5B02A

Structure of the prenyltransferase moen5 with a fusion protein tag of sso7d
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
264
structure length
264
Chain Sequence
VDDDDKMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, dna binding protein
molecule keywords MoeN5,DNA-binding protein 7d
publication title Moenomycin Biosynthesis: Structure and Mechanism of Action of the Prenyltransferase MoeN5.
pubmed doi rcsb
source organism Streptomyces ghanaensis
total genus 116
structure length 264
sequence length 264
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b02A00
3M9UA 3G4FA 4KVDA 2P1CA 4XQSF 1PS1A 2QISA 1V4HA 1V4JA 3N3LF 3ZCDA 5B00A 1DGPA 4KQ5A 4JXNA 3KRFA 3ACXA 3WCIA 5ILZA 1N22A 2E4OA 3V66A 5AELA 2RAHA 2Z4ZA 3P41A 3WJOA 4KFAA 3SDVA 2Q58A 3S9VA 1UBYA 3OABB 5B0JA 4N1ZF 2OGDA 4LLTA 4ZQ8A 4LLSA 4HD1A 4RXAA 3V1VA 3WCBA 1V4KA 2ONGA 3LGKA 5IK9A 4EA1A 3EZ3A 3N6KF 3RBMA 3WCHA 4MC3A 3QKCA 3VJ8A 3LDWA 2ZCQA 3OYRA 4KVWA 4JXYA 2Z4VA 1YV5A 3BNXA 2F8CF 2Z78A 5CG6A 3AQBB 1VG4A 3PKOA 3VJBA 5HN8A 5DJVF 2PS5A 3ICNA 4RXDA 5ERMA 5B0MA 2AETA 2EWGA 1HXCA 1N1ZA 2F94F 3KRCB 3MAVA 5A0IA 3WEFA 1KIZA 2Z7HA 3ZMCA 4OKZA 5CG5A 2AEKA 1YHMA 1RQIA 2Z7IA 2Z4WA 5DJRF 4H5EF 3LZ9A 4LA6A 3KROB 2FTZA 3OABA 2AZJA 2Z50A 3LMDA 2ONHA 4H5DF 4JVJF 4Q23A 3VJCA 3KBKA 2J5CA 3N49F 1YYRA 3TFPA 4NKEA 2ZEVA 2F7MF 5HN9A 2E8VA 3LG5A 3LK5A 3ICKA 3Q30A 3RMGA 3RYEA 1V4IA 3N45F 4NUAA 4P0WA 2PS7A 2E8TA 1WL2A 4LA5A 4LFVF 4UMJA 3WEGA 4KUXA 3OACA 2E8XA 2AZKA 3KRCA 3M01A 5DHIA 3MZVA 1N24A 2Z4YA 4LZCA 4KQUA 5IK6A 3PYAA 4KQSA 5IKAA 4LUUA 4H5CF 4EA0A 4LOBA 3KROA 4FP4A 1YYSA 3CKEA 3LJIA 2E94A 3P5PA 5ILDA 4L2XF 3KRPB 3WCLA 3LSNA 1YYUA 3N1VF 3ADZA 5E8KA 2ZCOA 3ID0A 1WY0A 5IM1A 3P8LA 3LEEA 5A0JA 3B7LA 2H8OA 5ERNA 3PDEA 3TC1A 4LIXA 2OA6A 5ER8A 1YHLA 1VG2A 4WK5A 3VJ9A 4PVYF 3TS7A 2ZCSA 3BNYA 1N20A 1FPSA 4JZBA 5JV1F 3Q2ZA 5ILJA 4QXSF 1EZFA 5B01A 1V4EA 4LTVA 3V1XA 4KVIA 2PS4A 5DJPF 4DWBA 3AQCB 5B0KA 3RYWA 3NPRA 3M00A 5AFXA 3NF2A 5DGSF 5C05A 1WL1A 2DH4A 3SDUA 3UCAA 1RTRA 5EROA 3KRPA 4E9UA 4KPJA 3OACB 2ZY1A 4LFEA 2Z4XA 3P8RA 2AELA 5JV2F 2E91A 5DW7A 3WCCA 4NFKF 1JFAA 5E8LA 4OGUA 3WCFA 1HM4A 3WEJA 4JZXA 5EAUA 3VJAA 3WCDA 3N0GA 3WCEA 5JUZF 4NKFA 1HM7A 1VG6A 4KWDA 1YYQA 2Q9YA 4QPFA 5ILIA 3ZL6A 1N1BA 3S4JA 2FORA 3PYBA 5KSXF 4E1EA 5B02A 4NFIF 4N9UA 5AYPA 3KRAB 4KVYA 4OMHA 5IL3A 5E8HA 3ICZA 3Q2QA 3CP6A 2VF6A 1WL0A 5IL8A 4NFJF 3LOMA 2E8WA 4DI5A 3N0FA 1RQJA 5JV0F 4DEMF 2E95A 2E93A 2F92F 5DGMF 3DYHA 1UBVA 5IVGA 1YJ4A 5HNAA 4DZWA 4DHDA 3ZMBA 5DIQF 4KPDA 3APZA 3LLWA 4LZ3A 3KB9A 3WEKA 3WCJA 4LPHF 4P0VA 1YYTA 3ACWA 5ILYA 3N1WF 2J1PA 5B0IA 5AHUB 4GAXA 4KKMA 1HX9A 2E90A 1DI1A 3KRAA 2PS8A 4OMGA 4MC0A 3NRIA 4F6VA 4KK2A 4F62A 4NG6A 1WL3A 3IBAA 1WKZA 1HXGA 5IK0A 3WE9A 1WMWA 4LFGA 2O1OA 4LXWA 1HXAA 4PVXF 5DGNF 2F9KF 4K10A 4RXEA 4GP2A 3ZOUA 2Z52A 3WEHA 3EGTA 2PS6A 3WCMA 2ZCRA 2OPNA 2E8UA 1UBXA 3P5RA 4F6XA 3WC9A 3ASXA 3DYGA 1YHKA 4E9ZA 3IPIA 5IN8A 3VJEA 4RYPA 5ILKA 2AZLA 4FJQA 1UBWA 4DWGA 4EA2A 3WCGA 3WJNA 5ILHA 3W7FA 1JFGA 4XQTF 3CC9A 3SDQA 2E92A 5IKHA 3QQVA 3WSAA 5EASA 4RXCA 1N23A 3LVSA 1KIYA 3SDRA 4DXJA 4MC8A 3M02A 5A0KA 2J1OA 5B03A 4LPGF 4GP1A 5I1UA 3SAEA 3LGZB 2F89F 2I19A 3ACYA 3KRFB 1ZW5A 3M0GA 5IMPA 4P0XA 2Q80A 3WEIA 4JYXA 4RNQA 3N5HF 5EATA 5DHKA 3G4DA 5DZ2A 2Q9ZA 3DYFA 4OKMA 2OPMA 3N46F 5IMNA 3N5JF 4LTZA 5IMIA 2ZEUA 5JA0F 2F8ZF 4LZ0A 1VG7A 3VJDA 1N21A 3EFQA 3ICMA 4XQRF 3TFVA 1VG3A 3WSBA 5H9DA 3WJKA 3TFNA 3Q1OA 3SDTA 3AE0A 3NPKA 1YQ7A 3AQ0A 5HN7A 3WCAA 3N3DA 3PH7A 5B0LA 4GA3A
chains in the Genus database with same CATH superfamily
3M9UA 3G4FA 4KVDA 2P1CA 4XQSF 1PS1A 2QISA 1V4HA 1V4JA 3N3LF 3ZCDA 5B00A 1DGPA 4KQ5A 4JXNA 3KRFA 3ACXA 3WCIA 5ILZA 1N22A 2E4OA 3V66A 5AELA 2RAHA 2Z4ZA 3P41A 3WJOA 4KFAA 3SDVA 2Q58A 3S9VA 1UBYA 3OABB 5B0JA 4N1ZF 2OGDA 4LLTA 4ZQ8A 4LLSA 4HD1A 4RXAA 3V1VA 3WCBA 1V4KA 2ONGA 3LGKA 5IK9A 4EA1A 3EZ3A 3N6KF 3RBMA 3WCHA 4MC3A 3QKCA 3VJ8A 3LDWA 2ZCQA 3OYRA 4KVWA 4JXYA 2Z4VA 1YV5A 3BNXA 2F8CF 2Z78A 5CG6A 3AQBB 1VG4A 3PKOA 3VJBA 5HN8A 5DJVF 2PS5A 3ICNA 4RXDA 5ERMA 5B0MA 2AETA 2EWGA 1HXCA 1N1ZA 2F94F 3KRCB 3MAVA 5A0IA 3WEFA 1KIZA 2Z7HA 3ZMCA 4OKZA 5CG5A 2AEKA 1YHMA 1RQIA 2Z7IA 2Z4WA 5DJRF 4H5EF 3LZ9A 4LA6A 3KROB 2FTZA 3OABA 2AZJA 2Z50A 3LMDA 2ONHA 4H5DF 4JVJF 4Q23A 3VJCA 3KBKA 2J5CA 3N49F 1YYRA 3TFPA 4NKEA 2ZEVA 2F7MF 5HN9A 2E8VA 3LG5A 3LK5A 3ICKA 3Q30A 3RMGA 3RYEA 1V4IA 3N45F 4NUAA 4P0WA 2PS7A 2E8TA 1WL2A 4LA5A 4LFVF 4UMJA 3WEGA 4KUXA 3OACA 2E8XA 2AZKA 3KRCA 3M01A 5DHIA 3MZVA 1N24A 2Z4YA 4LZCA 4KQUA 5IK6A 3PYAA 4KQSA 5IKAA 4LUUA 4H5CF 4EA0A 4LOBA 3KROA 4FP4A 1YYSA 3CKEA 3LJIA 2E94A 3P5PA 5ILDA 4L2XF 3KRPB 3WCLA 3LSNA 1YYUA 3N1VF 3ADZA 5E8KA 2ZCOA 3ID0A 1WY0A 5IM1A 3P8LA 3LEEA 5A0JA 3B7LA 2H8OA 5ERNA 3PDEA 3TC1A 4LIXA 2OA6A 5ER8A 1YHLA 1VG2A 4WK5A 3VJ9A 4PVYF 3TS7A 2ZCSA 3BNYA 1N20A 1FPSA 4JZBA 5JV1F 3Q2ZA 5ILJA 4QXSF 1EZFA 5B01A 1V4EA 4LTVA 3V1XA 4KVIA 2PS4A 5DJPF 4DWBA 3AQCB 5B0KA 3RYWA 3NPRA 3M00A 5AFXA 3NF2A 5DGSF 5C05A 1WL1A 2DH4A 3SDUA 3UCAA 1RTRA 5EROA 3KRPA 4E9UA 4KPJA 3OACB 2ZY1A 4LFEA 2Z4XA 3P8RA 2AELA 5JV2F 2E91A 5DW7A 3WCCA 4NFKF 1JFAA 5E8LA 4OGUA 3WCFA 1HM4A 3WEJA 4JZXA 5EAUA 3VJAA 3WCDA 3N0GA 3WCEA 5JUZF 4NKFA 1HM7A 1VG6A 4KWDA 1YYQA 2Q9YA 4QPFA 5ILIA 3ZL6A 1N1BA 3S4JA 2FORA 3PYBA 5KSXF 4E1EA 5B02A 4NFIF 4N9UA 5AYPA 3KRAB 4KVYA 4OMHA 5IL3A 5E8HA 3ICZA 3Q2QA 3CP6A 2VF6A 1WL0A 5IL8A 4NFJF 3LOMA 2E8WA 4DI5A 3N0FA 1RQJA 5JV0F 4DEMF 2E95A 2E93A 2F92F 5DGMF 3DYHA 1UBVA 5IVGA 1YJ4A 5HNAA 4DZWA 4DHDA 3ZMBA 5DIQF 4KPDA 3APZA 3LLWA 4LZ3A 3KB9A 3WEKA 3WCJA 4LPHF 4P0VA 1YYTA 3ACWA 5ILYA 3N1WF 2J1PA 5B0IA 5AHUB 4GAXA 4KKMA 1HX9A 2E90A 1DI1A 3KRAA 2PS8A 4OMGA 4MC0A 3NRIA 4F6VA 4KK2A 4F62A 4NG6A 1WL3A 3IBAA 1WKZA 1HXGA 5IK0A 3WE9A 1WMWA 4LFGA 2O1OA 4LXWA 1HXAA 4PVXF 5DGNF 2F9KF 4K10A 4RXEA 4GP2A 3ZOUA 2Z52A 3WEHA 3EGTA 2PS6A 3WCMA 2ZCRA 2OPNA 2E8UA 1UBXA 3P5RA 4F6XA 3WC9A 3ASXA 3DYGA 1YHKA 4E9ZA 3IPIA 5IN8A 3VJEA 4RYPA 5ILKA 2AZLA 4FJQA 1UBWA 4DWGA 4EA2A 3WCGA 3WJNA 5ILHA 3W7FA 1JFGA 4XQTF 3CC9A 3SDQA 2E92A 5IKHA 3QQVA 3WSAA 5EASA 4RXCA 1N23A 3LVSA 1KIYA 3SDRA 4DXJA 4MC8A 3M02A 5A0KA 2J1OA 5B03A 4LPGF 4GP1A 5I1UA 3SAEA 3LGZB 2F89F 2I19A 3ACYA 3KRFB 1ZW5A 3M0GA 5IMPA 4P0XA 2Q80A 3WEIA 4JYXA 4RNQA 3N5HF 5EATA 5DHKA 3G4DA 5DZ2A 2Q9ZA 3DYFA 4OKMA 2OPMA 3N46F 5IMNA 3N5JF 4LTZA 5IMIA 2ZEUA 5JA0F 2F8ZF 4LZ0A 1VG7A 3VJDA 1N21A 3EFQA 3ICMA 4XQRF 3TFVA 1VG3A 3WSBA 5H9DA 3WJKA 3TFNA 3Q1OA 3SDTA 3AE0A 3NPKA 1YQ7A 3AQ0A 5HN7A 3WCAA 3N3DA 3PH7A 5B0LA 4GA3A
chains in the Genus database with same CATH topology
3M9UA 3G4FA 4KVDA 2P1CA 4XQSF 1PS1A 2QISA 1V4HA 1V4JA 3N3LF 3ZCDA 5B00A 1DGPA 4KQ5A 4JXNA 3KRFA 3ACXA 3WCIA 5ILZA 1N22A 2E4OA 3V66A 5AELA 2RAHA 2Z4ZA 3P41A 3WJOA 4KFAA 3SDVA 2Q58A 3S9VA 1UBYA 3OABB 5B0JA 4N1ZF 2OGDA 4LLTA 4ZQ8A 4LLSA 4HD1A 4RXAA 3V1VA 3WCBA 1V4KA 2ONGA 3LGKA 5IK9A 4EA1A 3EZ3A 3N6KF 3RBMA 3WCHA 4MC3A 3QKCA 3VJ8A 3LDWA 2ZCQA 3OYRA 4KVWA 4JXYA 2Z4VA 1YV5A 3BNXA 2F8CF 2Z78A 5CG6A 3AQBB 1VG4A 3PKOA 3VJBA 5HN8A 5DJVF 2PS5A 3ICNA 4RXDA 5ERMA 5B0MA 2AETA 2EWGA 1HXCA 1N1ZA 2F94F 3KRCB 3MAVA 5A0IA 3WEFA 1KIZA 2Z7HA 3ZMCA 4OKZA 5CG5A 2AEKA 1YHMA 1RQIA 2Z7IA 2Z4WA 5DJRF 4H5EF 3LZ9A 4LA6A 3KROB 2FTZA 3OABA 2AZJA 2Z50A 3LMDA 2ONHA 4H5DF 4JVJF 4Q23A 3VJCA 3KBKA 2J5CA 3N49F 1YYRA 3TFPA 4NKEA 2ZEVA 2F7MF 5HN9A 2E8VA 3LG5A 3LK5A 3ICKA 3Q30A 3RMGA 3RYEA 1V4IA 3N45F 4NUAA 4P0WA 2PS7A 2E8TA 1WL2A 4LA5A 4LFVF 4UMJA 3WEGA 4KUXA 3OACA 2E8XA 2AZKA 3KRCA 3M01A 5DHIA 3MZVA 1N24A 2Z4YA 4LZCA 4KQUA 5IK6A 3PYAA 4KQSA 5IKAA 4LUUA 4H5CF 4EA0A 4LOBA 3KROA 4FP4A 1YYSA 3CKEA 3LJIA 2E94A 3P5PA 5ILDA 4L2XF 3KRPB 3WCLA 3LSNA 1YYUA 3N1VF 3ADZA 5E8KA 2ZCOA 3ID0A 1WY0A 5IM1A 3P8LA 3LEEA 5A0JA 3B7LA 2H8OA 5ERNA 3PDEA 3TC1A 4LIXA 2OA6A 5ER8A 1YHLA 1VG2A 4WK5A 3VJ9A 4PVYF 3TS7A 2ZCSA 3BNYA 1N20A 1FPSA 4JZBA 5JV1F 3Q2ZA 5ILJA 4QXSF 1EZFA 5B01A 1V4EA 4LTVA 3V1XA 4KVIA 2PS4A 5DJPF 4DWBA 3AQCB 5B0KA 3RYWA 3NPRA 3M00A 5AFXA 3NF2A 5DGSF 5C05A 1WL1A 2DH4A 3SDUA 3UCAA 1RTRA 5EROA 3KRPA 4E9UA 4KPJA 3OACB 2ZY1A 4LFEA 2Z4XA 3P8RA 2AELA 5JV2F 2E91A 5DW7A 3WCCA 4NFKF 1JFAA 5E8LA 4OGUA 3WCFA 1HM4A 3WEJA 4JZXA 5EAUA 3VJAA 3WCDA 3N0GA 3WCEA 5JUZF 4NKFA 1HM7A 1VG6A 4KWDA 1YYQA 2Q9YA 4QPFA 5ILIA 3ZL6A 1N1BA 3S4JA 2FORA 3PYBA 5KSXF 4E1EA 5B02A 4NFIF 4N9UA 5AYPA 3KRAB 4KVYA 4OMHA 5IL3A 5E8HA 3ICZA 3Q2QA 3CP6A 2VF6A 1WL0A 5IL8A 4NFJF 3LOMA 2E8WA 4DI5A 3N0FA 1RQJA 5JV0F 4DEMF 2E95A 2E93A 2F92F 5DGMF 3DYHA 1UBVA 5IVGA 1YJ4A 5HNAA 4DZWA 4DHDA 3ZMBA 5DIQF 4KPDA 3APZA 3LLWA 4LZ3A 3KB9A 3WEKA 3WCJA 4LPHF 4P0VA 1YYTA 3ACWA 5ILYA 3N1WF 2J1PA 5B0IA 5AHUB 4GAXA 4KKMA 1HX9A 2E90A 1DI1A 3KRAA 2PS8A 4OMGA 4MC0A 3NRIA 4F6VA 4KK2A 4F62A 4NG6A 1WL3A 3IBAA 1WKZA 1HXGA 5IK0A 3WE9A 1WMWA 4LFGA 2O1OA 4LXWA 1HXAA 4PVXF 5DGNF 2F9KF 4K10A 4RXEA 4GP2A 3ZOUA 2Z52A 3WEHA 3EGTA 2PS6A 3WCMA 2ZCRA 2OPNA 2E8UA 1UBXA 3P5RA 4F6XA 3WC9A 3ASXA 3DYGA 1YHKA 4E9ZA 3IPIA 5IN8A 3VJEA 4RYPA 5ILKA 2AZLA 4FJQA 1UBWA 4DWGA 4EA2A 3WCGA 3WJNA 5ILHA 3W7FA 1JFGA 4XQTF 3CC9A 3SDQA 2E92A 5IKHA 3QQVA 3WSAA 5EASA 4RXCA 1N23A 3LVSA 1KIYA 3SDRA 4DXJA 4MC8A 3M02A 5A0KA 2J1OA 5B03A 4LPGF 4GP1A 5I1UA 3SAEA 3LGZB 2F89F 2I19A 3ACYA 3KRFB 1ZW5A 3M0GA 5IMPA 4P0XA 2Q80A 3WEIA 4JYXA 4RNQA 3N5HF 5EATA 5DHKA 3G4DA 5DZ2A 2Q9ZA 3DYFA 4OKMA 2OPMA 3N46F 5IMNA 3N5JF 4LTZA 5IMIA 2ZEUA 5JA0F 2F8ZF 4LZ0A 1VG7A 3VJDA 1N21A 3EFQA 3ICMA 4XQRF 3TFVA 1VG3A 3WSBA 5H9DA 3WJKA 3TFNA 3Q1OA 3SDTA 3AE0A 3NPKA 1YQ7A 3AQ0A 5HN7A 3WCAA 3N3DA 3PH7A 5B0LA 4GA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9U A;  3G4F A;  4KVD A;  2P1C A;  4XQS F;  1PS1 A;  2QIS A;  1V4H A;  1V4J A;  3N3L F;  3ZCD A;  5B00 A;  1DGP A;  4KQ5 A;  4JXN A;  3KRF A;  3ACX A;  3WCI A;  5ILZ A;  1N22 A;  2E4O A;  3V66 A;  5AEL A;  2RAH A;  2Z4Z A;  3P41 A;  3WJO A;  4KFA A;  3SDV A;  2Q58 A;  3S9V A;  1UBY A;  3OAB B;  5B0J A;  4N1Z F;  2OGD A;  4LLT A;  4ZQ8 A;  4LLS A;  4HD1 A;  4RXA A;  3V1V A;  3WCB A;  1V4K A;  2ONG A;  3LGK A;  5IK9 A;  4EA1 A;  3EZ3 A;  3N6K F;  3RBM A;  3WCH A;  4MC3 A;  3QKC A;  3VJ8 A;  3LDW A;  2ZCQ A;  3OYR A;  4KVW A;  4JXY A;  2Z4V A;  1YV5 A;  3BNX A;  2F8C F;  2Z78 A;  5CG6 A;  3AQB B;  1VG4 A;  3PKO A;  3VJB A;  5HN8 A;  5DJV F;  2PS5 A;  3ICN A;  4RXD A;  5ERM A;  5B0M A;  2AET A;  2EWG A;  1HXC A;  1N1Z A;  2F94 F;  3KRC B;  3MAV A;  5A0I A;  3WEF A;  1KIZ A;  2Z7H A;  3ZMC A;  4OKZ A;  5CG5 A;  2AEK A;  1YHM A;  1RQI A;  2Z7I A;  2Z4W A;  5DJR F;  4H5E F;  3LZ9 A;  4LA6 A;  3KRO B;  2FTZ A;  3OAB A;  2AZJ A;  2Z50 A;  3LMD A;  2ONH A;  4H5D F;  4JVJ F;  4Q23 A;  3VJC A;  3KBK A;  2J5C A;  3N49 F;  1YYR A;  3TFP A;  4NKE A;  2ZEV A;  2F7M F;  5HN9 A;  2E8V A;  3LG5 A;  3LK5 A;  3ICK A;  3Q30 A;  3RMG A;  3RYE A;  1V4I A;  3N45 F;  4NUA A;  4P0W A;  2PS7 A;  2E8T A;  1WL2 A;  4LA5 A;  4LFV F;  4UMJ A;  3WEG A;  4KUX A;  3OAC A;  2E8X A;  2AZK A;  3KRC A;  3M01 A;  5DHI A;  3MZV A;  1N24 A;  2Z4Y A;  4LZC A;  4KQU A;  5IK6 A;  3PYA A;  4KQS A;  5IKA A;  4LUU A;  4H5C F;  4EA0 A;  4LOB A;  3KRO A;  4FP4 A;  1YYS A;  3CKE A;  3LJI A;  2E94 A;  3P5P A;  5ILD A;  4L2X F;  3KRP B;  3WCL A;  3LSN A;  1YYU A;  3N1V F;  3ADZ A;  5E8K A;  2ZCO A;  3ID0 A;  1WY0 A;  5IM1 A;  3P8L A;  3LEE A;  5A0J A;  3B7L A;  2H8O A;  5ERN A;  3PDE A;  3TC1 A;  4LIX A;  2OA6 A;  5ER8 A;  1YHL A;  1VG2 A;  4WK5 A;  3VJ9 A;  4PVY F;  3TS7 A;  2ZCS A;  3BNY A;  1N20 A;  1FPS A;  4JZB A;  5JV1 F;  3Q2Z A;  5ILJ A;  4QXS F;  1EZF A;  5B01 A;  1V4E A;  4LTV A;  3V1X A;  4KVI A;  2PS4 A;  5DJP F;  4DWB A;  3AQC B;  5B0K A;  3RYW A;  3NPR A;  3M00 A;  5AFX A;  3NF2 A;  5DGS F;  5C05 A;  1WL1 A;  2DH4 A;  3SDU A;  3UCA A;  1RTR A;  5ERO A;  3KRP A;  4E9U A;  4KPJ A;  3OAC B;  2ZY1 A;  4LFE A;  2Z4X A;  3P8R A;  2AEL A;  5JV2 F;  2E91 A;  5DW7 A;  3WCC A;  4NFK F;  1JFA A;  5E8L A;  4OGU A;  3WCF A;  1HM4 A;  3WEJ A;  4JZX A;  5EAU A;  3VJA A;  3WCD A;  3N0G A;  3WCE A;  5JUZ F;  4NKF A;  1HM7 A;  1VG6 A;  4KWD A;  1YYQ A;  2Q9Y A;  4QPF A;  5ILI A;  3ZL6 A;  1N1B A;  3S4J A;  2FOR A;  3PYB A;  5KSX F;  4E1E A;  5B02 A;  4NFI F;  4N9U A;  5AYP A;  3KRA B;  4KVY A;  4OMH A;  5IL3 A;  5E8H A;  3ICZ A;  3Q2Q A;  3CP6 A;  2VF6 A;  1WL0 A;  5IL8 A;  4NFJ F;  3LOM A;  2E8W A;  4DI5 A;  3N0F A;  1RQJ A;  5JV0 F;  4DEM F;  2E95 A;  2E93 A;  2F92 F;  5DGM F;  3DYH A;  1UBV A;  5IVG A;  1YJ4 A;  5HNA A;  4DZW A;  4DHD A;  3ZMB A;  5DIQ F;  4KPD A;  3APZ A;  3LLW A;  4LZ3 A;  3KB9 A;  3WEK A;  3WCJ A;  4LPH F;  4P0V A;  1YYT A;  3ACW A;  5ILY A;  3N1W F;  2J1P A;  5B0I A;  5AHU B;  4GAX A;  4KKM A;  1HX9 A;  2E90 A;  1DI1 A;  3KRA A;  2PS8 A;  4OMG A;  4MC0 A;  3NRI A;  4F6V A;  4KK2 A;  4F62 A;  4NG6 A;  1WL3 A;  3IBA A;  1WKZ A;  1HXG A;  5IK0 A;  3WE9 A;  1WMW A;  4LFG A;  2O1O A;  4LXW A;  1HXA A;  4PVX F;  5DGN F;  2F9K F;  4K10 A;  4RXE A;  4GP2 A;  3ZOU A;  2Z52 A;  3WEH A;  3EGT A;  2PS6 A;  3WCM A;  2ZCR A;  2OPN A;  2E8U A;  1UBX A;  3P5R A;  4F6X A;  3WC9 A;  3ASX A;  3DYG A;  1YHK A;  4E9Z A;  3IPI A;  5IN8 A;  3VJE A;  4RYP A;  5ILK A;  2AZL A;  4FJQ A;  1UBW A;  4DWG A;  4EA2 A;  3WCG A;  3WJN A;  5ILH A;  3W7F A;  1JFG A;  4XQT F;  3CC9 A;  3SDQ A;  2E92 A;  5IKH A;  3QQV A;  3WSA A;  5EAS A;  4RXC A;  1N23 A;  3LVS A;  1KIY A;  3SDR A;  4DXJ A;  4MC8 A;  3M02 A;  5A0K A;  2J1O A;  5B03 A;  4LPG F;  4GP1 A;  5I1U A;  3SAE A;  3LGZ B;  2F89 F;  2I19 A;  3ACY A;  3KRF B;  1ZW5 A;  3M0G A;  5IMP A;  4P0X A;  2Q80 A;  3WEI A;  4JYX A;  4RNQ A;  3N5H F;  5EAT A;  5DHK A;  3G4D A;  5DZ2 A;  2Q9Z A;  3DYF A;  4OKM A;  2OPM A;  3N46 F;  5IMN A;  3N5J F;  4LTZ A;  5IMI A;  2ZEU A;  5JA0 F;  2F8Z F;  4LZ0 A;  1VG7 A;  3VJD A;  1N21 A;  3EFQ A;  3ICM A;  4XQR F;  3TFV A;  1VG3 A;  3WSB A;  5H9D A;  3WJK A;  3TFN A;  3Q1O A;  3SDT A;  3AE0 A;  3NPK A;  1YQ7 A;  3AQ0 A;  5HN7 A;  3WCA A;  3N3D A;  3PH7 A;  5B0L A;  4GA3 A; 
#chains in the Genus database with same CATH topology
 3M9U A;  3G4F A;  4KVD A;  2P1C A;  4XQS F;  1PS1 A;  2QIS A;  1V4H A;  1V4J A;  3N3L F;  3ZCD A;  5B00 A;  1DGP A;  4KQ5 A;  4JXN A;  3KRF A;  3ACX A;  3WCI A;  5ILZ A;  1N22 A;  2E4O A;  3V66 A;  5AEL A;  2RAH A;  2Z4Z A;  3P41 A;  3WJO A;  4KFA A;  3SDV A;  2Q58 A;  3S9V A;  1UBY A;  3OAB B;  5B0J A;  4N1Z F;  2OGD A;  4LLT A;  4ZQ8 A;  4LLS A;  4HD1 A;  4RXA A;  3V1V A;  3WCB A;  1V4K A;  2ONG A;  3LGK A;  5IK9 A;  4EA1 A;  3EZ3 A;  3N6K F;  3RBM A;  3WCH A;  4MC3 A;  3QKC A;  3VJ8 A;  3LDW A;  2ZCQ A;  3OYR A;  4KVW A;  4JXY A;  2Z4V A;  1YV5 A;  3BNX A;  2F8C F;  2Z78 A;  5CG6 A;  3AQB B;  1VG4 A;  3PKO A;  3VJB A;  5HN8 A;  5DJV F;  2PS5 A;  3ICN A;  4RXD A;  5ERM A;  5B0M A;  2AET A;  2EWG A;  1HXC A;  1N1Z A;  2F94 F;  3KRC B;  3MAV A;  5A0I A;  3WEF A;  1KIZ A;  2Z7H A;  3ZMC A;  4OKZ A;  5CG5 A;  2AEK A;  1YHM A;  1RQI A;  2Z7I A;  2Z4W A;  5DJR F;  4H5E F;  3LZ9 A;  4LA6 A;  3KRO B;  2FTZ A;  3OAB A;  2AZJ A;  2Z50 A;  3LMD A;  2ONH A;  4H5D F;  4JVJ F;  4Q23 A;  3VJC A;  3KBK A;  2J5C A;  3N49 F;  1YYR A;  3TFP A;  4NKE A;  2ZEV A;  2F7M F;  5HN9 A;  2E8V A;  3LG5 A;  3LK5 A;  3ICK A;  3Q30 A;  3RMG A;  3RYE A;  1V4I A;  3N45 F;  4NUA A;  4P0W A;  2PS7 A;  2E8T A;  1WL2 A;  4LA5 A;  4LFV F;  4UMJ A;  3WEG A;  4KUX A;  3OAC A;  2E8X A;  2AZK A;  3KRC A;  3M01 A;  5DHI A;  3MZV A;  1N24 A;  2Z4Y A;  4LZC A;  4KQU A;  5IK6 A;  3PYA A;  4KQS A;  5IKA A;  4LUU A;  4H5C F;  4EA0 A;  4LOB A;  3KRO A;  4FP4 A;  1YYS A;  3CKE A;  3LJI A;  2E94 A;  3P5P A;  5ILD A;  4L2X F;  3KRP B;  3WCL A;  3LSN A;  1YYU A;  3N1V F;  3ADZ A;  5E8K A;  2ZCO A;  3ID0 A;  1WY0 A;  5IM1 A;  3P8L A;  3LEE A;  5A0J A;  3B7L A;  2H8O A;  5ERN A;  3PDE A;  3TC1 A;  4LIX A;  2OA6 A;  5ER8 A;  1YHL A;  1VG2 A;  4WK5 A;  3VJ9 A;  4PVY F;  3TS7 A;  2ZCS A;  3BNY A;  1N20 A;  1FPS A;  4JZB A;  5JV1 F;  3Q2Z A;  5ILJ A;  4QXS F;  1EZF A;  5B01 A;  1V4E A;  4LTV A;  3V1X A;  4KVI A;  2PS4 A;  5DJP F;  4DWB A;  3AQC B;  5B0K A;  3RYW A;  3NPR A;  3M00 A;  5AFX A;  3NF2 A;  5DGS F;  5C05 A;  1WL1 A;  2DH4 A;  3SDU A;  3UCA A;  1RTR A;  5ERO A;  3KRP A;  4E9U A;  4KPJ A;  3OAC B;  2ZY1 A;  4LFE A;  2Z4X A;  3P8R A;  2AEL A;  5JV2 F;  2E91 A;  5DW7 A;  3WCC A;  4NFK F;  1JFA A;  5E8L A;  4OGU A;  3WCF A;  1HM4 A;  3WEJ A;  4JZX A;  5EAU A;  3VJA A;  3WCD A;  3N0G A;  3WCE A;  5JUZ F;  4NKF A;  1HM7 A;  1VG6 A;  4KWD A;  1YYQ A;  2Q9Y A;  4QPF A;  5ILI A;  3ZL6 A;  1N1B A;  3S4J A;  2FOR A;  3PYB A;  5KSX F;  4E1E A;  5B02 A;  4NFI F;  4N9U A;  5AYP A;  3KRA B;  4KVY A;  4OMH A;  5IL3 A;  5E8H A;  3ICZ A;  3Q2Q A;  3CP6 A;  2VF6 A;  1WL0 A;  5IL8 A;  4NFJ F;  3LOM A;  2E8W A;  4DI5 A;  3N0F A;  1RQJ A;  5JV0 F;  4DEM F;  2E95 A;  2E93 A;  2F92 F;  5DGM F;  3DYH A;  1UBV A;  5IVG A;  1YJ4 A;  5HNA A;  4DZW A;  4DHD A;  3ZMB A;  5DIQ F;  4KPD A;  3APZ A;  3LLW A;  4LZ3 A;  3KB9 A;  3WEK A;  3WCJ A;  4LPH F;  4P0V A;  1YYT A;  3ACW A;  5ILY A;  3N1W F;  2J1P A;  5B0I A;  5AHU B;  4GAX A;  4KKM A;  1HX9 A;  2E90 A;  1DI1 A;  3KRA A;  2PS8 A;  4OMG A;  4MC0 A;  3NRI A;  4F6V A;  4KK2 A;  4F62 A;  4NG6 A;  1WL3 A;  3IBA A;  1WKZ A;  1HXG A;  5IK0 A;  3WE9 A;  1WMW A;  4LFG A;  2O1O A;  4LXW A;  1HXA A;  4PVX F;  5DGN F;  2F9K F;  4K10 A;  4RXE A;  4GP2 A;  3ZOU A;  2Z52 A;  3WEH A;  3EGT A;  2PS6 A;  3WCM A;  2ZCR A;  2OPN A;  2E8U A;  1UBX A;  3P5R A;  4F6X A;  3WC9 A;  3ASX A;  3DYG A;  1YHK A;  4E9Z A;  3IPI A;  5IN8 A;  3VJE A;  4RYP A;  5ILK A;  2AZL A;  4FJQ A;  1UBW A;  4DWG A;  4EA2 A;  3WCG A;  3WJN A;  5ILH A;  3W7F A;  1JFG A;  4XQT F;  3CC9 A;  3SDQ A;  2E92 A;  5IKH A;  3QQV A;  3WSA A;  5EAS A;  4RXC A;  1N23 A;  3LVS A;  1KIY A;  3SDR A;  4DXJ A;  4MC8 A;  3M02 A;  5A0K A;  2J1O A;  5B03 A;  4LPG F;  4GP1 A;  5I1U A;  3SAE A;  3LGZ B;  2F89 F;  2I19 A;  3ACY A;  3KRF B;  1ZW5 A;  3M0G A;  5IMP A;  4P0X A;  2Q80 A;  3WEI A;  4JYX A;  4RNQ A;  3N5H F;  5EAT A;  5DHK A;  3G4D A;  5DZ2 A;  2Q9Z A;  3DYF A;  4OKM A;  2OPM A;  3N46 F;  5IMN A;  3N5J F;  4LTZ A;  5IMI A;  2ZEU A;  5JA0 F;  2F8Z F;  4LZ0 A;  1VG7 A;  3VJD A;  1N21 A;  3EFQ A;  3ICM A;  4XQR F;  3TFV A;  1VG3 A;  3WSB A;  5H9D A;  3WJK A;  3TFN A;  3Q1O A;  3SDT A;  3AE0 A;  3NPK A;  1YQ7 A;  3AQ0 A;  5HN7 A;  3WCA A;  3N3D A;  3PH7 A;  5B0L A;  4GA3 A; 
#chains in the Genus database with same CATH homology
 3M9U A;  3G4F A;  4KVD A;  2P1C A;  4XQS F;  1PS1 A;  2QIS A;  1V4H A;  1V4J A;  3N3L F;  3ZCD A;  5B00 A;  1DGP A;  4KQ5 A;  4JXN A;  3KRF A;  3ACX A;  3WCI A;  5ILZ A;  1N22 A;  2E4O A;  3V66 A;  5AEL A;  2RAH A;  2Z4Z A;  3P41 A;  3WJO A;  4KFA A;  3SDV A;  2Q58 A;  3S9V A;  1UBY A;  3OAB B;  5B0J A;  4N1Z F;  2OGD A;  4LLT A;  4ZQ8 A;  4LLS A;  4HD1 A;  4RXA A;  3V1V A;  3WCB A;  1V4K A;  2ONG A;  3LGK A;  5IK9 A;  4EA1 A;  3EZ3 A;  3N6K F;  3RBM A;  3WCH A;  4MC3 A;  3QKC A;  3VJ8 A;  3LDW A;  2ZCQ A;  3OYR A;  4KVW A;  4JXY A;  2Z4V A;  1YV5 A;  3BNX A;  2F8C F;  2Z78 A;  5CG6 A;  3AQB B;  1VG4 A;  3PKO A;  3VJB A;  5HN8 A;  5DJV F;  2PS5 A;  3ICN A;  4RXD A;  5ERM A;  5B0M A;  2AET A;  2EWG A;  1HXC A;  1N1Z A;  2F94 F;  3KRC B;  3MAV A;  5A0I A;  3WEF A;  1KIZ A;  2Z7H A;  3ZMC A;  4OKZ A;  5CG5 A;  2AEK A;  1YHM A;  1RQI A;  2Z7I A;  2Z4W A;  5DJR F;  4H5E F;  3LZ9 A;  4LA6 A;  3KRO B;  2FTZ A;  3OAB A;  2AZJ A;  2Z50 A;  3LMD A;  2ONH A;  4H5D F;  4JVJ F;  4Q23 A;  3VJC A;  3KBK A;  2J5C A;  3N49 F;  1YYR A;  3TFP A;  4NKE A;  2ZEV A;  2F7M F;  5HN9 A;  2E8V A;  3LG5 A;  3LK5 A;  3ICK A;  3Q30 A;  3RMG A;  3RYE A;  1V4I A;  3N45 F;  4NUA A;  4P0W A;  2PS7 A;  2E8T A;  1WL2 A;  4LA5 A;  4LFV F;  4UMJ A;  3WEG A;  4KUX A;  3OAC A;  2E8X A;  2AZK A;  3KRC A;  3M01 A;  5DHI A;  3MZV A;  1N24 A;  2Z4Y A;  4LZC A;  4KQU A;  5IK6 A;  3PYA A;  4KQS A;  5IKA A;  4LUU A;  4H5C F;  4EA0 A;  4LOB A;  3KRO A;  4FP4 A;  1YYS A;  3CKE A;  3LJI A;  2E94 A;  3P5P A;  5ILD A;  4L2X F;  3KRP B;  3WCL A;  3LSN A;  1YYU A;  3N1V F;  3ADZ A;  5E8K A;  2ZCO A;  3ID0 A;  1WY0 A;  5IM1 A;  3P8L A;  3LEE A;  5A0J A;  3B7L A;  2H8O A;  5ERN A;  3PDE A;  3TC1 A;  4LIX A;  2OA6 A;  5ER8 A;  1YHL A;  1VG2 A;  4WK5 A;  3VJ9 A;  4PVY F;  3TS7 A;  2ZCS A;  3BNY A;  1N20 A;  1FPS A;  4JZB A;  5JV1 F;  3Q2Z A;  5ILJ A;  4QXS F;  1EZF A;  5B01 A;  1V4E A;  4LTV A;  3V1X A;  4KVI A;  2PS4 A;  5DJP F;  4DWB A;  3AQC B;  5B0K A;  3RYW A;  3NPR A;  3M00 A;  5AFX A;  3NF2 A;  5DGS F;  5C05 A;  1WL1 A;  2DH4 A;  3SDU A;  3UCA A;  1RTR A;  5ERO A;  3KRP A;  4E9U A;  4KPJ A;  3OAC B;  2ZY1 A;  4LFE A;  2Z4X A;  3P8R A;  2AEL A;  5JV2 F;  2E91 A;  5DW7 A;  3WCC A;  4NFK F;  1JFA A;  5E8L A;  4OGU A;  3WCF A;  1HM4 A;  3WEJ A;  4JZX A;  5EAU A;  3VJA A;  3WCD A;  3N0G A;  3WCE A;  5JUZ F;  4NKF A;  1HM7 A;  1VG6 A;  4KWD A;  1YYQ A;  2Q9Y A;  4QPF A;  5ILI A;  3ZL6 A;  1N1B A;  3S4J A;  2FOR A;  3PYB A;  5KSX F;  4E1E A;  5B02 A;  4NFI F;  4N9U A;  5AYP A;  3KRA B;  4KVY A;  4OMH A;  5IL3 A;  5E8H A;  3ICZ A;  3Q2Q A;  3CP6 A;  2VF6 A;  1WL0 A;  5IL8 A;  4NFJ F;  3LOM A;  2E8W A;  4DI5 A;  3N0F A;  1RQJ A;  5JV0 F;  4DEM F;  2E95 A;  2E93 A;  2F92 F;  5DGM F;  3DYH A;  1UBV A;  5IVG A;  1YJ4 A;  5HNA A;  4DZW A;  4DHD A;  3ZMB A;  5DIQ F;  4KPD A;  3APZ A;  3LLW A;  4LZ3 A;  3KB9 A;  3WEK A;  3WCJ A;  4LPH F;  4P0V A;  1YYT A;  3ACW A;  5ILY A;  3N1W F;  2J1P A;  5B0I A;  5AHU B;  4GAX A;  4KKM A;  1HX9 A;  2E90 A;  1DI1 A;  3KRA A;  2PS8 A;  4OMG A;  4MC0 A;  3NRI A;  4F6V A;  4KK2 A;  4F62 A;  4NG6 A;  1WL3 A;  3IBA A;  1WKZ A;  1HXG A;  5IK0 A;  3WE9 A;  1WMW A;  4LFG A;  2O1O A;  4LXW A;  1HXA A;  4PVX F;  5DGN F;  2F9K F;  4K10 A;  4RXE A;  4GP2 A;  3ZOU A;  2Z52 A;  3WEH A;  3EGT A;  2PS6 A;  3WCM A;  2ZCR A;  2OPN A;  2E8U A;  1UBX A;  3P5R A;  4F6X A;  3WC9 A;  3ASX A;  3DYG A;  1YHK A;  4E9Z A;  3IPI A;  5IN8 A;  3VJE A;  4RYP A;  5ILK A;  2AZL A;  4FJQ A;  1UBW A;  4DWG A;  4EA2 A;  3WCG A;  3WJN A;  5ILH A;  3W7F A;  1JFG A;  4XQT F;  3CC9 A;  3SDQ A;  2E92 A;  5IKH A;  3QQV A;  3WSA A;  5EAS A;  4RXC A;  1N23 A;  3LVS A;  1KIY A;  3SDR A;  4DXJ A;  4MC8 A;  3M02 A;  5A0K A;  2J1O A;  5B03 A;  4LPG F;  4GP1 A;  5I1U A;  3SAE A;  3LGZ B;  2F89 F;  2I19 A;  3ACY A;  3KRF B;  1ZW5 A;  3M0G A;  5IMP A;  4P0X A;  2Q80 A;  3WEI A;  4JYX A;  4RNQ A;  3N5H F;  5EAT A;  5DHK A;  3G4D A;  5DZ2 A;  2Q9Z A;  3DYF A;  4OKM A;  2OPM A;  3N46 F;  5IMN A;  3N5J F;  4LTZ A;  5IMI A;  2ZEU A;  5JA0 F;  2F8Z F;  4LZ0 A;  1VG7 A;  3VJD A;  1N21 A;  3EFQ A;  3ICM A;  4XQR F;  3TFV A;  1VG3 A;  3WSB A;  5H9D A;  3WJK A;  3TFN A;  3Q1O A;  3SDT A;  3AE0 A;  3NPK A;  1YQ7 A;  3AQ0 A;  5HN7 A;  3WCA A;  3N3D A;  3PH7 A;  5B0L A;  4GA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...