3OACB

Mint deletion mutant of heterotetrameric geranyl pyrophosphate synthase in complex with ligands
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
248
structure length
248
Chain Sequence
QPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTFAAPATAASTLCLAACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLPPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIEISRAGGPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYGEMHACGAACGAILGGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQLIDENIIGKLKELALEELGGFHGKNAELMSSLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyl diphosphate synthase large subunit
publication title Enhanced specificity of mint geranyl pyrophosphate synthase by modifying the R-loop interactions
pubmed doi rcsb
source organism Mentha x piperita
total genus 92
structure length 248
sequence length 248
chains with identical sequence C
ec nomenclature ec 2.5.1.1: Dimethylallyltranstransferase.
pdb deposition date 2010-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3oacB00
3OACB 4QXSF 4LPHF 3ADZA 3NRIA 5IK9A 1YHLA 3N1WF 3LMDA 3M01A 2PS7A 3WCGA 1YYUA 3G4DA 1RQJA 4RYPA 4DWBA 5HN9A 1UBXA 3WEGA 4MC8A 3RYWA 2E91A 5DZ2A 5DGMF 3EGTA 3LJIA 4NFIF 2OA6A 5EAUA 3WJOA 4XQRF 3VJCA 4H5EF 3LSNA 5IMNA 3SDRA 4LZ3A 3P41A 1KIZA 4KVIA 4LLSA 3V1XA 3N45F 3Q2ZA 4P0XA 3AQCB 4E9ZA 4F6VA 2F8CF 4RXDA 4FJQA 2F7MF 3N3LF 4GP1A 3OACA 3DYHA 2J5CA 3P5RA 5ER8A 5A0KA 1YYQA 3DYGA 4DHDA 2E94A 3KRFA 4KVYA 5H9DA 1EZFA 3WCFA 5DJVF 2FORA 5IL3A 4JXNA 4L2XF 1N1ZA 4F6XA 3MZVA 4OMGA 4MC0A 2E8XA 3NF2A 5AFXA 5IK0A 2Q80A 2E92A 3WEFA 2ONHA 1KIYA 4LZCA 3ACXA 3PYAA 5B01A 4N1ZF 1V4JA 4LFEA 3WCEA 5JV1F 3WCIA 1YQ7A 3LZ9A 5IVGA 5IMIA 4OKMA 5C05A 2H8OA 3LG5A 1YHMA 3PH7A 2PS6A 3VJ8A 2Q58A 3P8LA 4NKEA 2ZEUA 3V1VA 1HM4A 2PS4A 3WSBA 4DZWA 2Z4YA 4JZBA 3ZMBA 3ID0A 1FPSA 3KB9A 3PKOA 4RXAA 4H5DF 5ILYA 3ZOUA 2Z7HA 4KUXA 1YHKA 5B00A 4NFKF 4LZ0A 3M9UA 4F62A 3N3DA 3B7LA 1VG6A 5HNAA 5CG5A 4KWDA 2Z50A 5B0JA 3CP6A 3VJ9A 3Q30A 2O1OA 2ZY1A 4LFGA 2FTZA 1UBVA 2DH4A 2E93A 2VF6A 1N24A 2Z7IA 3P8RA 4KK2A 3VJEA 2E95A 2E8TA 4KQSA 4WK5A 3KRFB 3KBKA 3WSAA 2E8WA 4KQ5A 3KRPA 3G4FA 3SDUA 3WCJA 4HD1A 4DEMF 3WCCA 3N0GA 3ICKA 3N5HF 5E8HA 4LUUA 5B0IA 1YYSA 3W7FA 3RBMA 3RYEA 2AELA 5AELA 3IPIA 2ZEVA 5JV0F 5I1UA 2Z4ZA 2E8UA 5A0IA 2PS5A 5EROA 3KRCB 4P0WA 3VJAA 3M02A 5DJPF 2QISA 3IBAA 2AEKA 3TFVA 3SDQA 3QKCA 1WL2A 2ZCSA 1VG2A 3TS7A 1VG7A 5HN8A 2AETA 3VJDA 3AE0A 4JZXA 3LK5A 2J1OA 3ACWA 3SAEA 5IN8A 1N22A 3LDWA 2OGDA 5ILKA 3WCBA 1JFAA 3OABB 3ASXA 4GA3A 5DJRF 4KQUA 5IK6A 3OYRA 4LFVF 5ILZA 4KPJA 2F9KF 3BNYA 1DGPA 3KRCA 3WCHA 1N23A 5DIQF 5IMPA 4OGUA 4KVDA 3DYFA 4DXJA 5DW7A 4LTVA 5DGNF 4DI5A 3AQBB 3WE9A 5B0MA 3WCDA 3KRAB 3WCAA 1WL3A 3MAVA 1DI1A 3BNXA 1PS1A 3KRPB 3Q2QA 3NPKA 4NKFA 5E8LA 4KFAA 2OPNA 3WEKA 2OPMA 4GP2A 3OABA 4UMJA 5B02A 2Q9ZA 3ACYA 1WY0A 3RMGA 1V4HA 2P1CA 3KROB 1V4IA 3S9VA 3CKEA 3P5PA 5EASA 2F94F 5B0LA 5A0JA 5DHIA 2AZLA 3M0GA 3NPRA 3UCAA 3ZMCA 4PVXF 2AZJA 4MC3A 4OMHA 3KRAA 4OKZA 3WC9A 3WJKA 1N20A 2J1PA 2E4OA 5IKHA 3S4JA 3N49F 4XQTF 3CC9A 4NG6A 4K10A 5ERNA 4Q23A 3WEJA 3N5JF 2F89F 4KKMA 1UBYA 4H5CF 4LA5A 3KROA 3PYBA 4LPGF 5ILJA 5B0KA 1YJ4A 4EA2A 5E8KA 1HM7A 3LLWA 3ICMA 3Q1OA 3WJNA 2Z4XA 1YYRA 4KVWA 3V66A 4LOBA 4XQSF 5HN7A 3LVSA 3AQ0A 3VJBA 3PDEA 4KPDA 3WCMA 1N1BA 3SDTA 5ERMA 2ZCOA 5AHUB 3TFNA 3LEEA 2I19A 4JXYA 5JV2F 4RNQA 4JYXA 3N1VF 1HXCA 4JVJF 5AYPA 4QPFA 5IL8A 1RTRA 4NFJF 5CG6A 3ZL6A 4DWGA 4EA0A 3N46F 2F92F 3WEIA 1HX9A 2E90A 2ZCQA 5ILDA 5DGSF 4LLTA 5DHKA 4P0VA 3TFPA 1YYTA 3QQVA 4N9UA 4EA1A 5JUZF 1UBWA 4GAXA 3ICZA 2EWGA 5EATA 3N6KF 5ILIA 1V4EA 3APZA 2PS8A 2ZCRA 3TC1A 4NUAA 4LXWA 2Z52A 3N0FA 4LA6A 3M00A 1YV5A 2AZKA 4ZQ8A 1WL0A 1HXAA 2E8VA 2Z78A 3WCLA 4LTZA 5IM1A 1JFGA 1V4KA 4RXEA 2RAHA 4PVYF 4FP4A 3ICNA 3SDVA 5IKAA 4RXCA 2Q9YA 2Z4WA 1N21A 2ONGA 1WMWA 3LOMA 1VG3A 3EZ3A 3ZCDA 5KSXF 4LIXA 5ILHA 3WEHA 1WL1A 3LGKA 3EFQA 4E9UA 2F8ZF 5JA0F 3LGZB 1HXGA 1RQIA 5B03A 1WKZA 2Z4VA 1ZW5A 1VG4A 4E1EA
chains in the Genus database with same CATH superfamily
3OACB 4QXSF 4LPHF 3ADZA 3NRIA 5IK9A 1YHLA 3N1WF 3LMDA 3M01A 2PS7A 3WCGA 1YYUA 3G4DA 1RQJA 4RYPA 4DWBA 5HN9A 1UBXA 3WEGA 4MC8A 3RYWA 2E91A 5DZ2A 5DGMF 3EGTA 3LJIA 4NFIF 2OA6A 5EAUA 3WJOA 4XQRF 3VJCA 4H5EF 3LSNA 5IMNA 3SDRA 4LZ3A 3P41A 1KIZA 4KVIA 4LLSA 3V1XA 3N45F 3Q2ZA 4P0XA 3AQCB 4E9ZA 4F6VA 2F8CF 4RXDA 4FJQA 2F7MF 3N3LF 4GP1A 3OACA 3DYHA 2J5CA 3P5RA 5ER8A 5A0KA 1YYQA 3DYGA 4DHDA 2E94A 3KRFA 4KVYA 5H9DA 1EZFA 3WCFA 5DJVF 2FORA 5IL3A 4JXNA 4L2XF 1N1ZA 4F6XA 3MZVA 4OMGA 4MC0A 2E8XA 3NF2A 5AFXA 5IK0A 2Q80A 2E92A 3WEFA 2ONHA 1KIYA 4LZCA 3ACXA 3PYAA 5B01A 4N1ZF 1V4JA 4LFEA 3WCEA 5JV1F 3WCIA 1YQ7A 3LZ9A 5IVGA 5IMIA 4OKMA 5C05A 2H8OA 3LG5A 1YHMA 3PH7A 2PS6A 3VJ8A 2Q58A 3P8LA 4NKEA 2ZEUA 3V1VA 1HM4A 2PS4A 3WSBA 4DZWA 2Z4YA 4JZBA 3ZMBA 3ID0A 1FPSA 3KB9A 3PKOA 4RXAA 4H5DF 5ILYA 3ZOUA 2Z7HA 4KUXA 1YHKA 5B00A 4NFKF 4LZ0A 3M9UA 4F62A 3N3DA 3B7LA 1VG6A 5HNAA 5CG5A 4KWDA 2Z50A 5B0JA 3CP6A 3VJ9A 3Q30A 2O1OA 2ZY1A 4LFGA 2FTZA 1UBVA 2DH4A 2E93A 2VF6A 1N24A 2Z7IA 3P8RA 4KK2A 3VJEA 2E95A 2E8TA 4KQSA 4WK5A 3KRFB 3KBKA 3WSAA 2E8WA 4KQ5A 3KRPA 3G4FA 3SDUA 3WCJA 4HD1A 4DEMF 3WCCA 3N0GA 3ICKA 3N5HF 5E8HA 4LUUA 5B0IA 1YYSA 3W7FA 3RBMA 3RYEA 2AELA 5AELA 3IPIA 2ZEVA 5JV0F 5I1UA 2Z4ZA 2E8UA 5A0IA 2PS5A 5EROA 3KRCB 4P0WA 3VJAA 3M02A 5DJPF 2QISA 3IBAA 2AEKA 3TFVA 3SDQA 3QKCA 1WL2A 2ZCSA 1VG2A 3TS7A 1VG7A 5HN8A 2AETA 3VJDA 3AE0A 4JZXA 3LK5A 2J1OA 3ACWA 3SAEA 5IN8A 1N22A 3LDWA 2OGDA 5ILKA 3WCBA 1JFAA 3OABB 3ASXA 4GA3A 5DJRF 4KQUA 5IK6A 3OYRA 4LFVF 5ILZA 4KPJA 2F9KF 3BNYA 1DGPA 3KRCA 3WCHA 1N23A 5DIQF 5IMPA 4OGUA 4KVDA 3DYFA 4DXJA 5DW7A 4LTVA 5DGNF 4DI5A 3AQBB 3WE9A 5B0MA 3WCDA 3KRAB 3WCAA 1WL3A 3MAVA 1DI1A 3BNXA 1PS1A 3KRPB 3Q2QA 3NPKA 4NKFA 5E8LA 4KFAA 2OPNA 3WEKA 2OPMA 4GP2A 3OABA 4UMJA 5B02A 2Q9ZA 3ACYA 1WY0A 3RMGA 1V4HA 2P1CA 3KROB 1V4IA 3S9VA 3CKEA 3P5PA 5EASA 2F94F 5B0LA 5A0JA 5DHIA 2AZLA 3M0GA 3NPRA 3UCAA 3ZMCA 4PVXF 2AZJA 4MC3A 4OMHA 3KRAA 4OKZA 3WC9A 3WJKA 1N20A 2J1PA 2E4OA 5IKHA 3S4JA 3N49F 4XQTF 3CC9A 4NG6A 4K10A 5ERNA 4Q23A 3WEJA 3N5JF 2F89F 4KKMA 1UBYA 4H5CF 4LA5A 3KROA 3PYBA 4LPGF 5ILJA 5B0KA 1YJ4A 4EA2A 5E8KA 1HM7A 3LLWA 3ICMA 3Q1OA 3WJNA 2Z4XA 1YYRA 4KVWA 3V66A 4LOBA 4XQSF 5HN7A 3LVSA 3AQ0A 3VJBA 3PDEA 4KPDA 3WCMA 1N1BA 3SDTA 5ERMA 2ZCOA 5AHUB 3TFNA 3LEEA 2I19A 4JXYA 5JV2F 4RNQA 4JYXA 3N1VF 1HXCA 4JVJF 5AYPA 4QPFA 5IL8A 1RTRA 4NFJF 5CG6A 3ZL6A 4DWGA 4EA0A 3N46F 2F92F 3WEIA 1HX9A 2E90A 2ZCQA 5ILDA 5DGSF 4LLTA 5DHKA 4P0VA 3TFPA 1YYTA 3QQVA 4N9UA 4EA1A 5JUZF 1UBWA 4GAXA 3ICZA 2EWGA 5EATA 3N6KF 5ILIA 1V4EA 3APZA 2PS8A 2ZCRA 3TC1A 4NUAA 4LXWA 2Z52A 3N0FA 4LA6A 3M00A 1YV5A 2AZKA 4ZQ8A 1WL0A 1HXAA 2E8VA 2Z78A 3WCLA 4LTZA 5IM1A 1JFGA 1V4KA 4RXEA 2RAHA 4PVYF 4FP4A 3ICNA 3SDVA 5IKAA 4RXCA 2Q9YA 2Z4WA 1N21A 2ONGA 1WMWA 3LOMA 1VG3A 3EZ3A 3ZCDA 5KSXF 4LIXA 5ILHA 3WEHA 1WL1A 3LGKA 3EFQA 4E9UA 2F8ZF 5JA0F 3LGZB 1HXGA 1RQIA 5B03A 1WKZA 2Z4VA 1ZW5A 1VG4A 4E1EA
chains in the Genus database with same CATH topology
3OACB 4QXSF 4LPHF 3ADZA 3NRIA 5IK9A 1YHLA 3N1WF 3LMDA 3M01A 2PS7A 3WCGA 1YYUA 3G4DA 1RQJA 4RYPA 4DWBA 5HN9A 1UBXA 3WEGA 4MC8A 3RYWA 2E91A 5DZ2A 5DGMF 3EGTA 3LJIA 4NFIF 2OA6A 5EAUA 3WJOA 4XQRF 3VJCA 4H5EF 3LSNA 5IMNA 3SDRA 4LZ3A 3P41A 1KIZA 4KVIA 4LLSA 3V1XA 3N45F 3Q2ZA 4P0XA 3AQCB 4E9ZA 4F6VA 2F8CF 4RXDA 4FJQA 2F7MF 3N3LF 4GP1A 3OACA 3DYHA 2J5CA 3P5RA 5ER8A 5A0KA 1YYQA 3DYGA 4DHDA 2E94A 3KRFA 4KVYA 5H9DA 1EZFA 3WCFA 5DJVF 2FORA 5IL3A 4JXNA 4L2XF 1N1ZA 4F6XA 3MZVA 4OMGA 4MC0A 2E8XA 3NF2A 5AFXA 5IK0A 2Q80A 2E92A 3WEFA 2ONHA 1KIYA 4LZCA 3ACXA 3PYAA 5B01A 4N1ZF 1V4JA 4LFEA 3WCEA 5JV1F 3WCIA 1YQ7A 3LZ9A 5IVGA 5IMIA 4OKMA 5C05A 2H8OA 3LG5A 1YHMA 3PH7A 2PS6A 3VJ8A 2Q58A 3P8LA 4NKEA 2ZEUA 3V1VA 1HM4A 2PS4A 3WSBA 4DZWA 2Z4YA 4JZBA 3ZMBA 3ID0A 1FPSA 3KB9A 3PKOA 4RXAA 4H5DF 5ILYA 3ZOUA 2Z7HA 4KUXA 1YHKA 5B00A 4NFKF 4LZ0A 3M9UA 4F62A 3N3DA 3B7LA 1VG6A 5HNAA 5CG5A 4KWDA 2Z50A 5B0JA 3CP6A 3VJ9A 3Q30A 2O1OA 2ZY1A 4LFGA 2FTZA 1UBVA 2DH4A 2E93A 2VF6A 1N24A 2Z7IA 3P8RA 4KK2A 3VJEA 2E95A 2E8TA 4KQSA 4WK5A 3KRFB 3KBKA 3WSAA 2E8WA 4KQ5A 3KRPA 3G4FA 3SDUA 3WCJA 4HD1A 4DEMF 3WCCA 3N0GA 3ICKA 3N5HF 5E8HA 4LUUA 5B0IA 1YYSA 3W7FA 3RBMA 3RYEA 2AELA 5AELA 3IPIA 2ZEVA 5JV0F 5I1UA 2Z4ZA 2E8UA 5A0IA 2PS5A 5EROA 3KRCB 4P0WA 3VJAA 3M02A 5DJPF 2QISA 3IBAA 2AEKA 3TFVA 3SDQA 3QKCA 1WL2A 2ZCSA 1VG2A 3TS7A 1VG7A 5HN8A 2AETA 3VJDA 3AE0A 4JZXA 3LK5A 2J1OA 3ACWA 3SAEA 5IN8A 1N22A 3LDWA 2OGDA 5ILKA 3WCBA 1JFAA 3OABB 3ASXA 4GA3A 5DJRF 4KQUA 5IK6A 3OYRA 4LFVF 5ILZA 4KPJA 2F9KF 3BNYA 1DGPA 3KRCA 3WCHA 1N23A 5DIQF 5IMPA 4OGUA 4KVDA 3DYFA 4DXJA 5DW7A 4LTVA 5DGNF 4DI5A 3AQBB 3WE9A 5B0MA 3WCDA 3KRAB 3WCAA 1WL3A 3MAVA 1DI1A 3BNXA 1PS1A 3KRPB 3Q2QA 3NPKA 4NKFA 5E8LA 4KFAA 2OPNA 3WEKA 2OPMA 4GP2A 3OABA 4UMJA 5B02A 2Q9ZA 3ACYA 1WY0A 3RMGA 1V4HA 2P1CA 3KROB 1V4IA 3S9VA 3CKEA 3P5PA 5EASA 2F94F 5B0LA 5A0JA 5DHIA 2AZLA 3M0GA 3NPRA 3UCAA 3ZMCA 4PVXF 2AZJA 4MC3A 4OMHA 3KRAA 4OKZA 3WC9A 3WJKA 1N20A 2J1PA 2E4OA 5IKHA 3S4JA 3N49F 4XQTF 3CC9A 4NG6A 4K10A 5ERNA 4Q23A 3WEJA 3N5JF 2F89F 4KKMA 1UBYA 4H5CF 4LA5A 3KROA 3PYBA 4LPGF 5ILJA 5B0KA 1YJ4A 4EA2A 5E8KA 1HM7A 3LLWA 3ICMA 3Q1OA 3WJNA 2Z4XA 1YYRA 4KVWA 3V66A 4LOBA 4XQSF 5HN7A 3LVSA 3AQ0A 3VJBA 3PDEA 4KPDA 3WCMA 1N1BA 3SDTA 5ERMA 2ZCOA 5AHUB 3TFNA 3LEEA 2I19A 4JXYA 5JV2F 4RNQA 4JYXA 3N1VF 1HXCA 4JVJF 5AYPA 4QPFA 5IL8A 1RTRA 4NFJF 5CG6A 3ZL6A 4DWGA 4EA0A 3N46F 2F92F 3WEIA 1HX9A 2E90A 2ZCQA 5ILDA 5DGSF 4LLTA 5DHKA 4P0VA 3TFPA 1YYTA 3QQVA 4N9UA 4EA1A 5JUZF 1UBWA 4GAXA 3ICZA 2EWGA 5EATA 3N6KF 5ILIA 1V4EA 3APZA 2PS8A 2ZCRA 3TC1A 4NUAA 4LXWA 2Z52A 3N0FA 4LA6A 3M00A 1YV5A 2AZKA 4ZQ8A 1WL0A 1HXAA 2E8VA 2Z78A 3WCLA 4LTZA 5IM1A 1JFGA 1V4KA 4RXEA 2RAHA 4PVYF 4FP4A 3ICNA 3SDVA 5IKAA 4RXCA 2Q9YA 2Z4WA 1N21A 2ONGA 1WMWA 3LOMA 1VG3A 3EZ3A 3ZCDA 5KSXF 4LIXA 5ILHA 3WEHA 1WL1A 3LGKA 3EFQA 4E9UA 2F8ZF 5JA0F 3LGZB 1HXGA 1RQIA 5B03A 1WKZA 2Z4VA 1ZW5A 1VG4A 4E1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OAC B;  4QXS F;  4LPH F;  3ADZ A;  3NRI A;  5IK9 A;  1YHL A;  3N1W F;  3LMD A;  3M01 A;  2PS7 A;  3WCG A;  1YYU A;  3G4D A;  1RQJ A;  4RYP A;  4DWB A;  5HN9 A;  1UBX A;  3WEG A;  4MC8 A;  3RYW A;  2E91 A;  5DZ2 A;  5DGM F;  3EGT A;  3LJI A;  4NFI F;  2OA6 A;  5EAU A;  3WJO A;  4XQR F;  3VJC A;  4H5E F;  3LSN A;  5IMN A;  3SDR A;  4LZ3 A;  3P41 A;  1KIZ A;  4KVI A;  4LLS A;  3V1X A;  3N45 F;  3Q2Z A;  4P0X A;  3AQC B;  4E9Z A;  4F6V A;  2F8C F;  4RXD A;  4FJQ A;  2F7M F;  3N3L F;  4GP1 A;  3OAC A;  3DYH A;  2J5C A;  3P5R A;  5ER8 A;  5A0K A;  1YYQ A;  3DYG A;  4DHD A;  2E94 A;  3KRF A;  4KVY A;  5H9D A;  1EZF A;  3WCF A;  5DJV F;  2FOR A;  5IL3 A;  4JXN A;  4L2X F;  1N1Z A;  4F6X A;  3MZV A;  4OMG A;  4MC0 A;  2E8X A;  3NF2 A;  5AFX A;  5IK0 A;  2Q80 A;  2E92 A;  3WEF A;  2ONH A;  1KIY A;  4LZC A;  3ACX A;  3PYA A;  5B01 A;  4N1Z F;  1V4J A;  4LFE A;  3WCE A;  5JV1 F;  3WCI A;  1YQ7 A;  3LZ9 A;  5IVG A;  5IMI A;  4OKM A;  5C05 A;  2H8O A;  3LG5 A;  1YHM A;  3PH7 A;  2PS6 A;  3VJ8 A;  2Q58 A;  3P8L A;  4NKE A;  2ZEU A;  3V1V A;  1HM4 A;  2PS4 A;  3WSB A;  4DZW A;  2Z4Y A;  4JZB A;  3ZMB A;  3ID0 A;  1FPS A;  3KB9 A;  3PKO A;  4RXA A;  4H5D F;  5ILY A;  3ZOU A;  2Z7H A;  4KUX A;  1YHK A;  5B00 A;  4NFK F;  4LZ0 A;  3M9U A;  4F62 A;  3N3D A;  3B7L A;  1VG6 A;  5HNA A;  5CG5 A;  4KWD A;  2Z50 A;  5B0J A;  3CP6 A;  3VJ9 A;  3Q30 A;  2O1O A;  2ZY1 A;  4LFG A;  2FTZ A;  1UBV A;  2DH4 A;  2E93 A;  2VF6 A;  1N24 A;  2Z7I A;  3P8R A;  4KK2 A;  3VJE A;  2E95 A;  2E8T A;  4KQS A;  4WK5 A;  3KRF B;  3KBK A;  3WSA A;  2E8W A;  4KQ5 A;  3KRP A;  3G4F A;  3SDU A;  3WCJ A;  4HD1 A;  4DEM F;  3WCC A;  3N0G A;  3ICK A;  3N5H F;  5E8H A;  4LUU A;  5B0I A;  1YYS A;  3W7F A;  3RBM A;  3RYE A;  2AEL A;  5AEL A;  3IPI A;  2ZEV A;  5JV0 F;  5I1U A;  2Z4Z A;  2E8U A;  5A0I A;  2PS5 A;  5ERO A;  3KRC B;  4P0W A;  3VJA A;  3M02 A;  5DJP F;  2QIS A;  3IBA A;  2AEK A;  3TFV A;  3SDQ A;  3QKC A;  1WL2 A;  2ZCS A;  1VG2 A;  3TS7 A;  1VG7 A;  5HN8 A;  2AET A;  3VJD A;  3AE0 A;  4JZX A;  3LK5 A;  2J1O A;  3ACW A;  3SAE A;  5IN8 A;  1N22 A;  3LDW A;  2OGD A;  5ILK A;  3WCB A;  1JFA A;  3OAB B;  3ASX A;  4GA3 A;  5DJR F;  4KQU A;  5IK6 A;  3OYR A;  4LFV F;  5ILZ A;  4KPJ A;  2F9K F;  3BNY A;  1DGP A;  3KRC A;  3WCH A;  1N23 A;  5DIQ F;  5IMP A;  4OGU A;  4KVD A;  3DYF A;  4DXJ A;  5DW7 A;  4LTV A;  5DGN F;  4DI5 A;  3AQB B;  3WE9 A;  5B0M A;  3WCD A;  3KRA B;  3WCA A;  1WL3 A;  3MAV A;  1DI1 A;  3BNX A;  1PS1 A;  3KRP B;  3Q2Q A;  3NPK A;  4NKF A;  5E8L A;  4KFA A;  2OPN A;  3WEK A;  2OPM A;  4GP2 A;  3OAB A;  4UMJ A;  5B02 A;  2Q9Z A;  3ACY A;  1WY0 A;  3RMG A;  1V4H A;  2P1C A;  3KRO B;  1V4I A;  3S9V A;  3CKE A;  3P5P A;  5EAS A;  2F94 F;  5B0L A;  5A0J A;  5DHI A;  2AZL A;  3M0G A;  3NPR A;  3UCA A;  3ZMC A;  4PVX F;  2AZJ A;  4MC3 A;  4OMH A;  3KRA A;  4OKZ A;  3WC9 A;  3WJK A;  1N20 A;  2J1P A;  2E4O A;  5IKH A;  3S4J A;  3N49 F;  4XQT F;  3CC9 A;  4NG6 A;  4K10 A;  5ERN A;  4Q23 A;  3WEJ A;  3N5J F;  2F89 F;  4KKM A;  1UBY A;  4H5C F;  4LA5 A;  3KRO A;  3PYB A;  4LPG F;  5ILJ A;  5B0K A;  1YJ4 A;  4EA2 A;  5E8K A;  1HM7 A;  3LLW A;  3ICM A;  3Q1O A;  3WJN A;  2Z4X A;  1YYR A;  4KVW A;  3V66 A;  4LOB A;  4XQS F;  5HN7 A;  3LVS A;  3AQ0 A;  3VJB A;  3PDE A;  4KPD A;  3WCM A;  1N1B A;  3SDT A;  5ERM A;  2ZCO A;  5AHU B;  3TFN A;  3LEE A;  2I19 A;  4JXY A;  5JV2 F;  4RNQ A;  4JYX A;  3N1V F;  1HXC A;  4JVJ F;  5AYP A;  4QPF A;  5IL8 A;  1RTR A;  4NFJ F;  5CG6 A;  3ZL6 A;  4DWG A;  4EA0 A;  3N46 F;  2F92 F;  3WEI A;  1HX9 A;  2E90 A;  2ZCQ A;  5ILD A;  5DGS F;  4LLT A;  5DHK A;  4P0V A;  3TFP A;  1YYT A;  3QQV A;  4N9U A;  4EA1 A;  5JUZ F;  1UBW A;  4GAX A;  3ICZ A;  2EWG A;  5EAT A;  3N6K F;  5ILI A;  1V4E A;  3APZ A;  2PS8 A;  2ZCR A;  3TC1 A;  4NUA A;  4LXW A;  2Z52 A;  3N0F A;  4LA6 A;  3M00 A;  1YV5 A;  2AZK A;  4ZQ8 A;  1WL0 A;  1HXA A;  2E8V A;  2Z78 A;  3WCL A;  4LTZ A;  5IM1 A;  1JFG A;  1V4K A;  4RXE A;  2RAH A;  4PVY F;  4FP4 A;  3ICN A;  3SDV A;  5IKA A;  4RXC A;  2Q9Y A;  2Z4W A;  1N21 A;  2ONG A;  1WMW A;  3LOM A;  1VG3 A;  3EZ3 A;  3ZCD A;  5KSX F;  4LIX A;  5ILH A;  3WEH A;  1WL1 A;  3LGK A;  3EFQ A;  4E9U A;  2F8Z F;  5JA0 F;  3LGZ B;  1HXG A;  1RQI A;  5B03 A;  1WKZ A;  2Z4V A;  1ZW5 A;  1VG4 A;  4E1E A; 
#chains in the Genus database with same CATH topology
 3OAC B;  4QXS F;  4LPH F;  3ADZ A;  3NRI A;  5IK9 A;  1YHL A;  3N1W F;  3LMD A;  3M01 A;  2PS7 A;  3WCG A;  1YYU A;  3G4D A;  1RQJ A;  4RYP A;  4DWB A;  5HN9 A;  1UBX A;  3WEG A;  4MC8 A;  3RYW A;  2E91 A;  5DZ2 A;  5DGM F;  3EGT A;  3LJI A;  4NFI F;  2OA6 A;  5EAU A;  3WJO A;  4XQR F;  3VJC A;  4H5E F;  3LSN A;  5IMN A;  3SDR A;  4LZ3 A;  3P41 A;  1KIZ A;  4KVI A;  4LLS A;  3V1X A;  3N45 F;  3Q2Z A;  4P0X A;  3AQC B;  4E9Z A;  4F6V A;  2F8C F;  4RXD A;  4FJQ A;  2F7M F;  3N3L F;  4GP1 A;  3OAC A;  3DYH A;  2J5C A;  3P5R A;  5ER8 A;  5A0K A;  1YYQ A;  3DYG A;  4DHD A;  2E94 A;  3KRF A;  4KVY A;  5H9D A;  1EZF A;  3WCF A;  5DJV F;  2FOR A;  5IL3 A;  4JXN A;  4L2X F;  1N1Z A;  4F6X A;  3MZV A;  4OMG A;  4MC0 A;  2E8X A;  3NF2 A;  5AFX A;  5IK0 A;  2Q80 A;  2E92 A;  3WEF A;  2ONH A;  1KIY A;  4LZC A;  3ACX A;  3PYA A;  5B01 A;  4N1Z F;  1V4J A;  4LFE A;  3WCE A;  5JV1 F;  3WCI A;  1YQ7 A;  3LZ9 A;  5IVG A;  5IMI A;  4OKM A;  5C05 A;  2H8O A;  3LG5 A;  1YHM A;  3PH7 A;  2PS6 A;  3VJ8 A;  2Q58 A;  3P8L A;  4NKE A;  2ZEU A;  3V1V A;  1HM4 A;  2PS4 A;  3WSB A;  4DZW A;  2Z4Y A;  4JZB A;  3ZMB A;  3ID0 A;  1FPS A;  3KB9 A;  3PKO A;  4RXA A;  4H5D F;  5ILY A;  3ZOU A;  2Z7H A;  4KUX A;  1YHK A;  5B00 A;  4NFK F;  4LZ0 A;  3M9U A;  4F62 A;  3N3D A;  3B7L A;  1VG6 A;  5HNA A;  5CG5 A;  4KWD A;  2Z50 A;  5B0J A;  3CP6 A;  3VJ9 A;  3Q30 A;  2O1O A;  2ZY1 A;  4LFG A;  2FTZ A;  1UBV A;  2DH4 A;  2E93 A;  2VF6 A;  1N24 A;  2Z7I A;  3P8R A;  4KK2 A;  3VJE A;  2E95 A;  2E8T A;  4KQS A;  4WK5 A;  3KRF B;  3KBK A;  3WSA A;  2E8W A;  4KQ5 A;  3KRP A;  3G4F A;  3SDU A;  3WCJ A;  4HD1 A;  4DEM F;  3WCC A;  3N0G A;  3ICK A;  3N5H F;  5E8H A;  4LUU A;  5B0I A;  1YYS A;  3W7F A;  3RBM A;  3RYE A;  2AEL A;  5AEL A;  3IPI A;  2ZEV A;  5JV0 F;  5I1U A;  2Z4Z A;  2E8U A;  5A0I A;  2PS5 A;  5ERO A;  3KRC B;  4P0W A;  3VJA A;  3M02 A;  5DJP F;  2QIS A;  3IBA A;  2AEK A;  3TFV A;  3SDQ A;  3QKC A;  1WL2 A;  2ZCS A;  1VG2 A;  3TS7 A;  1VG7 A;  5HN8 A;  2AET A;  3VJD A;  3AE0 A;  4JZX A;  3LK5 A;  2J1O A;  3ACW A;  3SAE A;  5IN8 A;  1N22 A;  3LDW A;  2OGD A;  5ILK A;  3WCB A;  1JFA A;  3OAB B;  3ASX A;  4GA3 A;  5DJR F;  4KQU A;  5IK6 A;  3OYR A;  4LFV F;  5ILZ A;  4KPJ A;  2F9K F;  3BNY A;  1DGP A;  3KRC A;  3WCH A;  1N23 A;  5DIQ F;  5IMP A;  4OGU A;  4KVD A;  3DYF A;  4DXJ A;  5DW7 A;  4LTV A;  5DGN F;  4DI5 A;  3AQB B;  3WE9 A;  5B0M A;  3WCD A;  3KRA B;  3WCA A;  1WL3 A;  3MAV A;  1DI1 A;  3BNX A;  1PS1 A;  3KRP B;  3Q2Q A;  3NPK A;  4NKF A;  5E8L A;  4KFA A;  2OPN A;  3WEK A;  2OPM A;  4GP2 A;  3OAB A;  4UMJ A;  5B02 A;  2Q9Z A;  3ACY A;  1WY0 A;  3RMG A;  1V4H A;  2P1C A;  3KRO B;  1V4I A;  3S9V A;  3CKE A;  3P5P A;  5EAS A;  2F94 F;  5B0L A;  5A0J A;  5DHI A;  2AZL A;  3M0G A;  3NPR A;  3UCA A;  3ZMC A;  4PVX F;  2AZJ A;  4MC3 A;  4OMH A;  3KRA A;  4OKZ A;  3WC9 A;  3WJK A;  1N20 A;  2J1P A;  2E4O A;  5IKH A;  3S4J A;  3N49 F;  4XQT F;  3CC9 A;  4NG6 A;  4K10 A;  5ERN A;  4Q23 A;  3WEJ A;  3N5J F;  2F89 F;  4KKM A;  1UBY A;  4H5C F;  4LA5 A;  3KRO A;  3PYB A;  4LPG F;  5ILJ A;  5B0K A;  1YJ4 A;  4EA2 A;  5E8K A;  1HM7 A;  3LLW A;  3ICM A;  3Q1O A;  3WJN A;  2Z4X A;  1YYR A;  4KVW A;  3V66 A;  4LOB A;  4XQS F;  5HN7 A;  3LVS A;  3AQ0 A;  3VJB A;  3PDE A;  4KPD A;  3WCM A;  1N1B A;  3SDT A;  5ERM A;  2ZCO A;  5AHU B;  3TFN A;  3LEE A;  2I19 A;  4JXY A;  5JV2 F;  4RNQ A;  4JYX A;  3N1V F;  1HXC A;  4JVJ F;  5AYP A;  4QPF A;  5IL8 A;  1RTR A;  4NFJ F;  5CG6 A;  3ZL6 A;  4DWG A;  4EA0 A;  3N46 F;  2F92 F;  3WEI A;  1HX9 A;  2E90 A;  2ZCQ A;  5ILD A;  5DGS F;  4LLT A;  5DHK A;  4P0V A;  3TFP A;  1YYT A;  3QQV A;  4N9U A;  4EA1 A;  5JUZ F;  1UBW A;  4GAX A;  3ICZ A;  2EWG A;  5EAT A;  3N6K F;  5ILI A;  1V4E A;  3APZ A;  2PS8 A;  2ZCR A;  3TC1 A;  4NUA A;  4LXW A;  2Z52 A;  3N0F A;  4LA6 A;  3M00 A;  1YV5 A;  2AZK A;  4ZQ8 A;  1WL0 A;  1HXA A;  2E8V A;  2Z78 A;  3WCL A;  4LTZ A;  5IM1 A;  1JFG A;  1V4K A;  4RXE A;  2RAH A;  4PVY F;  4FP4 A;  3ICN A;  3SDV A;  5IKA A;  4RXC A;  2Q9Y A;  2Z4W A;  1N21 A;  2ONG A;  1WMW A;  3LOM A;  1VG3 A;  3EZ3 A;  3ZCD A;  5KSX F;  4LIX A;  5ILH A;  3WEH A;  1WL1 A;  3LGK A;  3EFQ A;  4E9U A;  2F8Z F;  5JA0 F;  3LGZ B;  1HXG A;  1RQI A;  5B03 A;  1WKZ A;  2Z4V A;  1ZW5 A;  1VG4 A;  4E1E A; 
#chains in the Genus database with same CATH homology
 3OAC B;  4QXS F;  4LPH F;  3ADZ A;  3NRI A;  5IK9 A;  1YHL A;  3N1W F;  3LMD A;  3M01 A;  2PS7 A;  3WCG A;  1YYU A;  3G4D A;  1RQJ A;  4RYP A;  4DWB A;  5HN9 A;  1UBX A;  3WEG A;  4MC8 A;  3RYW A;  2E91 A;  5DZ2 A;  5DGM F;  3EGT A;  3LJI A;  4NFI F;  2OA6 A;  5EAU A;  3WJO A;  4XQR F;  3VJC A;  4H5E F;  3LSN A;  5IMN A;  3SDR A;  4LZ3 A;  3P41 A;  1KIZ A;  4KVI A;  4LLS A;  3V1X A;  3N45 F;  3Q2Z A;  4P0X A;  3AQC B;  4E9Z A;  4F6V A;  2F8C F;  4RXD A;  4FJQ A;  2F7M F;  3N3L F;  4GP1 A;  3OAC A;  3DYH A;  2J5C A;  3P5R A;  5ER8 A;  5A0K A;  1YYQ A;  3DYG A;  4DHD A;  2E94 A;  3KRF A;  4KVY A;  5H9D A;  1EZF A;  3WCF A;  5DJV F;  2FOR A;  5IL3 A;  4JXN A;  4L2X F;  1N1Z A;  4F6X A;  3MZV A;  4OMG A;  4MC0 A;  2E8X A;  3NF2 A;  5AFX A;  5IK0 A;  2Q80 A;  2E92 A;  3WEF A;  2ONH A;  1KIY A;  4LZC A;  3ACX A;  3PYA A;  5B01 A;  4N1Z F;  1V4J A;  4LFE A;  3WCE A;  5JV1 F;  3WCI A;  1YQ7 A;  3LZ9 A;  5IVG A;  5IMI A;  4OKM A;  5C05 A;  2H8O A;  3LG5 A;  1YHM A;  3PH7 A;  2PS6 A;  3VJ8 A;  2Q58 A;  3P8L A;  4NKE A;  2ZEU A;  3V1V A;  1HM4 A;  2PS4 A;  3WSB A;  4DZW A;  2Z4Y A;  4JZB A;  3ZMB A;  3ID0 A;  1FPS A;  3KB9 A;  3PKO A;  4RXA A;  4H5D F;  5ILY A;  3ZOU A;  2Z7H A;  4KUX A;  1YHK A;  5B00 A;  4NFK F;  4LZ0 A;  3M9U A;  4F62 A;  3N3D A;  3B7L A;  1VG6 A;  5HNA A;  5CG5 A;  4KWD A;  2Z50 A;  5B0J A;  3CP6 A;  3VJ9 A;  3Q30 A;  2O1O A;  2ZY1 A;  4LFG A;  2FTZ A;  1UBV A;  2DH4 A;  2E93 A;  2VF6 A;  1N24 A;  2Z7I A;  3P8R A;  4KK2 A;  3VJE A;  2E95 A;  2E8T A;  4KQS A;  4WK5 A;  3KRF B;  3KBK A;  3WSA A;  2E8W A;  4KQ5 A;  3KRP A;  3G4F A;  3SDU A;  3WCJ A;  4HD1 A;  4DEM F;  3WCC A;  3N0G A;  3ICK A;  3N5H F;  5E8H A;  4LUU A;  5B0I A;  1YYS A;  3W7F A;  3RBM A;  3RYE A;  2AEL A;  5AEL A;  3IPI A;  2ZEV A;  5JV0 F;  5I1U A;  2Z4Z A;  2E8U A;  5A0I A;  2PS5 A;  5ERO A;  3KRC B;  4P0W A;  3VJA A;  3M02 A;  5DJP F;  2QIS A;  3IBA A;  2AEK A;  3TFV A;  3SDQ A;  3QKC A;  1WL2 A;  2ZCS A;  1VG2 A;  3TS7 A;  1VG7 A;  5HN8 A;  2AET A;  3VJD A;  3AE0 A;  4JZX A;  3LK5 A;  2J1O A;  3ACW A;  3SAE A;  5IN8 A;  1N22 A;  3LDW A;  2OGD A;  5ILK A;  3WCB A;  1JFA A;  3OAB B;  3ASX A;  4GA3 A;  5DJR F;  4KQU A;  5IK6 A;  3OYR A;  4LFV F;  5ILZ A;  4KPJ A;  2F9K F;  3BNY A;  1DGP A;  3KRC A;  3WCH A;  1N23 A;  5DIQ F;  5IMP A;  4OGU A;  4KVD A;  3DYF A;  4DXJ A;  5DW7 A;  4LTV A;  5DGN F;  4DI5 A;  3AQB B;  3WE9 A;  5B0M A;  3WCD A;  3KRA B;  3WCA A;  1WL3 A;  3MAV A;  1DI1 A;  3BNX A;  1PS1 A;  3KRP B;  3Q2Q A;  3NPK A;  4NKF A;  5E8L A;  4KFA A;  2OPN A;  3WEK A;  2OPM A;  4GP2 A;  3OAB A;  4UMJ A;  5B02 A;  2Q9Z A;  3ACY A;  1WY0 A;  3RMG A;  1V4H A;  2P1C A;  3KRO B;  1V4I A;  3S9V A;  3CKE A;  3P5P A;  5EAS A;  2F94 F;  5B0L A;  5A0J A;  5DHI A;  2AZL A;  3M0G A;  3NPR A;  3UCA A;  3ZMC A;  4PVX F;  2AZJ A;  4MC3 A;  4OMH A;  3KRA A;  4OKZ A;  3WC9 A;  3WJK A;  1N20 A;  2J1P A;  2E4O A;  5IKH A;  3S4J A;  3N49 F;  4XQT F;  3CC9 A;  4NG6 A;  4K10 A;  5ERN A;  4Q23 A;  3WEJ A;  3N5J F;  2F89 F;  4KKM A;  1UBY A;  4H5C F;  4LA5 A;  3KRO A;  3PYB A;  4LPG F;  5ILJ A;  5B0K A;  1YJ4 A;  4EA2 A;  5E8K A;  1HM7 A;  3LLW A;  3ICM A;  3Q1O A;  3WJN A;  2Z4X A;  1YYR A;  4KVW A;  3V66 A;  4LOB A;  4XQS F;  5HN7 A;  3LVS A;  3AQ0 A;  3VJB A;  3PDE A;  4KPD A;  3WCM A;  1N1B A;  3SDT A;  5ERM A;  2ZCO A;  5AHU B;  3TFN A;  3LEE A;  2I19 A;  4JXY A;  5JV2 F;  4RNQ A;  4JYX A;  3N1V F;  1HXC A;  4JVJ F;  5AYP A;  4QPF A;  5IL8 A;  1RTR A;  4NFJ F;  5CG6 A;  3ZL6 A;  4DWG A;  4EA0 A;  3N46 F;  2F92 F;  3WEI A;  1HX9 A;  2E90 A;  2ZCQ A;  5ILD A;  5DGS F;  4LLT A;  5DHK A;  4P0V A;  3TFP A;  1YYT A;  3QQV A;  4N9U A;  4EA1 A;  5JUZ F;  1UBW A;  4GAX A;  3ICZ A;  2EWG A;  5EAT A;  3N6K F;  5ILI A;  1V4E A;  3APZ A;  2PS8 A;  2ZCR A;  3TC1 A;  4NUA A;  4LXW A;  2Z52 A;  3N0F A;  4LA6 A;  3M00 A;  1YV5 A;  2AZK A;  4ZQ8 A;  1WL0 A;  1HXA A;  2E8V A;  2Z78 A;  3WCL A;  4LTZ A;  5IM1 A;  1JFG A;  1V4K A;  4RXE A;  2RAH A;  4PVY F;  4FP4 A;  3ICN A;  3SDV A;  5IKA A;  4RXC A;  2Q9Y A;  2Z4W A;  1N21 A;  2ONG A;  1WMW A;  3LOM A;  1VG3 A;  3EZ3 A;  3ZCD A;  5KSX F;  4LIX A;  5ILH A;  3WEH A;  1WL1 A;  3LGK A;  3EFQ A;  4E9U A;  2F8Z F;  5JA0 F;  3LGZ B;  1HXG A;  1RQI A;  5B03 A;  1WKZ A;  2Z4V A;  1ZW5 A;  1VG4 A;  4E1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...