3OACB

Mint deletion mutant of heterotetrameric geranyl pyrophosphate synthase in complex with ligands
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
248
structure length
248
Chain Sequence
QPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTFAAPATAASTLCLAACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLPPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIEISRAGGPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYGEMHACGAACGAILGGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQLIDENIIGKLKELALEELGGFHGKNAELMSSLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranyl diphosphate synthase large subunit
publication title Enhanced specificity of mint geranyl pyrophosphate synthase by modifying the R-loop interactions
pubmed doi rcsb
source organism Mentha x piperita
molecule tags Transferase
total genus 92
structure length 248
sequence length 248
chains with identical sequence C
ec nomenclature ec 2.5.1.1: Dimethylallyltranstransferase.
pdb deposition date 2010-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3oacB00
5HN9A 1UBWA 2AEKA 3VJEA 5AHUB 5ERNA 4LTVA 4NFIF 1YYQA 2ZCSA 1RQIA 3EZ3A 2P1CA 2Z52A 3ICNA 4LLTA 3LGKA 1UBXA 5B0LA 1V4KA 5B0MA 4XQRF 2E8WA 5IK6A 3WEFA 5JV1F 4PVYF 4OKZA 1VG6A 3LMDA 4XQTF 3ZCDA 4MC8A 4K10A 4F6XA 3KRPB 5A0KA 2E93A 2E91A 2E8VA 3WCFA 3N3LF 5ILDA 1HXGA 3WEGA 4KPJA 3WCAA 5IK9A 3M0GA 1PS1A 2E95A 3KRFA 5A0IA 5E8LA 3SDTA 1WKZA 4KKMA 5AFXA 3SDRA 5CG5A 4MC0A 5DIQF 3VJBA 3DYFA 4UMJA 3WJOA 1DI1A 4JVJF 3WCDA 2AZLA 2VF6A 3LSNA 5DGSF 3AQBB 5IM1A 4KVDA 2PS5A 4LZCA 5B01A 4DI5A 3M00A 5IL8A 3Q1OA 4E9UA 4ZQ8A 4H5EF 3LEEA 2ZY1A 2J1PA 4LZ3A 2ZCQA 4LTZA 4Q23A 4NG6A 3WSBA 3NPKA 3N46F 5JA0F 3WEJA 3Q2QA 4GAXA 5ILIA 4OGUA 3CC9A 2QISA 3P41A 4LA6A 5DJPF 2Q9YA 4LZ0A 4RYPA 2ZEUA 2PS4A 3OABA 4QXSF 1YYSA 4L2XF 2PS6A 5B03A 3LZ9A 1JFGA 1YHLA 1EZFA 3N6KF 3EFQA 4EA1A 3G4FA 4NFJF 4LA5A 3PYAA 3ACYA 4KPDA 1N22A 3G4DA 4E1EA 2Z4YA 3AE0A 5EAUA 1DGPA 1YJ4A 5IVGA 3N45F 5DJVF 3TFNA 4KQ5A 2J5CA 1WL2A 2ZCOA 3WE9A 4GA3A 1YQ7A 3WCEA 4E9ZA 5B02A 2E92A 3LK5A 3APZA 1WMWA 3N0FA 4DEMF 3TFVA 1KIZA 4P0XA 4DXJA 2F89F 3M01A 2Z7IA 5DW7A 3AQ0A 3B7LA 2E8UA 3KB9A 3WCBA 2H8OA 4KVWA 4P0WA 5AYPA 5IN8A 4LOBA 1HM4A 3WEKA 5I1UA 1UBYA 2FORA 1V4HA 4LXWA 1HM7A 3ZL6A 3WCHA 3OABB 2AELA 2E90A 1YYTA 3RYEA 1N1ZA 1N21A 2DH4A 4KQUA 1FPSA 3TS7A 4DHDA 2OPNA 4OMHA 3KRAB 3NRIA 3PKOA 3S9VA 5HN7A 1WL1A 4GP2A 3UCAA 2F7MF 3ID0A 4FP4A 3W7FA 1YYRA 3NPRA 4NKEA 4P0VA 3N1WF 3N0GA 1UBVA 4LFVF 1VG4A 3VJCA 5B0JA 2OGDA 4JZXA 2Q9ZA 3DYGA 5IK0A 5JV2F 5JUZF 3ICMA 4JXYA 2Z50A 1VG7A 5HN8A 3WJNA 2Z4XA 3Q30A 3ASXA 3RMGA 3RYWA 3LLWA 5B0KA 4MC3A 5ILJA 4LLSA 1KIYA 3N5JF 1V4JA 5H9DA 2Z4WA 3ACXA 3WCMA 3VJAA 5DZ2A 5E8KA 4LIXA 2E94A 4OMGA 3PH7A 1JFAA 3OACA 1WL3A 1ZW5A 4DZWA 3SDVA 3WCIA 3AQCB 2J1OA 4KFAA 5IKHA 3V1XA 3KRAA 2ZEVA 3ZMBA 3IPIA 3KRCA 3IBAA 3KROA 3Q2ZA 5IMIA 4NUAA 4KK2A 5ILZA 4RXEA 3ICKA 5C05A 5ER8A 2E8TA 3SDQA 5JV0F 2AETA 3N5HF 2PS7A 4JYXA 5DGMF 4EA0A 4H5DF 4KUXA 5ILHA 2Z4ZA 5CG6A 3WC9A 3OYRA 4WK5A 5ERMA 3ACWA 2E4OA 2OPMA 1V4IA 2E8XA 5B00A 2RAHA 2Q80A 3VJDA 4RNQA 1VG3A 1YV5A 2AZKA 4H5CF 5EATA 5E8HA 4RXDA 3LGZB 1HXCA 5IMPA 3LG5A 2F8ZF 3VJ8A 5DHIA 1V4EA 2Z4VA 3MAVA 3CKEA 2OA6A 2F92F 1HX9A 3SAEA 2Z78A 4KVIA 5ILYA 3RBMA 4PVXF 3BNXA 5ILKA 5IMNA 1YHKA 3TFPA 3ADZA 3V66A 5KSXF 3WEHA 1YHMA 3OACB 3QKCA 4NFKF 4HD1A 3MZVA 5EASA 3EGTA 2FTZA 3LJIA 3NF2A 4RXCA 3V1VA 5AELA 1WL0A 1N24A 3PYBA 3QQVA 3VJ9A 3KRCB 3KROB 3WCJA 3LOMA 3PDEA 3P5RA 4KQSA 3LDWA 1RQJA 4RXAA 4FJQA 3WEIA 3TC1A 3M9UA 4LFGA 3WJKA 3N49F 4LPHF 4JZBA 1RTRA 1HXAA 3WCGA 4LUUA 5EROA 3KBKA 2I19A 3ICZA 2ONHA 2EWGA 3DYHA 3BNYA 2Z7HA 2F9KF 5IL3A 1N20A 4EA2A 4NKFA 1N1BA 5IKAA 3N1VF 1VG2A 5DHKA 4GP1A 3P5PA 2PS8A 4QPFA 3WCLA 4LFEA 2F8CF 1N23A 4DWBA 3LVSA 5B0IA 3WCCA 4F6VA 5DJRF 3P8RA 3CP6A 3KRPA 5HNAA 3N3DA 4KVYA 4F62A 1WY0A 3ZMCA 3M02A 4DWGA 2ZCRA 3S4JA 4KWDA 4N1ZF 4OKMA 3SDUA 2AZJA 4N9UA 2F94F 5A0JA 4LPGF 4JXNA 3P8LA 3KRFB 2Q58A 1YYUA 3WSAA 2ONGA 5DGNF 2O1OA 3ZOUA 4XQSF
chains in the Genus database with same CATH superfamily
5HN9A 1UBWA 2AEKA 3VJEA 5AHUB 5ERNA 4LTVA 4NFIF 1YYQA 2ZCSA 1RQIA 3EZ3A 2P1CA 2Z52A 3ICNA 4LLTA 3LGKA 1UBXA 5B0LA 1V4KA 5B0MA 4XQRF 2E8WA 5IK6A 3WEFA 5JV1F 4PVYF 4OKZA 1VG6A 3LMDA 4XQTF 3ZCDA 4MC8A 4K10A 4F6XA 3KRPB 5A0KA 2E93A 2E91A 2E8VA 3WCFA 3N3LF 5ILDA 1HXGA 3WEGA 4KPJA 3WCAA 5IK9A 3M0GA 1PS1A 2E95A 3KRFA 5A0IA 5E8LA 3SDTA 1WKZA 4KKMA 5AFXA 3SDRA 5CG5A 4MC0A 5DIQF 3VJBA 3DYFA 4UMJA 3WJOA 1DI1A 4JVJF 3WCDA 2AZLA 2VF6A 3LSNA 5DGSF 3AQBB 5IM1A 4KVDA 2PS5A 4LZCA 5B01A 4DI5A 3M00A 5IL8A 3Q1OA 4E9UA 4ZQ8A 4H5EF 3LEEA 2ZY1A 2J1PA 4LZ3A 2ZCQA 4LTZA 4Q23A 4NG6A 3WSBA 3NPKA 3N46F 5JA0F 3WEJA 3Q2QA 4GAXA 5ILIA 4OGUA 3CC9A 2QISA 3P41A 4LA6A 5DJPF 2Q9YA 4LZ0A 4RYPA 2ZEUA 2PS4A 3OABA 4QXSF 1YYSA 4L2XF 2PS6A 5B03A 3LZ9A 1JFGA 1YHLA 1EZFA 3N6KF 3EFQA 4EA1A 3G4FA 4NFJF 4LA5A 3PYAA 3ACYA 4KPDA 1N22A 3G4DA 4E1EA 2Z4YA 3AE0A 5EAUA 1DGPA 1YJ4A 5IVGA 3N45F 5DJVF 3TFNA 4KQ5A 2J5CA 1WL2A 2ZCOA 3WE9A 4GA3A 1YQ7A 3WCEA 4E9ZA 5B02A 2E92A 3LK5A 3APZA 1WMWA 3N0FA 4DEMF 3TFVA 1KIZA 4P0XA 4DXJA 2F89F 3M01A 2Z7IA 5DW7A 3AQ0A 3B7LA 2E8UA 3KB9A 3WCBA 2H8OA 4KVWA 4P0WA 5AYPA 5IN8A 4LOBA 1HM4A 3WEKA 5I1UA 1UBYA 2FORA 1V4HA 4LXWA 1HM7A 3ZL6A 3WCHA 3OABB 2AELA 2E90A 1YYTA 3RYEA 1N1ZA 1N21A 2DH4A 4KQUA 1FPSA 3TS7A 4DHDA 2OPNA 4OMHA 3KRAB 3NRIA 3PKOA 3S9VA 5HN7A 1WL1A 4GP2A 3UCAA 2F7MF 3ID0A 4FP4A 3W7FA 1YYRA 3NPRA 4NKEA 4P0VA 3N1WF 3N0GA 1UBVA 4LFVF 1VG4A 3VJCA 5B0JA 2OGDA 4JZXA 2Q9ZA 3DYGA 5IK0A 5JV2F 5JUZF 3ICMA 4JXYA 2Z50A 1VG7A 5HN8A 3WJNA 2Z4XA 3Q30A 3ASXA 3RMGA 3RYWA 3LLWA 5B0KA 4MC3A 5ILJA 4LLSA 1KIYA 3N5JF 1V4JA 5H9DA 2Z4WA 3ACXA 3WCMA 3VJAA 5DZ2A 5E8KA 4LIXA 2E94A 4OMGA 3PH7A 1JFAA 3OACA 1WL3A 1ZW5A 4DZWA 3SDVA 3WCIA 3AQCB 2J1OA 4KFAA 5IKHA 3V1XA 3KRAA 2ZEVA 3ZMBA 3IPIA 3KRCA 3IBAA 3KROA 3Q2ZA 5IMIA 4NUAA 4KK2A 5ILZA 4RXEA 3ICKA 5C05A 5ER8A 2E8TA 3SDQA 5JV0F 2AETA 3N5HF 2PS7A 4JYXA 5DGMF 4EA0A 4H5DF 4KUXA 5ILHA 2Z4ZA 5CG6A 3WC9A 3OYRA 4WK5A 5ERMA 3ACWA 2E4OA 2OPMA 1V4IA 2E8XA 5B00A 2RAHA 2Q80A 3VJDA 4RNQA 1VG3A 1YV5A 2AZKA 4H5CF 5EATA 5E8HA 4RXDA 3LGZB 1HXCA 5IMPA 3LG5A 2F8ZF 3VJ8A 5DHIA 1V4EA 2Z4VA 3MAVA 3CKEA 2OA6A 2F92F 1HX9A 3SAEA 2Z78A 4KVIA 5ILYA 3RBMA 4PVXF 3BNXA 5ILKA 5IMNA 1YHKA 3TFPA 3ADZA 3V66A 5KSXF 3WEHA 1YHMA 3OACB 3QKCA 4NFKF 4HD1A 3MZVA 5EASA 3EGTA 2FTZA 3LJIA 3NF2A 4RXCA 3V1VA 5AELA 1WL0A 1N24A 3PYBA 3QQVA 3VJ9A 3KRCB 3KROB 3WCJA 3LOMA 3PDEA 3P5RA 4KQSA 3LDWA 1RQJA 4RXAA 4FJQA 3WEIA 3TC1A 3M9UA 4LFGA 3WJKA 3N49F 4LPHF 4JZBA 1RTRA 1HXAA 3WCGA 4LUUA 5EROA 3KBKA 2I19A 3ICZA 2ONHA 2EWGA 3DYHA 3BNYA 2Z7HA 2F9KF 5IL3A 1N20A 4EA2A 4NKFA 1N1BA 5IKAA 3N1VF 1VG2A 5DHKA 4GP1A 3P5PA 2PS8A 4QPFA 3WCLA 4LFEA 2F8CF 1N23A 4DWBA 3LVSA 5B0IA 3WCCA 4F6VA 5DJRF 3P8RA 3CP6A 3KRPA 5HNAA 3N3DA 4KVYA 4F62A 1WY0A 3ZMCA 3M02A 4DWGA 2ZCRA 3S4JA 4KWDA 4N1ZF 4OKMA 3SDUA 2AZJA 4N9UA 2F94F 5A0JA 4LPGF 4JXNA 3P8LA 3KRFB 2Q58A 1YYUA 3WSAA 2ONGA 5DGNF 2O1OA 3ZOUA 4XQSF
chains in the Genus database with same CATH topology
5HN9A 1UBWA 2AEKA 3VJEA 5AHUB 5ERNA 4LTVA 4NFIF 1YYQA 2ZCSA 1RQIA 3EZ3A 2P1CA 2Z52A 3ICNA 4LLTA 3LGKA 1UBXA 5B0LA 1V4KA 5B0MA 4XQRF 2E8WA 5IK6A 3WEFA 5JV1F 4PVYF 4OKZA 1VG6A 3LMDA 4XQTF 3ZCDA 4MC8A 4K10A 4F6XA 3KRPB 5A0KA 2E93A 2E91A 2E8VA 3WCFA 3N3LF 5ILDA 1HXGA 3WEGA 4KPJA 3WCAA 5IK9A 3M0GA 1PS1A 2E95A 3KRFA 5A0IA 5E8LA 3SDTA 1WKZA 4KKMA 5AFXA 3SDRA 5CG5A 4MC0A 5DIQF 3VJBA 3DYFA 4UMJA 3WJOA 1DI1A 4JVJF 3WCDA 2AZLA 2VF6A 3LSNA 5DGSF 3AQBB 5IM1A 4KVDA 2PS5A 4LZCA 5B01A 4DI5A 3M00A 5IL8A 3Q1OA 4E9UA 4ZQ8A 4H5EF 3LEEA 2ZY1A 2J1PA 4LZ3A 2ZCQA 4LTZA 4Q23A 4NG6A 3WSBA 3NPKA 3N46F 5JA0F 3WEJA 3Q2QA 4GAXA 5ILIA 4OGUA 3CC9A 2QISA 3P41A 4LA6A 5DJPF 2Q9YA 4LZ0A 4RYPA 2ZEUA 2PS4A 3OABA 4QXSF 1YYSA 4L2XF 2PS6A 5B03A 3LZ9A 1JFGA 1YHLA 1EZFA 3N6KF 3EFQA 4EA1A 3G4FA 4NFJF 4LA5A 3PYAA 3ACYA 4KPDA 1N22A 3G4DA 4E1EA 2Z4YA 3AE0A 5EAUA 1DGPA 1YJ4A 5IVGA 3N45F 5DJVF 3TFNA 4KQ5A 2J5CA 1WL2A 2ZCOA 3WE9A 4GA3A 1YQ7A 3WCEA 4E9ZA 5B02A 2E92A 3LK5A 3APZA 1WMWA 3N0FA 4DEMF 3TFVA 1KIZA 4P0XA 4DXJA 2F89F 3M01A 2Z7IA 5DW7A 3AQ0A 3B7LA 2E8UA 3KB9A 3WCBA 2H8OA 4KVWA 4P0WA 5AYPA 5IN8A 4LOBA 1HM4A 3WEKA 5I1UA 1UBYA 2FORA 1V4HA 4LXWA 1HM7A 3ZL6A 3WCHA 3OABB 2AELA 2E90A 1YYTA 3RYEA 1N1ZA 1N21A 2DH4A 4KQUA 1FPSA 3TS7A 4DHDA 2OPNA 4OMHA 3KRAB 3NRIA 3PKOA 3S9VA 5HN7A 1WL1A 4GP2A 3UCAA 2F7MF 3ID0A 4FP4A 3W7FA 1YYRA 3NPRA 4NKEA 4P0VA 3N1WF 3N0GA 1UBVA 4LFVF 1VG4A 3VJCA 5B0JA 2OGDA 4JZXA 2Q9ZA 3DYGA 5IK0A 5JV2F 5JUZF 3ICMA 4JXYA 2Z50A 1VG7A 5HN8A 3WJNA 2Z4XA 3Q30A 3ASXA 3RMGA 3RYWA 3LLWA 5B0KA 4MC3A 5ILJA 4LLSA 1KIYA 3N5JF 1V4JA 5H9DA 2Z4WA 3ACXA 3WCMA 3VJAA 5DZ2A 5E8KA 4LIXA 2E94A 4OMGA 3PH7A 1JFAA 3OACA 1WL3A 1ZW5A 4DZWA 3SDVA 3WCIA 3AQCB 2J1OA 4KFAA 5IKHA 3V1XA 3KRAA 2ZEVA 3ZMBA 3IPIA 3KRCA 3IBAA 3KROA 3Q2ZA 5IMIA 4NUAA 4KK2A 5ILZA 4RXEA 3ICKA 5C05A 5ER8A 2E8TA 3SDQA 5JV0F 2AETA 3N5HF 2PS7A 4JYXA 5DGMF 4EA0A 4H5DF 4KUXA 5ILHA 2Z4ZA 5CG6A 3WC9A 3OYRA 4WK5A 5ERMA 3ACWA 2E4OA 2OPMA 1V4IA 2E8XA 5B00A 2RAHA 2Q80A 3VJDA 4RNQA 1VG3A 1YV5A 2AZKA 4H5CF 5EATA 5E8HA 4RXDA 3LGZB 1HXCA 5IMPA 3LG5A 2F8ZF 3VJ8A 5DHIA 1V4EA 2Z4VA 3MAVA 3CKEA 2OA6A 2F92F 1HX9A 3SAEA 2Z78A 4KVIA 5ILYA 3RBMA 4PVXF 3BNXA 5ILKA 5IMNA 1YHKA 3TFPA 3ADZA 3V66A 5KSXF 3WEHA 1YHMA 3OACB 3QKCA 4NFKF 4HD1A 3MZVA 5EASA 3EGTA 2FTZA 3LJIA 3NF2A 4RXCA 3V1VA 5AELA 1WL0A 1N24A 3PYBA 3QQVA 3VJ9A 3KRCB 3KROB 3WCJA 3LOMA 3PDEA 3P5RA 4KQSA 3LDWA 1RQJA 4RXAA 4FJQA 3WEIA 3TC1A 3M9UA 4LFGA 3WJKA 3N49F 4LPHF 4JZBA 1RTRA 1HXAA 3WCGA 4LUUA 5EROA 3KBKA 2I19A 3ICZA 2ONHA 2EWGA 3DYHA 3BNYA 2Z7HA 2F9KF 5IL3A 1N20A 4EA2A 4NKFA 1N1BA 5IKAA 3N1VF 1VG2A 5DHKA 4GP1A 3P5PA 2PS8A 4QPFA 3WCLA 4LFEA 2F8CF 1N23A 4DWBA 3LVSA 5B0IA 3WCCA 4F6VA 5DJRF 3P8RA 3CP6A 3KRPA 5HNAA 3N3DA 4KVYA 4F62A 1WY0A 3ZMCA 3M02A 4DWGA 2ZCRA 3S4JA 4KWDA 4N1ZF 4OKMA 3SDUA 2AZJA 4N9UA 2F94F 5A0JA 4LPGF 4JXNA 3P8LA 3KRFB 2Q58A 1YYUA 3WSAA 2ONGA 5DGNF 2O1OA 3ZOUA 4XQSF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HN9 A;  1UBW A;  2AEK A;  3VJE A;  5AHU B;  5ERN A;  4LTV A;  4NFI F;  1YYQ A;  2ZCS A;  1RQI A;  3EZ3 A;  2P1C A;  2Z52 A;  3ICN A;  4LLT A;  3LGK A;  1UBX A;  5B0L A;  1V4K A;  5B0M A;  4XQR F;  2E8W A;  5IK6 A;  3WEF A;  5JV1 F;  4PVY F;  4OKZ A;  1VG6 A;  3LMD A;  4XQT F;  3ZCD A;  4MC8 A;  4K10 A;  4F6X A;  3KRP B;  5A0K A;  2E93 A;  2E91 A;  2E8V A;  3WCF A;  3N3L F;  5ILD A;  1HXG A;  3WEG A;  4KPJ A;  3WCA A;  5IK9 A;  3M0G A;  1PS1 A;  2E95 A;  3KRF A;  5A0I A;  5E8L A;  3SDT A;  1WKZ A;  4KKM A;  5AFX A;  3SDR A;  5CG5 A;  4MC0 A;  5DIQ F;  3VJB A;  3DYF A;  4UMJ A;  3WJO A;  1DI1 A;  4JVJ F;  3WCD A;  2AZL A;  2VF6 A;  3LSN A;  5DGS F;  3AQB B;  5IM1 A;  4KVD A;  2PS5 A;  4LZC A;  5B01 A;  4DI5 A;  3M00 A;  5IL8 A;  3Q1O A;  4E9U A;  4ZQ8 A;  4H5E F;  3LEE A;  2ZY1 A;  2J1P A;  4LZ3 A;  2ZCQ A;  4LTZ A;  4Q23 A;  4NG6 A;  3WSB A;  3NPK A;  3N46 F;  5JA0 F;  3WEJ A;  3Q2Q A;  4GAX A;  5ILI A;  4OGU A;  3CC9 A;  2QIS A;  3P41 A;  4LA6 A;  5DJP F;  2Q9Y A;  4LZ0 A;  4RYP A;  2ZEU A;  2PS4 A;  3OAB A;  4QXS F;  1YYS A;  4L2X F;  2PS6 A;  5B03 A;  3LZ9 A;  1JFG A;  1YHL A;  1EZF A;  3N6K F;  3EFQ A;  4EA1 A;  3G4F A;  4NFJ F;  4LA5 A;  3PYA A;  3ACY A;  4KPD A;  1N22 A;  3G4D A;  4E1E A;  2Z4Y A;  3AE0 A;  5EAU A;  1DGP A;  1YJ4 A;  5IVG A;  3N45 F;  5DJV F;  3TFN A;  4KQ5 A;  2J5C A;  1WL2 A;  2ZCO A;  3WE9 A;  4GA3 A;  1YQ7 A;  3WCE A;  4E9Z A;  5B02 A;  2E92 A;  3LK5 A;  3APZ A;  1WMW A;  3N0F A;  4DEM F;  3TFV A;  1KIZ A;  4P0X A;  4DXJ A;  2F89 F;  3M01 A;  2Z7I A;  5DW7 A;  3AQ0 A;  3B7L A;  2E8U A;  3KB9 A;  3WCB A;  2H8O A;  4KVW A;  4P0W A;  5AYP A;  5IN8 A;  4LOB A;  1HM4 A;  3WEK A;  5I1U A;  1UBY A;  2FOR A;  1V4H A;  4LXW A;  1HM7 A;  3ZL6 A;  3WCH A;  3OAB B;  2AEL A;  2E90 A;  1YYT A;  3RYE A;  1N1Z A;  1N21 A;  2DH4 A;  4KQU A;  1FPS A;  3TS7 A;  4DHD A;  2OPN A;  4OMH A;  3KRA B;  3NRI A;  3PKO A;  3S9V A;  5HN7 A;  1WL1 A;  4GP2 A;  3UCA A;  2F7M F;  3ID0 A;  4FP4 A;  3W7F A;  1YYR A;  3NPR A;  4NKE A;  4P0V A;  3N1W F;  3N0G A;  1UBV A;  4LFV F;  1VG4 A;  3VJC A;  5B0J A;  2OGD A;  4JZX A;  2Q9Z A;  3DYG A;  5IK0 A;  5JV2 F;  5JUZ F;  3ICM A;  4JXY A;  2Z50 A;  1VG7 A;  5HN8 A;  3WJN A;  2Z4X A;  3Q30 A;  3ASX A;  3RMG A;  3RYW A;  3LLW A;  5B0K A;  4MC3 A;  5ILJ A;  4LLS A;  1KIY A;  3N5J F;  1V4J A;  5H9D A;  2Z4W A;  3ACX A;  3WCM A;  3VJA A;  5DZ2 A;  5E8K A;  4LIX A;  2E94 A;  4OMG A;  3PH7 A;  1JFA A;  3OAC A;  1WL3 A;  1ZW5 A;  4DZW A;  3SDV A;  3WCI A;  3AQC B;  2J1O A;  4KFA A;  5IKH A;  3V1X A;  3KRA A;  2ZEV A;  3ZMB A;  3IPI A;  3KRC A;  3IBA A;  3KRO A;  3Q2Z A;  5IMI A;  4NUA A;  4KK2 A;  5ILZ A;  4RXE A;  3ICK A;  5C05 A;  5ER8 A;  2E8T A;  3SDQ A;  5JV0 F;  2AET A;  3N5H F;  2PS7 A;  4JYX A;  5DGM F;  4EA0 A;  4H5D F;  4KUX A;  5ILH A;  2Z4Z A;  5CG6 A;  3WC9 A;  3OYR A;  4WK5 A;  5ERM A;  3ACW A;  2E4O A;  2OPM A;  1V4I A;  2E8X A;  5B00 A;  2RAH A;  2Q80 A;  3VJD A;  4RNQ A;  1VG3 A;  1YV5 A;  2AZK A;  4H5C F;  5EAT A;  5E8H A;  4RXD A;  3LGZ B;  1HXC A;  5IMP A;  3LG5 A;  2F8Z F;  3VJ8 A;  5DHI A;  1V4E A;  2Z4V A;  3MAV A;  3CKE A;  2OA6 A;  2F92 F;  1HX9 A;  3SAE A;  2Z78 A;  4KVI A;  5ILY A;  3RBM A;  4PVX F;  3BNX A;  5ILK A;  5IMN A;  1YHK A;  3TFP A;  3ADZ A;  3V66 A;  5KSX F;  3WEH A;  1YHM A;  3OAC B;  3QKC A;  4NFK F;  4HD1 A;  3MZV A;  5EAS A;  3EGT A;  2FTZ A;  3LJI A;  3NF2 A;  4RXC A;  3V1V A;  5AEL A;  1WL0 A;  1N24 A;  3PYB A;  3QQV A;  3VJ9 A;  3KRC B;  3KRO B;  3WCJ A;  3LOM A;  3PDE A;  3P5R A;  4KQS A;  3LDW A;  1RQJ A;  4RXA A;  4FJQ A;  3WEI A;  3TC1 A;  3M9U A;  4LFG A;  3WJK A;  3N49 F;  4LPH F;  4JZB A;  1RTR A;  1HXA A;  3WCG A;  4LUU A;  5ERO A;  3KBK A;  2I19 A;  3ICZ A;  2ONH A;  2EWG A;  3DYH A;  3BNY A;  2Z7H A;  2F9K F;  5IL3 A;  1N20 A;  4EA2 A;  4NKF A;  1N1B A;  5IKA A;  3N1V F;  1VG2 A;  5DHK A;  4GP1 A;  3P5P A;  2PS8 A;  4QPF A;  3WCL A;  4LFE A;  2F8C F;  1N23 A;  4DWB A;  3LVS A;  5B0I A;  3WCC A;  4F6V A;  5DJR F;  3P8R A;  3CP6 A;  3KRP A;  5HNA A;  3N3D A;  4KVY A;  4F62 A;  1WY0 A;  3ZMC A;  3M02 A;  4DWG A;  2ZCR A;  3S4J A;  4KWD A;  4N1Z F;  4OKM A;  3SDU A;  2AZJ A;  4N9U A;  2F94 F;  5A0J A;  4LPG F;  4JXN A;  3P8L A;  3KRF B;  2Q58 A;  1YYU A;  3WSA A;  2ONG A;  5DGN F;  2O1O A;  3ZOU A;  4XQS F; 
#chains in the Genus database with same CATH topology
 5HN9 A;  1UBW A;  2AEK A;  3VJE A;  5AHU B;  5ERN A;  4LTV A;  4NFI F;  1YYQ A;  2ZCS A;  1RQI A;  3EZ3 A;  2P1C A;  2Z52 A;  3ICN A;  4LLT A;  3LGK A;  1UBX A;  5B0L A;  1V4K A;  5B0M A;  4XQR F;  2E8W A;  5IK6 A;  3WEF A;  5JV1 F;  4PVY F;  4OKZ A;  1VG6 A;  3LMD A;  4XQT F;  3ZCD A;  4MC8 A;  4K10 A;  4F6X A;  3KRP B;  5A0K A;  2E93 A;  2E91 A;  2E8V A;  3WCF A;  3N3L F;  5ILD A;  1HXG A;  3WEG A;  4KPJ A;  3WCA A;  5IK9 A;  3M0G A;  1PS1 A;  2E95 A;  3KRF A;  5A0I A;  5E8L A;  3SDT A;  1WKZ A;  4KKM A;  5AFX A;  3SDR A;  5CG5 A;  4MC0 A;  5DIQ F;  3VJB A;  3DYF A;  4UMJ A;  3WJO A;  1DI1 A;  4JVJ F;  3WCD A;  2AZL A;  2VF6 A;  3LSN A;  5DGS F;  3AQB B;  5IM1 A;  4KVD A;  2PS5 A;  4LZC A;  5B01 A;  4DI5 A;  3M00 A;  5IL8 A;  3Q1O A;  4E9U A;  4ZQ8 A;  4H5E F;  3LEE A;  2ZY1 A;  2J1P A;  4LZ3 A;  2ZCQ A;  4LTZ A;  4Q23 A;  4NG6 A;  3WSB A;  3NPK A;  3N46 F;  5JA0 F;  3WEJ A;  3Q2Q A;  4GAX A;  5ILI A;  4OGU A;  3CC9 A;  2QIS A;  3P41 A;  4LA6 A;  5DJP F;  2Q9Y A;  4LZ0 A;  4RYP A;  2ZEU A;  2PS4 A;  3OAB A;  4QXS F;  1YYS A;  4L2X F;  2PS6 A;  5B03 A;  3LZ9 A;  1JFG A;  1YHL A;  1EZF A;  3N6K F;  3EFQ A;  4EA1 A;  3G4F A;  4NFJ F;  4LA5 A;  3PYA A;  3ACY A;  4KPD A;  1N22 A;  3G4D A;  4E1E A;  2Z4Y A;  3AE0 A;  5EAU A;  1DGP A;  1YJ4 A;  5IVG A;  3N45 F;  5DJV F;  3TFN A;  4KQ5 A;  2J5C A;  1WL2 A;  2ZCO A;  3WE9 A;  4GA3 A;  1YQ7 A;  3WCE A;  4E9Z A;  5B02 A;  2E92 A;  3LK5 A;  3APZ A;  1WMW A;  3N0F A;  4DEM F;  3TFV A;  1KIZ A;  4P0X A;  4DXJ A;  2F89 F;  3M01 A;  2Z7I A;  5DW7 A;  3AQ0 A;  3B7L A;  2E8U A;  3KB9 A;  3WCB A;  2H8O A;  4KVW A;  4P0W A;  5AYP A;  5IN8 A;  4LOB A;  1HM4 A;  3WEK A;  5I1U A;  1UBY A;  2FOR A;  1V4H A;  4LXW A;  1HM7 A;  3ZL6 A;  3WCH A;  3OAB B;  2AEL A;  2E90 A;  1YYT A;  3RYE A;  1N1Z A;  1N21 A;  2DH4 A;  4KQU A;  1FPS A;  3TS7 A;  4DHD A;  2OPN A;  4OMH A;  3KRA B;  3NRI A;  3PKO A;  3S9V A;  5HN7 A;  1WL1 A;  4GP2 A;  3UCA A;  2F7M F;  3ID0 A;  4FP4 A;  3W7F A;  1YYR A;  3NPR A;  4NKE A;  4P0V A;  3N1W F;  3N0G A;  1UBV A;  4LFV F;  1VG4 A;  3VJC A;  5B0J A;  2OGD A;  4JZX A;  2Q9Z A;  3DYG A;  5IK0 A;  5JV2 F;  5JUZ F;  3ICM A;  4JXY A;  2Z50 A;  1VG7 A;  5HN8 A;  3WJN A;  2Z4X A;  3Q30 A;  3ASX A;  3RMG A;  3RYW A;  3LLW A;  5B0K A;  4MC3 A;  5ILJ A;  4LLS A;  1KIY A;  3N5J F;  1V4J A;  5H9D A;  2Z4W A;  3ACX A;  3WCM A;  3VJA A;  5DZ2 A;  5E8K A;  4LIX A;  2E94 A;  4OMG A;  3PH7 A;  1JFA A;  3OAC A;  1WL3 A;  1ZW5 A;  4DZW A;  3SDV A;  3WCI A;  3AQC B;  2J1O A;  4KFA A;  5IKH A;  3V1X A;  3KRA A;  2ZEV A;  3ZMB A;  3IPI A;  3KRC A;  3IBA A;  3KRO A;  3Q2Z A;  5IMI A;  4NUA A;  4KK2 A;  5ILZ A;  4RXE A;  3ICK A;  5C05 A;  5ER8 A;  2E8T A;  3SDQ A;  5JV0 F;  2AET A;  3N5H F;  2PS7 A;  4JYX A;  5DGM F;  4EA0 A;  4H5D F;  4KUX A;  5ILH A;  2Z4Z A;  5CG6 A;  3WC9 A;  3OYR A;  4WK5 A;  5ERM A;  3ACW A;  2E4O A;  2OPM A;  1V4I A;  2E8X A;  5B00 A;  2RAH A;  2Q80 A;  3VJD A;  4RNQ A;  1VG3 A;  1YV5 A;  2AZK A;  4H5C F;  5EAT A;  5E8H A;  4RXD A;  3LGZ B;  1HXC A;  5IMP A;  3LG5 A;  2F8Z F;  3VJ8 A;  5DHI A;  1V4E A;  2Z4V A;  3MAV A;  3CKE A;  2OA6 A;  2F92 F;  1HX9 A;  3SAE A;  2Z78 A;  4KVI A;  5ILY A;  3RBM A;  4PVX F;  3BNX A;  5ILK A;  5IMN A;  1YHK A;  3TFP A;  3ADZ A;  3V66 A;  5KSX F;  3WEH A;  1YHM A;  3OAC B;  3QKC A;  4NFK F;  4HD1 A;  3MZV A;  5EAS A;  3EGT A;  2FTZ A;  3LJI A;  3NF2 A;  4RXC A;  3V1V A;  5AEL A;  1WL0 A;  1N24 A;  3PYB A;  3QQV A;  3VJ9 A;  3KRC B;  3KRO B;  3WCJ A;  3LOM A;  3PDE A;  3P5R A;  4KQS A;  3LDW A;  1RQJ A;  4RXA A;  4FJQ A;  3WEI A;  3TC1 A;  3M9U A;  4LFG A;  3WJK A;  3N49 F;  4LPH F;  4JZB A;  1RTR A;  1HXA A;  3WCG A;  4LUU A;  5ERO A;  3KBK A;  2I19 A;  3ICZ A;  2ONH A;  2EWG A;  3DYH A;  3BNY A;  2Z7H A;  2F9K F;  5IL3 A;  1N20 A;  4EA2 A;  4NKF A;  1N1B A;  5IKA A;  3N1V F;  1VG2 A;  5DHK A;  4GP1 A;  3P5P A;  2PS8 A;  4QPF A;  3WCL A;  4LFE A;  2F8C F;  1N23 A;  4DWB A;  3LVS A;  5B0I A;  3WCC A;  4F6V A;  5DJR F;  3P8R A;  3CP6 A;  3KRP A;  5HNA A;  3N3D A;  4KVY A;  4F62 A;  1WY0 A;  3ZMC A;  3M02 A;  4DWG A;  2ZCR A;  3S4J A;  4KWD A;  4N1Z F;  4OKM A;  3SDU A;  2AZJ A;  4N9U A;  2F94 F;  5A0J A;  4LPG F;  4JXN A;  3P8L A;  3KRF B;  2Q58 A;  1YYU A;  3WSA A;  2ONG A;  5DGN F;  2O1O A;  3ZOU A;  4XQS F; 
#chains in the Genus database with same CATH homology
 5HN9 A;  1UBW A;  2AEK A;  3VJE A;  5AHU B;  5ERN A;  4LTV A;  4NFI F;  1YYQ A;  2ZCS A;  1RQI A;  3EZ3 A;  2P1C A;  2Z52 A;  3ICN A;  4LLT A;  3LGK A;  1UBX A;  5B0L A;  1V4K A;  5B0M A;  4XQR F;  2E8W A;  5IK6 A;  3WEF A;  5JV1 F;  4PVY F;  4OKZ A;  1VG6 A;  3LMD A;  4XQT F;  3ZCD A;  4MC8 A;  4K10 A;  4F6X A;  3KRP B;  5A0K A;  2E93 A;  2E91 A;  2E8V A;  3WCF A;  3N3L F;  5ILD A;  1HXG A;  3WEG A;  4KPJ A;  3WCA A;  5IK9 A;  3M0G A;  1PS1 A;  2E95 A;  3KRF A;  5A0I A;  5E8L A;  3SDT A;  1WKZ A;  4KKM A;  5AFX A;  3SDR A;  5CG5 A;  4MC0 A;  5DIQ F;  3VJB A;  3DYF A;  4UMJ A;  3WJO A;  1DI1 A;  4JVJ F;  3WCD A;  2AZL A;  2VF6 A;  3LSN A;  5DGS F;  3AQB B;  5IM1 A;  4KVD A;  2PS5 A;  4LZC A;  5B01 A;  4DI5 A;  3M00 A;  5IL8 A;  3Q1O A;  4E9U A;  4ZQ8 A;  4H5E F;  3LEE A;  2ZY1 A;  2J1P A;  4LZ3 A;  2ZCQ A;  4LTZ A;  4Q23 A;  4NG6 A;  3WSB A;  3NPK A;  3N46 F;  5JA0 F;  3WEJ A;  3Q2Q A;  4GAX A;  5ILI A;  4OGU A;  3CC9 A;  2QIS A;  3P41 A;  4LA6 A;  5DJP F;  2Q9Y A;  4LZ0 A;  4RYP A;  2ZEU A;  2PS4 A;  3OAB A;  4QXS F;  1YYS A;  4L2X F;  2PS6 A;  5B03 A;  3LZ9 A;  1JFG A;  1YHL A;  1EZF A;  3N6K F;  3EFQ A;  4EA1 A;  3G4F A;  4NFJ F;  4LA5 A;  3PYA A;  3ACY A;  4KPD A;  1N22 A;  3G4D A;  4E1E A;  2Z4Y A;  3AE0 A;  5EAU A;  1DGP A;  1YJ4 A;  5IVG A;  3N45 F;  5DJV F;  3TFN A;  4KQ5 A;  2J5C A;  1WL2 A;  2ZCO A;  3WE9 A;  4GA3 A;  1YQ7 A;  3WCE A;  4E9Z A;  5B02 A;  2E92 A;  3LK5 A;  3APZ A;  1WMW A;  3N0F A;  4DEM F;  3TFV A;  1KIZ A;  4P0X A;  4DXJ A;  2F89 F;  3M01 A;  2Z7I A;  5DW7 A;  3AQ0 A;  3B7L A;  2E8U A;  3KB9 A;  3WCB A;  2H8O A;  4KVW A;  4P0W A;  5AYP A;  5IN8 A;  4LOB A;  1HM4 A;  3WEK A;  5I1U A;  1UBY A;  2FOR A;  1V4H A;  4LXW A;  1HM7 A;  3ZL6 A;  3WCH A;  3OAB B;  2AEL A;  2E90 A;  1YYT A;  3RYE A;  1N1Z A;  1N21 A;  2DH4 A;  4KQU A;  1FPS A;  3TS7 A;  4DHD A;  2OPN A;  4OMH A;  3KRA B;  3NRI A;  3PKO A;  3S9V A;  5HN7 A;  1WL1 A;  4GP2 A;  3UCA A;  2F7M F;  3ID0 A;  4FP4 A;  3W7F A;  1YYR A;  3NPR A;  4NKE A;  4P0V A;  3N1W F;  3N0G A;  1UBV A;  4LFV F;  1VG4 A;  3VJC A;  5B0J A;  2OGD A;  4JZX A;  2Q9Z A;  3DYG A;  5IK0 A;  5JV2 F;  5JUZ F;  3ICM A;  4JXY A;  2Z50 A;  1VG7 A;  5HN8 A;  3WJN A;  2Z4X A;  3Q30 A;  3ASX A;  3RMG A;  3RYW A;  3LLW A;  5B0K A;  4MC3 A;  5ILJ A;  4LLS A;  1KIY A;  3N5J F;  1V4J A;  5H9D A;  2Z4W A;  3ACX A;  3WCM A;  3VJA A;  5DZ2 A;  5E8K A;  4LIX A;  2E94 A;  4OMG A;  3PH7 A;  1JFA A;  3OAC A;  1WL3 A;  1ZW5 A;  4DZW A;  3SDV A;  3WCI A;  3AQC B;  2J1O A;  4KFA A;  5IKH A;  3V1X A;  3KRA A;  2ZEV A;  3ZMB A;  3IPI A;  3KRC A;  3IBA A;  3KRO A;  3Q2Z A;  5IMI A;  4NUA A;  4KK2 A;  5ILZ A;  4RXE A;  3ICK A;  5C05 A;  5ER8 A;  2E8T A;  3SDQ A;  5JV0 F;  2AET A;  3N5H F;  2PS7 A;  4JYX A;  5DGM F;  4EA0 A;  4H5D F;  4KUX A;  5ILH A;  2Z4Z A;  5CG6 A;  3WC9 A;  3OYR A;  4WK5 A;  5ERM A;  3ACW A;  2E4O A;  2OPM A;  1V4I A;  2E8X A;  5B00 A;  2RAH A;  2Q80 A;  3VJD A;  4RNQ A;  1VG3 A;  1YV5 A;  2AZK A;  4H5C F;  5EAT A;  5E8H A;  4RXD A;  3LGZ B;  1HXC A;  5IMP A;  3LG5 A;  2F8Z F;  3VJ8 A;  5DHI A;  1V4E A;  2Z4V A;  3MAV A;  3CKE A;  2OA6 A;  2F92 F;  1HX9 A;  3SAE A;  2Z78 A;  4KVI A;  5ILY A;  3RBM A;  4PVX F;  3BNX A;  5ILK A;  5IMN A;  1YHK A;  3TFP A;  3ADZ A;  3V66 A;  5KSX F;  3WEH A;  1YHM A;  3OAC B;  3QKC A;  4NFK F;  4HD1 A;  3MZV A;  5EAS A;  3EGT A;  2FTZ A;  3LJI A;  3NF2 A;  4RXC A;  3V1V A;  5AEL A;  1WL0 A;  1N24 A;  3PYB A;  3QQV A;  3VJ9 A;  3KRC B;  3KRO B;  3WCJ A;  3LOM A;  3PDE A;  3P5R A;  4KQS A;  3LDW A;  1RQJ A;  4RXA A;  4FJQ A;  3WEI A;  3TC1 A;  3M9U A;  4LFG A;  3WJK A;  3N49 F;  4LPH F;  4JZB A;  1RTR A;  1HXA A;  3WCG A;  4LUU A;  5ERO A;  3KBK A;  2I19 A;  3ICZ A;  2ONH A;  2EWG A;  3DYH A;  3BNY A;  2Z7H A;  2F9K F;  5IL3 A;  1N20 A;  4EA2 A;  4NKF A;  1N1B A;  5IKA A;  3N1V F;  1VG2 A;  5DHK A;  4GP1 A;  3P5P A;  2PS8 A;  4QPF A;  3WCL A;  4LFE A;  2F8C F;  1N23 A;  4DWB A;  3LVS A;  5B0I A;  3WCC A;  4F6V A;  5DJR F;  3P8R A;  3CP6 A;  3KRP A;  5HNA A;  3N3D A;  4KVY A;  4F62 A;  1WY0 A;  3ZMC A;  3M02 A;  4DWG A;  2ZCR A;  3S4J A;  4KWD A;  4N1Z F;  4OKM A;  3SDU A;  2AZJ A;  4N9U A;  2F94 F;  5A0J A;  4LPG F;  4JXN A;  3P8L A;  3KRF B;  2Q58 A;  1YYU A;  3WSA A;  2ONG A;  5DGN F;  2O1O A;  3ZOU A;  4XQS F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...