5CDVA

Proline dipeptidase from deinococcus radiodurans r1
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
349
Chain Sequence
SSKMDQLRPVLGRAGVDALWVSAPANVRWLSGFTSAEDGKVLVSPDGATLYTDARYTVQAQEESSLPQYIARPPATYEHAADTVRGLRVGFEAESLTVAELEDLRQAWPNSTLVALRGTLGGLRAVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRAGGESAFELIVASGPNGAKPHGHASKRVIEDGDLVTIDMGARLGGYNSDMTRTVAVGTPSAEMKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGEAFAHSLGHGVGLEVHEGPGLRGTSQDVLEAGMVITIEPGAYLPGVGGVRIEDLILVTEDGYEVLSHSAKESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proline dipeptidase from Deinococcus radiodurans R1 at 1.45 Angstrom resolution
rcsb
source organism Deinococcus radiodurans (strain atcc 13939 / dsm 20539 / jcm 16871 / lmg 4051 /
molecule tags Hydrolase
molecule keywords Proline dipeptidase
total genus 110
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2015-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5cdvA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 5cdvA02
1MATA 4RZYA 2BWVA 4PV4A 5CDVA 4IDYA 2DFIA 4RZZA 2EA2A 2GU5A 1YW7A 2Q95A 2BWSA 2EVMA 4IKRA 2BWUA 4PNCA 1O0XA 1JAWA 3FMRA 2MATA 5FCHA 1YW8A 4FLLA 5CDEA 2Q96A 4FUKA 2GU6A 2EVCA 3MR1A 1R5GA 4ZNGA 3BIQA 1Y1NA 2BHAA 2IW2A 3L7GA 4IECA 4IPAA 4KM3A 4R60A 2GG8A 2HOWA 1B6AA 1CHMA 2GU4A 5CNXA 4FKCA 2GG2A 5CIKA 4S2TP 3IU9A 1WLRA 3QOCA 2BH3A 3PEBA 4B28A 2GGBA 2GU7A 4IKUA 4A6VA 1B59A 5JHUA 2BHDA 3CB6A 4U75A 2GGCA 2GG0A 3TAVA 2BWWA 4RGZ1 3S6BA 3I7MA 3MX6A 4U69A 2B3LA 1QXZA 1WY2A 1R5HA 3D27A 4S01A 1C21A 3FMQA 4IKTA 4FLJA 2GG7A 4OOKA 3L24A 4IKSA 1PV9A 3PN9A 4S00A 4EGEA 3BITA 3CB5A 3MATA 2V3ZA 4U71A 1WBQA 2BN7A 5CLSA 2OAZA 2P98A 1XGSA 2P99A 4U70A 2P9AA 1QZYA 1C27A 3PKDA 2Q94A 3CTZA 2BWYA 4FO7A 2NQ7A 1BN5A 2BWXA 1N51A 3OOOA 4IU6A 1WN1A 4Z7MA 1C24A 5JFRA 4HXXA 4U76A 1W2MA 3IG4A 1W7VA 4QR8A 2GA2A 3FM3A 3IU7A 1YVMA 3IL0A 1M35A 5D6EA 2GG3A 3O5VA 1XGNA 1YW9A 1KP0A 4U6WA 2Q8KA 2B3HA 2V3YA 3BIPA 1WKMA 1XGMA 3Q6DA 1YJ3A 4FLKA 4MATA 1QXYA 3PKAA 1KQ9A 2B3KA 2G6PA 4IF7A 2GZ5A 3OVKA 1QXWA 2OKNA 5FCFA 5CE6A 5CDLA 4ZWPA 5JI6A 3PKEA 2GG5A 4JUQA 4ZWUA 1C23A 4U6JA 4U6EA 1XGOA 2BHBA 2Q93A 5E5BA 4FLIA 1C22A 2V6CA 1WL9A 3PKBA 5D6FA 4U73A 3TB5A 2Q92A 2NQ6A 4FO8A 1WL6A 3RVAA 1A16A 2BWTA 4U6ZA 2V3XA 4ZWOA 2EA4A 2GTXA 5E2CA 2EVOA 4U1BA 1BOAA 4S2RP 4U6CA 1R58A 3IU8A 3PKCA 2BB7A 3RORA 1XNZA 2BHCA 2ADUA 4A6WA 1KQ0A 2ZSGA 2GG9A
chains in the Genus database with same CATH superfamily
1MATA 4RZYA 2BWVA 4PV4A 5CDVA 4IDYA 2DFIA 4RZZA 2EA2A 2GU5A 1YW7A 2Q95A 2BWSA 2EVMA 4IKRA 2BWUA 4PNCA 1O0XA 1JAWA 3FMRA 2MATA 5FCHA 1YW8A 4FLLA 5CDEA 2Q96A 4FUKA 2GU6A 2EVCA 3MR1A 1R5GA 4ZNGA 3BIQA 1Y1NA 2BHAA 2IW2A 3L7GA 4IECA 4IPAA 4KM3A 4R60A 2GG8A 2HOWA 1B6AA 1CHMA 2GU4A 5CNXA 4FKCA 2GG2A 5CIKA 4S2TP 3IU9A 1WLRA 3QOCA 2BH3A 3PEBA 4B28A 2GGBA 2GU7A 4IKUA 4A6VA 1B59A 5JHUA 2BHDA 3CB6A 4U75A 2GGCA 2GG0A 3TAVA 2BWWA 4RGZ1 3S6BA 3I7MA 3MX6A 4U69A 2B3LA 1QXZA 1WY2A 1R5HA 3D27A 4S01A 1C21A 3FMQA 4IKTA 4FLJA 2GG7A 4OOKA 3L24A 4IKSA 1PV9A 3PN9A 4S00A 4EGEA 3BITA 3CB5A 3MATA 2V3ZA 4U71A 1WBQA 2BN7A 5CLSA 2OAZA 2P98A 1XGSA 2P99A 4U70A 2P9AA 1QZYA 1C27A 3PKDA 2Q94A 3CTZA 2BWYA 4FO7A 2NQ7A 1BN5A 2BWXA 1N51A 3OOOA 4IU6A 1WN1A 4Z7MA 1C24A 5JFRA 4HXXA 4U76A 1W2MA 3IG4A 1W7VA 4QR8A 2GA2A 3FM3A 3IU7A 1YVMA 3IL0A 1M35A 5D6EA 2GG3A 3O5VA 1XGNA 1YW9A 1KP0A 4U6WA 2Q8KA 2B3HA 2V3YA 3BIPA 1WKMA 1XGMA 3Q6DA 1YJ3A 4FLKA 4MATA 1QXYA 3PKAA 1KQ9A 2B3KA 2G6PA 4IF7A 2GZ5A 3OVKA 1QXWA 2OKNA 5FCFA 5CE6A 5CDLA 4ZWPA 5JI6A 3PKEA 2GG5A 4JUQA 4ZWUA 1C23A 4U6JA 4U6EA 1XGOA 2BHBA 2Q93A 5E5BA 4FLIA 1C22A 2V6CA 1WL9A 3PKBA 5D6FA 4U73A 3TB5A 2Q92A 2NQ6A 4FO8A 1WL6A 3RVAA 1A16A 2BWTA 4U6ZA 2V3XA 4ZWOA 2EA4A 2GTXA 5E2CA 2EVOA 4U1BA 1BOAA 4S2RP 4U6CA 1R58A 3IU8A 3PKCA 2BB7A 3RORA 1XNZA 2BHCA 2ADUA 4A6WA 1KQ0A 2ZSGA 2GG9A
chains in the Genus database with same CATH topology
1MATA 4RZYA 2BWVA 4PV4A 5CDVA 4IDYA 2DFIA 4RZZA 2EA2A 2GU5A 1YW7A 2Q95A 2BWSA 2EVMA 4IKRA 2BWUA 4PNCA 1O0XA 1JAWA 3FMRA 2MATA 5FCHA 1YW8A 4FLLA 5CDEA 2Q96A 4FUKA 2GU6A 2EVCA 3MR1A 1R5GA 4ZNGA 3BIQA 1Y1NA 2BHAA 2IW2A 3L7GA 4IECA 4IPAA 4KM3A 4R60A 2GG8A 2HOWA 1B6AA 1CHMA 2GU4A 5CNXA 4FKCA 2GG2A 5CIKA 4S2TP 3IU9A 1WLRA 3QOCA 2BH3A 3PEBA 4B28A 2GGBA 2GU7A 4IKUA 4A6VA 1B59A 5JHUA 2BHDA 3CB6A 4U75A 2GGCA 2GG0A 3TAVA 2BWWA 4RGZ1 3S6BA 3I7MA 3MX6A 4U69A 2B3LA 1QXZA 1WY2A 1R5HA 3D27A 4S01A 1C21A 3FMQA 4IKTA 4FLJA 2GG7A 4OOKA 3L24A 4IKSA 1PV9A 3PN9A 4S00A 4EGEA 3BITA 3CB5A 3MATA 2V3ZA 4U71A 1WBQA 2BN7A 5CLSA 2OAZA 2P98A 1XGSA 2P99A 4U70A 2P9AA 1QZYA 1C27A 3PKDA 2Q94A 3CTZA 2BWYA 4FO7A 2NQ7A 1BN5A 2BWXA 1N51A 3OOOA 4IU6A 1WN1A 4Z7MA 1C24A 5JFRA 4HXXA 4U76A 1W2MA 3IG4A 1W7VA 4QR8A 2GA2A 3FM3A 3IU7A 1YVMA 3IL0A 1M35A 5D6EA 2GG3A 3O5VA 1XGNA 1YW9A 1KP0A 4U6WA 2Q8KA 2B3HA 2V3YA 3BIPA 1WKMA 1XGMA 3Q6DA 1YJ3A 4FLKA 4MATA 1QXYA 3PKAA 1KQ9A 2B3KA 2G6PA 4IF7A 2GZ5A 3OVKA 1QXWA 2OKNA 5FCFA 5CE6A 5CDLA 4ZWPA 5JI6A 3PKEA 2GG5A 4JUQA 4ZWUA 1C23A 4U6JA 4U6EA 1XGOA 2BHBA 2Q93A 5E5BA 4FLIA 1C22A 2V6CA 1WL9A 3PKBA 5D6FA 4U73A 3TB5A 2Q92A 2NQ6A 4FO8A 1WL6A 3RVAA 1A16A 2BWTA 4U6ZA 2V3XA 4ZWOA 2EA4A 2GTXA 5E2CA 2EVOA 4U1BA 1BOAA 4S2RP 4U6CA 1R58A 3IU8A 3PKCA 2BB7A 3RORA 1XNZA 2BHCA 2ADUA 4A6WA 1KQ0A 2ZSGA 2GG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAT A;  4RZY A;  2BWV A;  4PV4 A;  5CDV A;  4IDY A;  2DFI A;  4RZZ A;  2EA2 A;  2GU5 A;  1YW7 A;  2Q95 A;  2BWS A;  2EVM A;  4IKR A;  2BWU A;  4PNC A;  1O0X A;  1JAW A;  3FMR A;  2MAT A;  5FCH A;  1YW8 A;  4FLL A;  5CDE A;  2Q96 A;  4FUK A;  2GU6 A;  2EVC A;  3MR1 A;  1R5G A;  4ZNG A;  3BIQ A;  1Y1N A;  2BHA A;  2IW2 A;  3L7G A;  4IEC A;  4IPA A;  4KM3 A;  4R60 A;  2GG8 A;  2HOW A;  1B6A A;  1CHM A;  2GU4 A;  5CNX A;  4FKC A;  2GG2 A;  5CIK A;  4S2T P;  3IU9 A;  1WLR A;  3QOC A;  2BH3 A;  3PEB A;  4B28 A;  2GGB A;  2GU7 A;  4IKU A;  4A6V A;  1B59 A;  5JHU A;  2BHD A;  3CB6 A;  4U75 A;  2GGC A;  2GG0 A;  3TAV A;  2BWW A;  4RGZ 1;  3S6B A;  3I7M A;  3MX6 A;  4U69 A;  2B3L A;  1QXZ A;  1WY2 A;  1R5H A;  3D27 A;  4S01 A;  1C21 A;  3FMQ A;  4IKT A;  4FLJ A;  2GG7 A;  4OOK A;  3L24 A;  4IKS A;  1PV9 A;  3PN9 A;  4S00 A;  4EGE A;  3BIT A;  3CB5 A;  3MAT A;  2V3Z A;  4U71 A;  1WBQ A;  2BN7 A;  5CLS A;  2OAZ A;  2P98 A;  1XGS A;  2P99 A;  4U70 A;  2P9A A;  1QZY A;  1C27 A;  3PKD A;  2Q94 A;  3CTZ A;  2BWY A;  4FO7 A;  2NQ7 A;  1BN5 A;  2BWX A;  1N51 A;  3OOO A;  4IU6 A;  1WN1 A;  4Z7M A;  1C24 A;  5JFR A;  4HXX A;  4U76 A;  1W2M A;  3IG4 A;  1W7V A;  4QR8 A;  2GA2 A;  3FM3 A;  3IU7 A;  1YVM A;  3IL0 A;  1M35 A;  5D6E A;  2GG3 A;  3O5V A;  1XGN A;  1YW9 A;  1KP0 A;  4U6W A;  2Q8K A;  2B3H A;  2V3Y A;  3BIP A;  1WKM A;  1XGM A;  3Q6D A;  1YJ3 A;  4FLK A;  4MAT A;  1QXY A;  3PKA A;  1KQ9 A;  2B3K A;  2G6P A;  4IF7 A;  2GZ5 A;  3OVK A;  1QXW A;  2OKN A;  5FCF A;  5CE6 A;  5CDL A;  4ZWP A;  5JI6 A;  3PKE A;  2GG5 A;  4JUQ A;  4ZWU A;  1C23 A;  4U6J A;  4U6E A;  1XGO A;  2BHB A;  2Q93 A;  5E5B A;  4FLI A;  1C22 A;  2V6C A;  1WL9 A;  3PKB A;  5D6F A;  4U73 A;  3TB5 A;  2Q92 A;  2NQ6 A;  4FO8 A;  1WL6 A;  3RVA A;  1A16 A;  2BWT A;  4U6Z A;  2V3X A;  4ZWO A;  2EA4 A;  2GTX A;  5E2C A;  2EVO A;  4U1B A;  1BOA A;  4S2R P;  4U6C A;  1R58 A;  3IU8 A;  3PKC A;  2BB7 A;  3ROR A;  1XNZ A;  2BHC A;  2ADU A;  4A6W A;  1KQ0 A;  2ZSG A;  2GG9 A; 
#chains in the Genus database with same CATH topology
 1MAT A;  4RZY A;  2BWV A;  4PV4 A;  5CDV A;  4IDY A;  2DFI A;  4RZZ A;  2EA2 A;  2GU5 A;  1YW7 A;  2Q95 A;  2BWS A;  2EVM A;  4IKR A;  2BWU A;  4PNC A;  1O0X A;  1JAW A;  3FMR A;  2MAT A;  5FCH A;  1YW8 A;  4FLL A;  5CDE A;  2Q96 A;  4FUK A;  2GU6 A;  2EVC A;  3MR1 A;  1R5G A;  4ZNG A;  3BIQ A;  1Y1N A;  2BHA A;  2IW2 A;  3L7G A;  4IEC A;  4IPA A;  4KM3 A;  4R60 A;  2GG8 A;  2HOW A;  1B6A A;  1CHM A;  2GU4 A;  5CNX A;  4FKC A;  2GG2 A;  5CIK A;  4S2T P;  3IU9 A;  1WLR A;  3QOC A;  2BH3 A;  3PEB A;  4B28 A;  2GGB A;  2GU7 A;  4IKU A;  4A6V A;  1B59 A;  5JHU A;  2BHD A;  3CB6 A;  4U75 A;  2GGC A;  2GG0 A;  3TAV A;  2BWW A;  4RGZ 1;  3S6B A;  3I7M A;  3MX6 A;  4U69 A;  2B3L A;  1QXZ A;  1WY2 A;  1R5H A;  3D27 A;  4S01 A;  1C21 A;  3FMQ A;  4IKT A;  4FLJ A;  2GG7 A;  4OOK A;  3L24 A;  4IKS A;  1PV9 A;  3PN9 A;  4S00 A;  4EGE A;  3BIT A;  3CB5 A;  3MAT A;  2V3Z A;  4U71 A;  1WBQ A;  2BN7 A;  5CLS A;  2OAZ A;  2P98 A;  1XGS A;  2P99 A;  4U70 A;  2P9A A;  1QZY A;  1C27 A;  3PKD A;  2Q94 A;  3CTZ A;  2BWY A;  4FO7 A;  2NQ7 A;  1BN5 A;  2BWX A;  1N51 A;  3OOO A;  4IU6 A;  1WN1 A;  4Z7M A;  1C24 A;  5JFR A;  4HXX A;  4U76 A;  1W2M A;  3IG4 A;  1W7V A;  4QR8 A;  2GA2 A;  3FM3 A;  3IU7 A;  1YVM A;  3IL0 A;  1M35 A;  5D6E A;  2GG3 A;  3O5V A;  1XGN A;  1YW9 A;  1KP0 A;  4U6W A;  2Q8K A;  2B3H A;  2V3Y A;  3BIP A;  1WKM A;  1XGM A;  3Q6D A;  1YJ3 A;  4FLK A;  4MAT A;  1QXY A;  3PKA A;  1KQ9 A;  2B3K A;  2G6P A;  4IF7 A;  2GZ5 A;  3OVK A;  1QXW A;  2OKN A;  5FCF A;  5CE6 A;  5CDL A;  4ZWP A;  5JI6 A;  3PKE A;  2GG5 A;  4JUQ A;  4ZWU A;  1C23 A;  4U6J A;  4U6E A;  1XGO A;  2BHB A;  2Q93 A;  5E5B A;  4FLI A;  1C22 A;  2V6C A;  1WL9 A;  3PKB A;  5D6F A;  4U73 A;  3TB5 A;  2Q92 A;  2NQ6 A;  4FO8 A;  1WL6 A;  3RVA A;  1A16 A;  2BWT A;  4U6Z A;  2V3X A;  4ZWO A;  2EA4 A;  2GTX A;  5E2C A;  2EVO A;  4U1B A;  1BOA A;  4S2R P;  4U6C A;  1R58 A;  3IU8 A;  3PKC A;  2BB7 A;  3ROR A;  1XNZ A;  2BHC A;  2ADU A;  4A6W A;  1KQ0 A;  2ZSG A;  2GG9 A; 
#chains in the Genus database with same CATH homology
 1MAT A;  4RZY A;  2BWV A;  4PV4 A;  5CDV A;  4IDY A;  2DFI A;  4RZZ A;  2EA2 A;  2GU5 A;  1YW7 A;  2Q95 A;  2BWS A;  2EVM A;  4IKR A;  2BWU A;  4PNC A;  1O0X A;  1JAW A;  3FMR A;  2MAT A;  5FCH A;  1YW8 A;  4FLL A;  5CDE A;  2Q96 A;  4FUK A;  2GU6 A;  2EVC A;  3MR1 A;  1R5G A;  4ZNG A;  3BIQ A;  1Y1N A;  2BHA A;  2IW2 A;  3L7G A;  4IEC A;  4IPA A;  4KM3 A;  4R60 A;  2GG8 A;  2HOW A;  1B6A A;  1CHM A;  2GU4 A;  5CNX A;  4FKC A;  2GG2 A;  5CIK A;  4S2T P;  3IU9 A;  1WLR A;  3QOC A;  2BH3 A;  3PEB A;  4B28 A;  2GGB A;  2GU7 A;  4IKU A;  4A6V A;  1B59 A;  5JHU A;  2BHD A;  3CB6 A;  4U75 A;  2GGC A;  2GG0 A;  3TAV A;  2BWW A;  4RGZ 1;  3S6B A;  3I7M A;  3MX6 A;  4U69 A;  2B3L A;  1QXZ A;  1WY2 A;  1R5H A;  3D27 A;  4S01 A;  1C21 A;  3FMQ A;  4IKT A;  4FLJ A;  2GG7 A;  4OOK A;  3L24 A;  4IKS A;  1PV9 A;  3PN9 A;  4S00 A;  4EGE A;  3BIT A;  3CB5 A;  3MAT A;  2V3Z A;  4U71 A;  1WBQ A;  2BN7 A;  5CLS A;  2OAZ A;  2P98 A;  1XGS A;  2P99 A;  4U70 A;  2P9A A;  1QZY A;  1C27 A;  3PKD A;  2Q94 A;  3CTZ A;  2BWY A;  4FO7 A;  2NQ7 A;  1BN5 A;  2BWX A;  1N51 A;  3OOO A;  4IU6 A;  1WN1 A;  4Z7M A;  1C24 A;  5JFR A;  4HXX A;  4U76 A;  1W2M A;  3IG4 A;  1W7V A;  4QR8 A;  2GA2 A;  3FM3 A;  3IU7 A;  1YVM A;  3IL0 A;  1M35 A;  5D6E A;  2GG3 A;  3O5V A;  1XGN A;  1YW9 A;  1KP0 A;  4U6W A;  2Q8K A;  2B3H A;  2V3Y A;  3BIP A;  1WKM A;  1XGM A;  3Q6D A;  1YJ3 A;  4FLK A;  4MAT A;  1QXY A;  3PKA A;  1KQ9 A;  2B3K A;  2G6P A;  4IF7 A;  2GZ5 A;  3OVK A;  1QXW A;  2OKN A;  5FCF A;  5CE6 A;  5CDL A;  4ZWP A;  5JI6 A;  3PKE A;  2GG5 A;  4JUQ A;  4ZWU A;  1C23 A;  4U6J A;  4U6E A;  1XGO A;  2BHB A;  2Q93 A;  5E5B A;  4FLI A;  1C22 A;  2V6C A;  1WL9 A;  3PKB A;  5D6F A;  4U73 A;  3TB5 A;  2Q92 A;  2NQ6 A;  4FO8 A;  1WL6 A;  3RVA A;  1A16 A;  2BWT A;  4U6Z A;  2V3X A;  4ZWO A;  2EA4 A;  2GTX A;  5E2C A;  2EVO A;  4U1B A;  1BOA A;  4S2R P;  4U6C A;  1R58 A;  3IU8 A;  3PKC A;  2BB7 A;  3ROR A;  1XNZ A;  2BHC A;  2ADU A;  4A6W A;  1KQ0 A;  2ZSG A;  2GG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...