1DGPA

Aristolochene synthase farnesol complex
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
300
structure length
290
Chain Sequence
TPPPTQWSYLCHPRVKEVQDEVDGYFLENWKFPSFKAVRTFLDAKFSEVTCLYFPLALDDRIHFACRLLTVLFLIDDVLEHMSFADGEAYNNRLIPISRGDVLPDRTKPEEFILYDLWESMRAHDAELANEVLEPTFVFMRAQTDRARLSIHELGHYLEYREKDVGKALLSALMRFSMGLRLSADELQDMKALEANCAKQLSVVNDIYSYDKEEEALCSAVKVLAEESKLGIPATKRVLWSMTREWETVHDEIVAEKIASPDGCSEAAKAYMKGLEYQMSGNEQWSKTTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords ARISTOLOCHENE SYNTHASE
publication title Crystal structure determination of aristolochene synthase from the blue cheese mold, Penicillium roqueforti.
pubmed doi rcsb
source organism Penicillium roqueforti
total genus 118
structure length 290
sequence length 300
chains with identical sequence B
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 1999-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 1dgpA00
2OPMA 4NG6A 3TFPA 5HN9A 5DGMF 3N45F 3DYGA 4RXDA 3WSAA 3N1WF 2Q80A 4LLTA 4MC8A 3Q30A 1WY0A 5IMNA 4HD1A 3M02A 4KUXA 3TS7A 3ZCDA 2OA6A 3ICKA 3ACYA 1EZFA 4LA6A 2H8OA 4FP4A 4KVIA 4KPDA 5EASA 3RYEA 4JYXA 4PVYF 3M01A 3PKOA 5IKAA 5IM1A 4DWBA 1N1BA 2Z50A 3LDWA 3WE9A 3ACXA 3LGKA 4XQTF 3P41A 5IKHA 1WL3A 5IK9A 1N22A 5EROA 2Q9YA 3WEGA 4JXYA 1UBVA 3ACWA 3LOMA 3TFNA 3VJCA 3WCHA 2E8XA 4H5EF 5B02A 5IK6A 2QISA 2E8WA 2E92A 5ERNA 1JFGA 1WMWA 3APZA 3WCBA 1V4JA 3WEKA 4ZQ8A 4KVWA 3SDVA 2AELA 3MZVA 4RXCA 4L2XF 5ILYA 1WL1A 2ONGA 2Z4YA 2J1PA 2AEKA 3DYFA 2FTZA 3OYRA 4QPFA 4MC0A 5DW7A 1RQJA 3M00A 3ICNA 4LZ3A 5B0LA 5DJRF 5ILJA 5B0MA 3UCAA 5A0JA 2PS5A 3OABB 3WCJA 1V4IA 1N1ZA 3WCAA 4LTVA 4F6XA 5ER8A 1YV5A 3ZMCA 4KWDA 5DGSF 2ZCRA 3WCDA 1N20A 1VG6A 1HM7A 5B0JA 3G4FA 2ZY1A 5EAUA 2AETA 1RTRA 4DZWA 1PS1A 4E1EA 4DEMF 4GAXA 1DI1A 4EA0A 3KRAA 4GP2A 1WL0A 5JV0F 1WKZA 3WEJA 2Z4WA 5A0IA 3ASXA 3CKEA 3AQBB 3SAEA 2Z7HA 1ZW5A 4LZCA 3RYWA 5B0IA 3N0GA 2PS7A 3LVSA 3P5PA 1HX9A 3IPIA 3BNXA 3VJBA 4F62A 2E4OA 2ZCQA 4KQUA 3PDEA 4XQSF 1VG2A 3N1VF 4NFKF 3WCCA 4H5CF 5JA0F 2F89F 1VG7A 5B03A 5HNAA 5AELA 2ZEUA 3OABA 3P8RA 3OACB 1RQIA 3CP6A 5AFXA 2EWGA 3LK5A 3Q2QA 3MAVA 3LSNA 4LOBA 3P8LA 5IL3A 4DXJA 1V4EA 4RYPA 3WEHA 4RXEA 3LG5A 2ONHA 5ILHA 1N21A 5B00A 3VJ9A 1YYTA 5IL8A 3KRAB 4N1ZF 4OMGA 5DJPF 4DHDA 5H9DA 2PS6A 4Q23A 3NPRA 5JV2F 1UBXA 3WCIA 5HN8A 1YHMA 4LTZA 4KFAA 3PYAA 4QXSF 1VG3A 5DGNF 3V1XA 3ZMBA 4WK5A 4E9ZA 1FPSA 2F8CF 3WCGA 3S4JA 2J1OA 4LIXA 2PS4A 4P0WA 2Z52A 4RNQA 4NFIF 5E8HA 2E94A 2Z4ZA 3P5RA 3OACA 2E91A 4LFEA 3SDUA 3ZL6A 2F92F 4LPHF 2AZJA 4DWGA 3S9VA 3N6KF 5KSXF 2E8UA 4GP1A 3LEEA 3VJ8A 4LLSA 3PYBA 3LLWA 5ILDA 3KROA 3LZ9A 3M0GA 5ERMA 2VF6A 2Z4VA 4KKMA 4LPGF 4NFJF 3WCFA 1HXGA 3WCLA 4H5DF 4LA5A 5IMPA 3PH7A 1V4HA 3V66A 4KQ5A 1KIZA 3WEIA 2E8VA 4UMJA 5DJVF 5CG5A 4JXNA 3VJDA 3EGTA 2RAHA 4LFVF 4E9UA 3AE0A 4KPJA 1VG4A 4LXWA 2OGDA 4K10A 4KVYA 3WCEA 4F6VA 3WC9A 2AZLA 1YHKA 4LZ0A 3W7FA 3EZ3A 3N5HF 5AYPA 2F8ZF 4MC3A 5ILKA 3WCMA 1HM4A 4LUUA 4JZXA 3KRPA 5B0KA 4EA1A 3Q1OA 3VJEA 3N3LF 3NRIA 4XQRF 3IBAA 4PVXF 3KB9A 4LFGA 3ID0A 3SDTA 3G4DA 1UBWA 3B7LA 5ILZA 3N0FA 2Z4XA 2O1OA 4DI5A 3KROB 1JFAA 5IN8A 3NF2A 1YJ4A 2E90A 5JUZF 3Q2ZA 4N9UA 5DHKA 2ZCSA 5IVGA 1HXCA 2ZEVA 3WSBA 5C05A 3N5JF 2F9KF 3DYHA 3NPKA 1UBYA 2ZCOA 4OKZA 3RBMA 2Q58A 3KRFA 3WEFA 4GA3A 3KRCA 1YQ7A 3TC1A 4RXAA 1V4KA 1WL2A 5ILIA 4OMHA 5HN7A 2E8TA 5DIQF 4P0VA 5E8LA 3RMGA 1YYQA 3ADZA 4EA2A 2OPNA 3KRPB 3SDQA 2AZKA 4OGUA 3LJIA 3QQVA 3N49F 5IK0A 1DGPA 2I19A 3ZOUA 4KQSA 3N3DA 3LMDA 4KK2A 3TFVA 4NKEA 5IMIA 5B01A 4NUAA 3KBKA 3AQCB 2J5CA 2PS8A 2Z7IA 2P1CA 3WJOA 3M9UA 2DH4A 3WJNA 2FORA 3SDRA 2F7MF 1YYUA 3WJKA 1N24A 5A0KA 1YHLA 2Z78A 5EATA 4P0XA 1KIYA 3CC9A 3KRFB 2E93A 3VJAA 2Q9ZA 3KRCB 3LGZB 4OKMA 5DZ2A 5AHUB 3V1VA 4JVJF 4NKFA 5E8KA 3EFQA 2E95A 1HXAA 5CG6A 4JZBA 4FJQA 1YYRA 5JV1F 1N23A 1YYSA 3ICZA 3ICMA 5I1UA 3QKCA 3AQ0A 3N46F 4KVDA 3BNYA 2F94F 5DHIA
chains in the Genus database with same CATH superfamily
2OPMA 4NG6A 3TFPA 5HN9A 5DGMF 3N45F 3DYGA 4RXDA 3WSAA 3N1WF 2Q80A 4LLTA 4MC8A 3Q30A 1WY0A 5IMNA 4HD1A 3M02A 4KUXA 3TS7A 3ZCDA 2OA6A 3ICKA 3ACYA 1EZFA 4LA6A 2H8OA 4FP4A 4KVIA 4KPDA 5EASA 3RYEA 4JYXA 4PVYF 3M01A 3PKOA 5IKAA 5IM1A 4DWBA 1N1BA 2Z50A 3LDWA 3WE9A 3ACXA 3LGKA 4XQTF 3P41A 5IKHA 1WL3A 5IK9A 1N22A 5EROA 2Q9YA 3WEGA 4JXYA 1UBVA 3ACWA 3LOMA 3TFNA 3VJCA 3WCHA 2E8XA 4H5EF 5B02A 5IK6A 2QISA 2E8WA 2E92A 5ERNA 1JFGA 1WMWA 3APZA 3WCBA 1V4JA 3WEKA 4ZQ8A 4KVWA 3SDVA 2AELA 3MZVA 4RXCA 4L2XF 5ILYA 1WL1A 2ONGA 2Z4YA 2J1PA 2AEKA 3DYFA 2FTZA 3OYRA 4QPFA 4MC0A 5DW7A 1RQJA 3M00A 3ICNA 4LZ3A 5B0LA 5DJRF 5ILJA 5B0MA 3UCAA 5A0JA 2PS5A 3OABB 3WCJA 1V4IA 1N1ZA 3WCAA 4LTVA 4F6XA 5ER8A 1YV5A 3ZMCA 4KWDA 5DGSF 2ZCRA 3WCDA 1N20A 1VG6A 1HM7A 5B0JA 3G4FA 2ZY1A 5EAUA 2AETA 1RTRA 4DZWA 1PS1A 4E1EA 4DEMF 4GAXA 1DI1A 4EA0A 3KRAA 4GP2A 1WL0A 5JV0F 1WKZA 3WEJA 2Z4WA 5A0IA 3ASXA 3CKEA 3AQBB 3SAEA 2Z7HA 1ZW5A 4LZCA 3RYWA 5B0IA 3N0GA 2PS7A 3LVSA 3P5PA 1HX9A 3IPIA 3BNXA 3VJBA 4F62A 2E4OA 2ZCQA 4KQUA 3PDEA 4XQSF 1VG2A 3N1VF 4NFKF 3WCCA 4H5CF 5JA0F 2F89F 1VG7A 5B03A 5HNAA 5AELA 2ZEUA 3OABA 3P8RA 3OACB 1RQIA 3CP6A 5AFXA 2EWGA 3LK5A 3Q2QA 3MAVA 3LSNA 4LOBA 3P8LA 5IL3A 4DXJA 1V4EA 4RYPA 3WEHA 4RXEA 3LG5A 2ONHA 5ILHA 1N21A 5B00A 3VJ9A 1YYTA 5IL8A 3KRAB 4N1ZF 4OMGA 5DJPF 4DHDA 5H9DA 2PS6A 4Q23A 3NPRA 5JV2F 1UBXA 3WCIA 5HN8A 1YHMA 4LTZA 4KFAA 3PYAA 4QXSF 1VG3A 5DGNF 3V1XA 3ZMBA 4WK5A 4E9ZA 1FPSA 2F8CF 3WCGA 3S4JA 2J1OA 4LIXA 2PS4A 4P0WA 2Z52A 4RNQA 4NFIF 5E8HA 2E94A 2Z4ZA 3P5RA 3OACA 2E91A 4LFEA 3SDUA 3ZL6A 2F92F 4LPHF 2AZJA 4DWGA 3S9VA 3N6KF 5KSXF 2E8UA 4GP1A 3LEEA 3VJ8A 4LLSA 3PYBA 3LLWA 5ILDA 3KROA 3LZ9A 3M0GA 5ERMA 2VF6A 2Z4VA 4KKMA 4LPGF 4NFJF 3WCFA 1HXGA 3WCLA 4H5DF 4LA5A 5IMPA 3PH7A 1V4HA 3V66A 4KQ5A 1KIZA 3WEIA 2E8VA 4UMJA 5DJVF 5CG5A 4JXNA 3VJDA 3EGTA 2RAHA 4LFVF 4E9UA 3AE0A 4KPJA 1VG4A 4LXWA 2OGDA 4K10A 4KVYA 3WCEA 4F6VA 3WC9A 2AZLA 1YHKA 4LZ0A 3W7FA 3EZ3A 3N5HF 5AYPA 2F8ZF 4MC3A 5ILKA 3WCMA 1HM4A 4LUUA 4JZXA 3KRPA 5B0KA 4EA1A 3Q1OA 3VJEA 3N3LF 3NRIA 4XQRF 3IBAA 4PVXF 3KB9A 4LFGA 3ID0A 3SDTA 3G4DA 1UBWA 3B7LA 5ILZA 3N0FA 2Z4XA 2O1OA 4DI5A 3KROB 1JFAA 5IN8A 3NF2A 1YJ4A 2E90A 5JUZF 3Q2ZA 4N9UA 5DHKA 2ZCSA 5IVGA 1HXCA 2ZEVA 3WSBA 5C05A 3N5JF 2F9KF 3DYHA 3NPKA 1UBYA 2ZCOA 4OKZA 3RBMA 2Q58A 3KRFA 3WEFA 4GA3A 3KRCA 1YQ7A 3TC1A 4RXAA 1V4KA 1WL2A 5ILIA 4OMHA 5HN7A 2E8TA 5DIQF 4P0VA 5E8LA 3RMGA 1YYQA 3ADZA 4EA2A 2OPNA 3KRPB 3SDQA 2AZKA 4OGUA 3LJIA 3QQVA 3N49F 5IK0A 1DGPA 2I19A 3ZOUA 4KQSA 3N3DA 3LMDA 4KK2A 3TFVA 4NKEA 5IMIA 5B01A 4NUAA 3KBKA 3AQCB 2J5CA 2PS8A 2Z7IA 2P1CA 3WJOA 3M9UA 2DH4A 3WJNA 2FORA 3SDRA 2F7MF 1YYUA 3WJKA 1N24A 5A0KA 1YHLA 2Z78A 5EATA 4P0XA 1KIYA 3CC9A 3KRFB 2E93A 3VJAA 2Q9ZA 3KRCB 3LGZB 4OKMA 5DZ2A 5AHUB 3V1VA 4JVJF 4NKFA 5E8KA 3EFQA 2E95A 1HXAA 5CG6A 4JZBA 4FJQA 1YYRA 5JV1F 1N23A 1YYSA 3ICZA 3ICMA 5I1UA 3QKCA 3AQ0A 3N46F 4KVDA 3BNYA 2F94F 5DHIA
chains in the Genus database with same CATH topology
2OPMA 4NG6A 3TFPA 5HN9A 5DGMF 3N45F 3DYGA 4RXDA 3WSAA 3N1WF 2Q80A 4LLTA 4MC8A 3Q30A 1WY0A 5IMNA 4HD1A 3M02A 4KUXA 3TS7A 3ZCDA 2OA6A 3ICKA 3ACYA 1EZFA 4LA6A 2H8OA 4FP4A 4KVIA 4KPDA 5EASA 3RYEA 4JYXA 4PVYF 3M01A 3PKOA 5IKAA 5IM1A 4DWBA 1N1BA 2Z50A 3LDWA 3WE9A 3ACXA 3LGKA 4XQTF 3P41A 5IKHA 1WL3A 5IK9A 1N22A 5EROA 2Q9YA 3WEGA 4JXYA 1UBVA 3ACWA 3LOMA 3TFNA 3VJCA 3WCHA 2E8XA 4H5EF 5B02A 5IK6A 2QISA 2E8WA 2E92A 5ERNA 1JFGA 1WMWA 3APZA 3WCBA 1V4JA 3WEKA 4ZQ8A 4KVWA 3SDVA 2AELA 3MZVA 4RXCA 4L2XF 5ILYA 1WL1A 2ONGA 2Z4YA 2J1PA 2AEKA 3DYFA 2FTZA 3OYRA 4QPFA 4MC0A 5DW7A 1RQJA 3M00A 3ICNA 4LZ3A 5B0LA 5DJRF 5ILJA 5B0MA 3UCAA 5A0JA 2PS5A 3OABB 3WCJA 1V4IA 1N1ZA 3WCAA 4LTVA 4F6XA 5ER8A 1YV5A 3ZMCA 4KWDA 5DGSF 2ZCRA 3WCDA 1N20A 1VG6A 1HM7A 5B0JA 3G4FA 2ZY1A 5EAUA 2AETA 1RTRA 4DZWA 1PS1A 4E1EA 4DEMF 4GAXA 1DI1A 4EA0A 3KRAA 4GP2A 1WL0A 5JV0F 1WKZA 3WEJA 2Z4WA 5A0IA 3ASXA 3CKEA 3AQBB 3SAEA 2Z7HA 1ZW5A 4LZCA 3RYWA 5B0IA 3N0GA 2PS7A 3LVSA 3P5PA 1HX9A 3IPIA 3BNXA 3VJBA 4F62A 2E4OA 2ZCQA 4KQUA 3PDEA 4XQSF 1VG2A 3N1VF 4NFKF 3WCCA 4H5CF 5JA0F 2F89F 1VG7A 5B03A 5HNAA 5AELA 2ZEUA 3OABA 3P8RA 3OACB 1RQIA 3CP6A 5AFXA 2EWGA 3LK5A 3Q2QA 3MAVA 3LSNA 4LOBA 3P8LA 5IL3A 4DXJA 1V4EA 4RYPA 3WEHA 4RXEA 3LG5A 2ONHA 5ILHA 1N21A 5B00A 3VJ9A 1YYTA 5IL8A 3KRAB 4N1ZF 4OMGA 5DJPF 4DHDA 5H9DA 2PS6A 4Q23A 3NPRA 5JV2F 1UBXA 3WCIA 5HN8A 1YHMA 4LTZA 4KFAA 3PYAA 4QXSF 1VG3A 5DGNF 3V1XA 3ZMBA 4WK5A 4E9ZA 1FPSA 2F8CF 3WCGA 3S4JA 2J1OA 4LIXA 2PS4A 4P0WA 2Z52A 4RNQA 4NFIF 5E8HA 2E94A 2Z4ZA 3P5RA 3OACA 2E91A 4LFEA 3SDUA 3ZL6A 2F92F 4LPHF 2AZJA 4DWGA 3S9VA 3N6KF 5KSXF 2E8UA 4GP1A 3LEEA 3VJ8A 4LLSA 3PYBA 3LLWA 5ILDA 3KROA 3LZ9A 3M0GA 5ERMA 2VF6A 2Z4VA 4KKMA 4LPGF 4NFJF 3WCFA 1HXGA 3WCLA 4H5DF 4LA5A 5IMPA 3PH7A 1V4HA 3V66A 4KQ5A 1KIZA 3WEIA 2E8VA 4UMJA 5DJVF 5CG5A 4JXNA 3VJDA 3EGTA 2RAHA 4LFVF 4E9UA 3AE0A 4KPJA 1VG4A 4LXWA 2OGDA 4K10A 4KVYA 3WCEA 4F6VA 3WC9A 2AZLA 1YHKA 4LZ0A 3W7FA 3EZ3A 3N5HF 5AYPA 2F8ZF 4MC3A 5ILKA 3WCMA 1HM4A 4LUUA 4JZXA 3KRPA 5B0KA 4EA1A 3Q1OA 3VJEA 3N3LF 3NRIA 4XQRF 3IBAA 4PVXF 3KB9A 4LFGA 3ID0A 3SDTA 3G4DA 1UBWA 3B7LA 5ILZA 3N0FA 2Z4XA 2O1OA 4DI5A 3KROB 1JFAA 5IN8A 3NF2A 1YJ4A 2E90A 5JUZF 3Q2ZA 4N9UA 5DHKA 2ZCSA 5IVGA 1HXCA 2ZEVA 3WSBA 5C05A 3N5JF 2F9KF 3DYHA 3NPKA 1UBYA 2ZCOA 4OKZA 3RBMA 2Q58A 3KRFA 3WEFA 4GA3A 3KRCA 1YQ7A 3TC1A 4RXAA 1V4KA 1WL2A 5ILIA 4OMHA 5HN7A 2E8TA 5DIQF 4P0VA 5E8LA 3RMGA 1YYQA 3ADZA 4EA2A 2OPNA 3KRPB 3SDQA 2AZKA 4OGUA 3LJIA 3QQVA 3N49F 5IK0A 1DGPA 2I19A 3ZOUA 4KQSA 3N3DA 3LMDA 4KK2A 3TFVA 4NKEA 5IMIA 5B01A 4NUAA 3KBKA 3AQCB 2J5CA 2PS8A 2Z7IA 2P1CA 3WJOA 3M9UA 2DH4A 3WJNA 2FORA 3SDRA 2F7MF 1YYUA 3WJKA 1N24A 5A0KA 1YHLA 2Z78A 5EATA 4P0XA 1KIYA 3CC9A 3KRFB 2E93A 3VJAA 2Q9ZA 3KRCB 3LGZB 4OKMA 5DZ2A 5AHUB 3V1VA 4JVJF 4NKFA 5E8KA 3EFQA 2E95A 1HXAA 5CG6A 4JZBA 4FJQA 1YYRA 5JV1F 1N23A 1YYSA 3ICZA 3ICMA 5I1UA 3QKCA 3AQ0A 3N46F 4KVDA 3BNYA 2F94F 5DHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPM A;  4NG6 A;  3TFP A;  5HN9 A;  5DGM F;  3N45 F;  3DYG A;  4RXD A;  3WSA A;  3N1W F;  2Q80 A;  4LLT A;  4MC8 A;  3Q30 A;  1WY0 A;  5IMN A;  4HD1 A;  3M02 A;  4KUX A;  3TS7 A;  3ZCD A;  2OA6 A;  3ICK A;  3ACY A;  1EZF A;  4LA6 A;  2H8O A;  4FP4 A;  4KVI A;  4KPD A;  5EAS A;  3RYE A;  4JYX A;  4PVY F;  3M01 A;  3PKO A;  5IKA A;  5IM1 A;  4DWB A;  1N1B A;  2Z50 A;  3LDW A;  3WE9 A;  3ACX A;  3LGK A;  4XQT F;  3P41 A;  5IKH A;  1WL3 A;  5IK9 A;  1N22 A;  5ERO A;  2Q9Y A;  3WEG A;  4JXY A;  1UBV A;  3ACW A;  3LOM A;  3TFN A;  3VJC A;  3WCH A;  2E8X A;  4H5E F;  5B02 A;  5IK6 A;  2QIS A;  2E8W A;  2E92 A;  5ERN A;  1JFG A;  1WMW A;  3APZ A;  3WCB A;  1V4J A;  3WEK A;  4ZQ8 A;  4KVW A;  3SDV A;  2AEL A;  3MZV A;  4RXC A;  4L2X F;  5ILY A;  1WL1 A;  2ONG A;  2Z4Y A;  2J1P A;  2AEK A;  3DYF A;  2FTZ A;  3OYR A;  4QPF A;  4MC0 A;  5DW7 A;  1RQJ A;  3M00 A;  3ICN A;  4LZ3 A;  5B0L A;  5DJR F;  5ILJ A;  5B0M A;  3UCA A;  5A0J A;  2PS5 A;  3OAB B;  3WCJ A;  1V4I A;  1N1Z A;  3WCA A;  4LTV A;  4F6X A;  5ER8 A;  1YV5 A;  3ZMC A;  4KWD A;  5DGS F;  2ZCR A;  3WCD A;  1N20 A;  1VG6 A;  1HM7 A;  5B0J A;  3G4F A;  2ZY1 A;  5EAU A;  2AET A;  1RTR A;  4DZW A;  1PS1 A;  4E1E A;  4DEM F;  4GAX A;  1DI1 A;  4EA0 A;  3KRA A;  4GP2 A;  1WL0 A;  5JV0 F;  1WKZ A;  3WEJ A;  2Z4W A;  5A0I A;  3ASX A;  3CKE A;  3AQB B;  3SAE A;  2Z7H A;  1ZW5 A;  4LZC A;  3RYW A;  5B0I A;  3N0G A;  2PS7 A;  3LVS A;  3P5P A;  1HX9 A;  3IPI A;  3BNX A;  3VJB A;  4F62 A;  2E4O A;  2ZCQ A;  4KQU A;  3PDE A;  4XQS F;  1VG2 A;  3N1V F;  4NFK F;  3WCC A;  4H5C F;  5JA0 F;  2F89 F;  1VG7 A;  5B03 A;  5HNA A;  5AEL A;  2ZEU A;  3OAB A;  3P8R A;  3OAC B;  1RQI A;  3CP6 A;  5AFX A;  2EWG A;  3LK5 A;  3Q2Q A;  3MAV A;  3LSN A;  4LOB A;  3P8L A;  5IL3 A;  4DXJ A;  1V4E A;  4RYP A;  3WEH A;  4RXE A;  3LG5 A;  2ONH A;  5ILH A;  1N21 A;  5B00 A;  3VJ9 A;  1YYT A;  5IL8 A;  3KRA B;  4N1Z F;  4OMG A;  5DJP F;  4DHD A;  5H9D A;  2PS6 A;  4Q23 A;  3NPR A;  5JV2 F;  1UBX A;  3WCI A;  5HN8 A;  1YHM A;  4LTZ A;  4KFA A;  3PYA A;  4QXS F;  1VG3 A;  5DGN F;  3V1X A;  3ZMB A;  4WK5 A;  4E9Z A;  1FPS A;  2F8C F;  3WCG A;  3S4J A;  2J1O A;  4LIX A;  2PS4 A;  4P0W A;  2Z52 A;  4RNQ A;  4NFI F;  5E8H A;  2E94 A;  2Z4Z A;  3P5R A;  3OAC A;  2E91 A;  4LFE A;  3SDU A;  3ZL6 A;  2F92 F;  4LPH F;  2AZJ A;  4DWG A;  3S9V A;  3N6K F;  5KSX F;  2E8U A;  4GP1 A;  3LEE A;  3VJ8 A;  4LLS A;  3PYB A;  3LLW A;  5ILD A;  3KRO A;  3LZ9 A;  3M0G A;  5ERM A;  2VF6 A;  2Z4V A;  4KKM A;  4LPG F;  4NFJ F;  3WCF A;  1HXG A;  3WCL A;  4H5D F;  4LA5 A;  5IMP A;  3PH7 A;  1V4H A;  3V66 A;  4KQ5 A;  1KIZ A;  3WEI A;  2E8V A;  4UMJ A;  5DJV F;  5CG5 A;  4JXN A;  3VJD A;  3EGT A;  2RAH A;  4LFV F;  4E9U A;  3AE0 A;  4KPJ A;  1VG4 A;  4LXW A;  2OGD A;  4K10 A;  4KVY A;  3WCE A;  4F6V A;  3WC9 A;  2AZL A;  1YHK A;  4LZ0 A;  3W7F A;  3EZ3 A;  3N5H F;  5AYP A;  2F8Z F;  4MC3 A;  5ILK A;  3WCM A;  1HM4 A;  4LUU A;  4JZX A;  3KRP A;  5B0K A;  4EA1 A;  3Q1O A;  3VJE A;  3N3L F;  3NRI A;  4XQR F;  3IBA A;  4PVX F;  3KB9 A;  4LFG A;  3ID0 A;  3SDT A;  3G4D A;  1UBW A;  3B7L A;  5ILZ A;  3N0F A;  2Z4X A;  2O1O A;  4DI5 A;  3KRO B;  1JFA A;  5IN8 A;  3NF2 A;  1YJ4 A;  2E90 A;  5JUZ F;  3Q2Z A;  4N9U A;  5DHK A;  2ZCS A;  5IVG A;  1HXC A;  2ZEV A;  3WSB A;  5C05 A;  3N5J F;  2F9K F;  3DYH A;  3NPK A;  1UBY A;  2ZCO A;  4OKZ A;  3RBM A;  2Q58 A;  3KRF A;  3WEF A;  4GA3 A;  3KRC A;  1YQ7 A;  3TC1 A;  4RXA A;  1V4K A;  1WL2 A;  5ILI A;  4OMH A;  5HN7 A;  2E8T A;  5DIQ F;  4P0V A;  5E8L A;  3RMG A;  1YYQ A;  3ADZ A;  4EA2 A;  2OPN A;  3KRP B;  3SDQ A;  2AZK A;  4OGU A;  3LJI A;  3QQV A;  3N49 F;  5IK0 A;  1DGP A;  2I19 A;  3ZOU A;  4KQS A;  3N3D A;  3LMD A;  4KK2 A;  3TFV A;  4NKE A;  5IMI A;  5B01 A;  4NUA A;  3KBK A;  3AQC B;  2J5C A;  2PS8 A;  2Z7I A;  2P1C A;  3WJO A;  3M9U A;  2DH4 A;  3WJN A;  2FOR A;  3SDR A;  2F7M F;  1YYU A;  3WJK A;  1N24 A;  5A0K A;  1YHL A;  2Z78 A;  5EAT A;  4P0X A;  1KIY A;  3CC9 A;  3KRF B;  2E93 A;  3VJA A;  2Q9Z A;  3KRC B;  3LGZ B;  4OKM A;  5DZ2 A;  5AHU B;  3V1V A;  4JVJ F;  4NKF A;  5E8K A;  3EFQ A;  2E95 A;  1HXA A;  5CG6 A;  4JZB A;  4FJQ A;  1YYR A;  5JV1 F;  1N23 A;  1YYS A;  3ICZ A;  3ICM A;  5I1U A;  3QKC A;  3AQ0 A;  3N46 F;  4KVD A;  3BNY A;  2F94 F;  5DHI A; 
#chains in the Genus database with same CATH topology
 2OPM A;  4NG6 A;  3TFP A;  5HN9 A;  5DGM F;  3N45 F;  3DYG A;  4RXD A;  3WSA A;  3N1W F;  2Q80 A;  4LLT A;  4MC8 A;  3Q30 A;  1WY0 A;  5IMN A;  4HD1 A;  3M02 A;  4KUX A;  3TS7 A;  3ZCD A;  2OA6 A;  3ICK A;  3ACY A;  1EZF A;  4LA6 A;  2H8O A;  4FP4 A;  4KVI A;  4KPD A;  5EAS A;  3RYE A;  4JYX A;  4PVY F;  3M01 A;  3PKO A;  5IKA A;  5IM1 A;  4DWB A;  1N1B A;  2Z50 A;  3LDW A;  3WE9 A;  3ACX A;  3LGK A;  4XQT F;  3P41 A;  5IKH A;  1WL3 A;  5IK9 A;  1N22 A;  5ERO A;  2Q9Y A;  3WEG A;  4JXY A;  1UBV A;  3ACW A;  3LOM A;  3TFN A;  3VJC A;  3WCH A;  2E8X A;  4H5E F;  5B02 A;  5IK6 A;  2QIS A;  2E8W A;  2E92 A;  5ERN A;  1JFG A;  1WMW A;  3APZ A;  3WCB A;  1V4J A;  3WEK A;  4ZQ8 A;  4KVW A;  3SDV A;  2AEL A;  3MZV A;  4RXC A;  4L2X F;  5ILY A;  1WL1 A;  2ONG A;  2Z4Y A;  2J1P A;  2AEK A;  3DYF A;  2FTZ A;  3OYR A;  4QPF A;  4MC0 A;  5DW7 A;  1RQJ A;  3M00 A;  3ICN A;  4LZ3 A;  5B0L A;  5DJR F;  5ILJ A;  5B0M A;  3UCA A;  5A0J A;  2PS5 A;  3OAB B;  3WCJ A;  1V4I A;  1N1Z A;  3WCA A;  4LTV A;  4F6X A;  5ER8 A;  1YV5 A;  3ZMC A;  4KWD A;  5DGS F;  2ZCR A;  3WCD A;  1N20 A;  1VG6 A;  1HM7 A;  5B0J A;  3G4F A;  2ZY1 A;  5EAU A;  2AET A;  1RTR A;  4DZW A;  1PS1 A;  4E1E A;  4DEM F;  4GAX A;  1DI1 A;  4EA0 A;  3KRA A;  4GP2 A;  1WL0 A;  5JV0 F;  1WKZ A;  3WEJ A;  2Z4W A;  5A0I A;  3ASX A;  3CKE A;  3AQB B;  3SAE A;  2Z7H A;  1ZW5 A;  4LZC A;  3RYW A;  5B0I A;  3N0G A;  2PS7 A;  3LVS A;  3P5P A;  1HX9 A;  3IPI A;  3BNX A;  3VJB A;  4F62 A;  2E4O A;  2ZCQ A;  4KQU A;  3PDE A;  4XQS F;  1VG2 A;  3N1V F;  4NFK F;  3WCC A;  4H5C F;  5JA0 F;  2F89 F;  1VG7 A;  5B03 A;  5HNA A;  5AEL A;  2ZEU A;  3OAB A;  3P8R A;  3OAC B;  1RQI A;  3CP6 A;  5AFX A;  2EWG A;  3LK5 A;  3Q2Q A;  3MAV A;  3LSN A;  4LOB A;  3P8L A;  5IL3 A;  4DXJ A;  1V4E A;  4RYP A;  3WEH A;  4RXE A;  3LG5 A;  2ONH A;  5ILH A;  1N21 A;  5B00 A;  3VJ9 A;  1YYT A;  5IL8 A;  3KRA B;  4N1Z F;  4OMG A;  5DJP F;  4DHD A;  5H9D A;  2PS6 A;  4Q23 A;  3NPR A;  5JV2 F;  1UBX A;  3WCI A;  5HN8 A;  1YHM A;  4LTZ A;  4KFA A;  3PYA A;  4QXS F;  1VG3 A;  5DGN F;  3V1X A;  3ZMB A;  4WK5 A;  4E9Z A;  1FPS A;  2F8C F;  3WCG A;  3S4J A;  2J1O A;  4LIX A;  2PS4 A;  4P0W A;  2Z52 A;  4RNQ A;  4NFI F;  5E8H A;  2E94 A;  2Z4Z A;  3P5R A;  3OAC A;  2E91 A;  4LFE A;  3SDU A;  3ZL6 A;  2F92 F;  4LPH F;  2AZJ A;  4DWG A;  3S9V A;  3N6K F;  5KSX F;  2E8U A;  4GP1 A;  3LEE A;  3VJ8 A;  4LLS A;  3PYB A;  3LLW A;  5ILD A;  3KRO A;  3LZ9 A;  3M0G A;  5ERM A;  2VF6 A;  2Z4V A;  4KKM A;  4LPG F;  4NFJ F;  3WCF A;  1HXG A;  3WCL A;  4H5D F;  4LA5 A;  5IMP A;  3PH7 A;  1V4H A;  3V66 A;  4KQ5 A;  1KIZ A;  3WEI A;  2E8V A;  4UMJ A;  5DJV F;  5CG5 A;  4JXN A;  3VJD A;  3EGT A;  2RAH A;  4LFV F;  4E9U A;  3AE0 A;  4KPJ A;  1VG4 A;  4LXW A;  2OGD A;  4K10 A;  4KVY A;  3WCE A;  4F6V A;  3WC9 A;  2AZL A;  1YHK A;  4LZ0 A;  3W7F A;  3EZ3 A;  3N5H F;  5AYP A;  2F8Z F;  4MC3 A;  5ILK A;  3WCM A;  1HM4 A;  4LUU A;  4JZX A;  3KRP A;  5B0K A;  4EA1 A;  3Q1O A;  3VJE A;  3N3L F;  3NRI A;  4XQR F;  3IBA A;  4PVX F;  3KB9 A;  4LFG A;  3ID0 A;  3SDT A;  3G4D A;  1UBW A;  3B7L A;  5ILZ A;  3N0F A;  2Z4X A;  2O1O A;  4DI5 A;  3KRO B;  1JFA A;  5IN8 A;  3NF2 A;  1YJ4 A;  2E90 A;  5JUZ F;  3Q2Z A;  4N9U A;  5DHK A;  2ZCS A;  5IVG A;  1HXC A;  2ZEV A;  3WSB A;  5C05 A;  3N5J F;  2F9K F;  3DYH A;  3NPK A;  1UBY A;  2ZCO A;  4OKZ A;  3RBM A;  2Q58 A;  3KRF A;  3WEF A;  4GA3 A;  3KRC A;  1YQ7 A;  3TC1 A;  4RXA A;  1V4K A;  1WL2 A;  5ILI A;  4OMH A;  5HN7 A;  2E8T A;  5DIQ F;  4P0V A;  5E8L A;  3RMG A;  1YYQ A;  3ADZ A;  4EA2 A;  2OPN A;  3KRP B;  3SDQ A;  2AZK A;  4OGU A;  3LJI A;  3QQV A;  3N49 F;  5IK0 A;  1DGP A;  2I19 A;  3ZOU A;  4KQS A;  3N3D A;  3LMD A;  4KK2 A;  3TFV A;  4NKE A;  5IMI A;  5B01 A;  4NUA A;  3KBK A;  3AQC B;  2J5C A;  2PS8 A;  2Z7I A;  2P1C A;  3WJO A;  3M9U A;  2DH4 A;  3WJN A;  2FOR A;  3SDR A;  2F7M F;  1YYU A;  3WJK A;  1N24 A;  5A0K A;  1YHL A;  2Z78 A;  5EAT A;  4P0X A;  1KIY A;  3CC9 A;  3KRF B;  2E93 A;  3VJA A;  2Q9Z A;  3KRC B;  3LGZ B;  4OKM A;  5DZ2 A;  5AHU B;  3V1V A;  4JVJ F;  4NKF A;  5E8K A;  3EFQ A;  2E95 A;  1HXA A;  5CG6 A;  4JZB A;  4FJQ A;  1YYR A;  5JV1 F;  1N23 A;  1YYS A;  3ICZ A;  3ICM A;  5I1U A;  3QKC A;  3AQ0 A;  3N46 F;  4KVD A;  3BNY A;  2F94 F;  5DHI A; 
#chains in the Genus database with same CATH homology
 2OPM A;  4NG6 A;  3TFP A;  5HN9 A;  5DGM F;  3N45 F;  3DYG A;  4RXD A;  3WSA A;  3N1W F;  2Q80 A;  4LLT A;  4MC8 A;  3Q30 A;  1WY0 A;  5IMN A;  4HD1 A;  3M02 A;  4KUX A;  3TS7 A;  3ZCD A;  2OA6 A;  3ICK A;  3ACY A;  1EZF A;  4LA6 A;  2H8O A;  4FP4 A;  4KVI A;  4KPD A;  5EAS A;  3RYE A;  4JYX A;  4PVY F;  3M01 A;  3PKO A;  5IKA A;  5IM1 A;  4DWB A;  1N1B A;  2Z50 A;  3LDW A;  3WE9 A;  3ACX A;  3LGK A;  4XQT F;  3P41 A;  5IKH A;  1WL3 A;  5IK9 A;  1N22 A;  5ERO A;  2Q9Y A;  3WEG A;  4JXY A;  1UBV A;  3ACW A;  3LOM A;  3TFN A;  3VJC A;  3WCH A;  2E8X A;  4H5E F;  5B02 A;  5IK6 A;  2QIS A;  2E8W A;  2E92 A;  5ERN A;  1JFG A;  1WMW A;  3APZ A;  3WCB A;  1V4J A;  3WEK A;  4ZQ8 A;  4KVW A;  3SDV A;  2AEL A;  3MZV A;  4RXC A;  4L2X F;  5ILY A;  1WL1 A;  2ONG A;  2Z4Y A;  2J1P A;  2AEK A;  3DYF A;  2FTZ A;  3OYR A;  4QPF A;  4MC0 A;  5DW7 A;  1RQJ A;  3M00 A;  3ICN A;  4LZ3 A;  5B0L A;  5DJR F;  5ILJ A;  5B0M A;  3UCA A;  5A0J A;  2PS5 A;  3OAB B;  3WCJ A;  1V4I A;  1N1Z A;  3WCA A;  4LTV A;  4F6X A;  5ER8 A;  1YV5 A;  3ZMC A;  4KWD A;  5DGS F;  2ZCR A;  3WCD A;  1N20 A;  1VG6 A;  1HM7 A;  5B0J A;  3G4F A;  2ZY1 A;  5EAU A;  2AET A;  1RTR A;  4DZW A;  1PS1 A;  4E1E A;  4DEM F;  4GAX A;  1DI1 A;  4EA0 A;  3KRA A;  4GP2 A;  1WL0 A;  5JV0 F;  1WKZ A;  3WEJ A;  2Z4W A;  5A0I A;  3ASX A;  3CKE A;  3AQB B;  3SAE A;  2Z7H A;  1ZW5 A;  4LZC A;  3RYW A;  5B0I A;  3N0G A;  2PS7 A;  3LVS A;  3P5P A;  1HX9 A;  3IPI A;  3BNX A;  3VJB A;  4F62 A;  2E4O A;  2ZCQ A;  4KQU A;  3PDE A;  4XQS F;  1VG2 A;  3N1V F;  4NFK F;  3WCC A;  4H5C F;  5JA0 F;  2F89 F;  1VG7 A;  5B03 A;  5HNA A;  5AEL A;  2ZEU A;  3OAB A;  3P8R A;  3OAC B;  1RQI A;  3CP6 A;  5AFX A;  2EWG A;  3LK5 A;  3Q2Q A;  3MAV A;  3LSN A;  4LOB A;  3P8L A;  5IL3 A;  4DXJ A;  1V4E A;  4RYP A;  3WEH A;  4RXE A;  3LG5 A;  2ONH A;  5ILH A;  1N21 A;  5B00 A;  3VJ9 A;  1YYT A;  5IL8 A;  3KRA B;  4N1Z F;  4OMG A;  5DJP F;  4DHD A;  5H9D A;  2PS6 A;  4Q23 A;  3NPR A;  5JV2 F;  1UBX A;  3WCI A;  5HN8 A;  1YHM A;  4LTZ A;  4KFA A;  3PYA A;  4QXS F;  1VG3 A;  5DGN F;  3V1X A;  3ZMB A;  4WK5 A;  4E9Z A;  1FPS A;  2F8C F;  3WCG A;  3S4J A;  2J1O A;  4LIX A;  2PS4 A;  4P0W A;  2Z52 A;  4RNQ A;  4NFI F;  5E8H A;  2E94 A;  2Z4Z A;  3P5R A;  3OAC A;  2E91 A;  4LFE A;  3SDU A;  3ZL6 A;  2F92 F;  4LPH F;  2AZJ A;  4DWG A;  3S9V A;  3N6K F;  5KSX F;  2E8U A;  4GP1 A;  3LEE A;  3VJ8 A;  4LLS A;  3PYB A;  3LLW A;  5ILD A;  3KRO A;  3LZ9 A;  3M0G A;  5ERM A;  2VF6 A;  2Z4V A;  4KKM A;  4LPG F;  4NFJ F;  3WCF A;  1HXG A;  3WCL A;  4H5D F;  4LA5 A;  5IMP A;  3PH7 A;  1V4H A;  3V66 A;  4KQ5 A;  1KIZ A;  3WEI A;  2E8V A;  4UMJ A;  5DJV F;  5CG5 A;  4JXN A;  3VJD A;  3EGT A;  2RAH A;  4LFV F;  4E9U A;  3AE0 A;  4KPJ A;  1VG4 A;  4LXW A;  2OGD A;  4K10 A;  4KVY A;  3WCE A;  4F6V A;  3WC9 A;  2AZL A;  1YHK A;  4LZ0 A;  3W7F A;  3EZ3 A;  3N5H F;  5AYP A;  2F8Z F;  4MC3 A;  5ILK A;  3WCM A;  1HM4 A;  4LUU A;  4JZX A;  3KRP A;  5B0K A;  4EA1 A;  3Q1O A;  3VJE A;  3N3L F;  3NRI A;  4XQR F;  3IBA A;  4PVX F;  3KB9 A;  4LFG A;  3ID0 A;  3SDT A;  3G4D A;  1UBW A;  3B7L A;  5ILZ A;  3N0F A;  2Z4X A;  2O1O A;  4DI5 A;  3KRO B;  1JFA A;  5IN8 A;  3NF2 A;  1YJ4 A;  2E90 A;  5JUZ F;  3Q2Z A;  4N9U A;  5DHK A;  2ZCS A;  5IVG A;  1HXC A;  2ZEV A;  3WSB A;  5C05 A;  3N5J F;  2F9K F;  3DYH A;  3NPK A;  1UBY A;  2ZCO A;  4OKZ A;  3RBM A;  2Q58 A;  3KRF A;  3WEF A;  4GA3 A;  3KRC A;  1YQ7 A;  3TC1 A;  4RXA A;  1V4K A;  1WL2 A;  5ILI A;  4OMH A;  5HN7 A;  2E8T A;  5DIQ F;  4P0V A;  5E8L A;  3RMG A;  1YYQ A;  3ADZ A;  4EA2 A;  2OPN A;  3KRP B;  3SDQ A;  2AZK A;  4OGU A;  3LJI A;  3QQV A;  3N49 F;  5IK0 A;  1DGP A;  2I19 A;  3ZOU A;  4KQS A;  3N3D A;  3LMD A;  4KK2 A;  3TFV A;  4NKE A;  5IMI A;  5B01 A;  4NUA A;  3KBK A;  3AQC B;  2J5C A;  2PS8 A;  2Z7I A;  2P1C A;  3WJO A;  3M9U A;  2DH4 A;  3WJN A;  2FOR A;  3SDR A;  2F7M F;  1YYU A;  3WJK A;  1N24 A;  5A0K A;  1YHL A;  2Z78 A;  5EAT A;  4P0X A;  1KIY A;  3CC9 A;  3KRF B;  2E93 A;  3VJA A;  2Q9Z A;  3KRC B;  3LGZ B;  4OKM A;  5DZ2 A;  5AHU B;  3V1V A;  4JVJ F;  4NKF A;  5E8K A;  3EFQ A;  2E95 A;  1HXA A;  5CG6 A;  4JZB A;  4FJQ A;  1YYR A;  5JV1 F;  1N23 A;  1YYS A;  3ICZ A;  3ICM A;  5I1U A;  3QKC A;  3AQ0 A;  3N46 F;  4KVD A;  3BNY A;  2F94 F;  5DHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...