNX A;  2GTX A;  5JHU A;  2V3X A;  4MAT A;  5D6F A;  1YW7 A;  5FCF A;  5CLS A;  2GA2 A;  4U6J A;  2EVM A;  2B3K A;  3S6B A;  2BWT A;  5CDL A;  3PN9 A;  1WKM A;  4PV4 A;  4U70 A;  3CB6 A;  4U1B A;  3OVK A;  1QXW A;  2GU4 A;  1O0X A;  3BIP A;  2OAZ A;  2BHC A;  1BOA A;  4PNC A;  2BWY A;  4RZY A;  3TAV A;  3CTZ A;  1W7V A;  1C27 A;  1YW9 A;  5CDV A;  2Q95 A;  1N51 A;  1C24 A;  3ROR A;  4S2R P;  3IU7 A;  2GZ5 A;  4ZWP A;  4S00 A;  1XGS A;  4FLJ A;  2BH3 A;  1R58 A;  4U6W A;  4IPA A;  4A6W A;  2ZSG A;  1QXY A;  2P98 A;  3PKC A;  4U76 A;  2GG0 A;  2GG3 A;  2BWU A;  2Q92 A;  4IEC A;  3BIT A;  3QOC A;  1XGM A;  2GG5 A;  4FUK A;  3D27 A;  2GU6 A;  1YW8 A;  2P9A A;  4B28 A;  1QXZ A;  1KQ9 A;  2BB7 A;  3O5V A;  1BN5 A;  4Z7M A;  3FM3 A;  1YVM A;  4ZWO A;  4U6C A;  1C23 A;  2Q94 A;  5CE6 A;  4S01 A;  5E2C A;  4U71 A;  2HOW A;  2B3H A;  4QR8 A;  3PKB A;  4OOK A;  1R5H A;  4IKU A;  5E5B A;  2ADU A;  3L7G A;  3RVA A;  4U6Z A;  3L24 A;  3Q6D A;  2MAT A;  3PKE A;  1KP0 A;  4FKC A;  3I7M A;  4FLK A;  4FO8 A;  3BIQ A;  3IL0 A;  5FCH A;  5CDE A;  4JUQ A;  5D6E A;  3TB5 A;  4IKR A;  1Y1N A;  1C22 A;  1R5G A;  1XGO A;  4FO7 A;  4RZZ A;  1WN1 A;  4R60 A;  4FLI A;  3PKA A;  4HXX A;  2BWV A;  2P99 A;  2EA4 A;  4A6V A;  2GG9 A;  2Q96 A;  2EVO A;  1B59 A;  2NQ6 A;  4IKS A;  2V3Y A;  2BN7 A;  2EVC A;  2DFI A;  2GU7 A;  1WY2 A;  2GG8 A;  1JAW A;  1XGN A;  4ZNG A;  2V3Z A;  4EGE A;  2V6C A;  1W2M A;  2GGB A;  2G6P A;  2GG2 A;  4U6E A;  1M35 A;  2Q8K A;  2IW2 A;  1MAT A;  2Q93 A;  2EA2 A;  2BHA A;  2BHB A;  4ZWU A;  1XNZ A;  2GGC A;  2BWS A;  1C21 A;  4IDY A;  3FMR A;  1QZY A;  3FMQ A;  4KM3 A;  3IU8 A;  4S2T P;  4RGZ 1;  3CB5 A;  2BWX A;  1YJ3 A;  5JI6 A;  2BHD A;  2OKN A;  5CIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...