3WJOA

Crystal structure of octaprenyl pyrophosphate synthase from escherichia coli with isopentenyl pyrophosphate (ipp)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
319
structure length
302
Chain Sequence
MNLEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYEGNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQMMTSLGSLKVLEVMSEAVNVIAEGEVLQLMNNYMRVIYSKTARLFEAAAQCSGILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNAVGDDLNEGKPTLPLLHAMHHGTPEQAQMIRTAIEQGNGRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQVLPDTPWREALIGLAHIAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Octaprenyl diphosphate synthase
publication title Crystal structures of ligand-bound octaprenyl pyrophosphate synthase from escherichia coli reveal the catalytic and chain-length determining mechanisms
pubmed doi rcsb
source organism Escherichia coli
total genus 121
structure length 302
sequence length 319
chains with identical sequence B
ec nomenclature ec 2.5.1.-:
pdb deposition date 2013-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3wjoA00
2ZEVA 5DGMF 1FPSA 5HN9A 3WEHA 4LXWA 4JXYA 1YHLA 3OACB 4LZ0A 3WCCA 4NKEA 1N1ZA 4LUUA 2E93A 3W7FA 3B7LA 5AFXA 2PS8A 3N46F 1HXGA 4NUAA 1V4IA 3DYGA 5E8LA 3N45F 5A0IA 3ICZA 4H5EF 4F62A 4JYXA 1HXCA 3VJCA 5B01A 3OYRA 4KWDA 1YQ7A 2ZCOA 4LFGA 3MAVA 2AETA 2OA6A 3UCAA 1YYSA 3LEEA 3P8RA 5ER8A 3ID0A 4NG6A 1UBXA 3WSAA 4DI5A 4Q23A 2E8VA 3ICMA 3ADZA 2Z4ZA 4F6XA 2Q58A 5CG6A 5HN8A 3M01A 3KROB 1WKZA 2VF6A 4PVXF 3KRAA 5JV1F 4GP2A 3TC1A 3DYHA 3KRPA 1JFGA 1PS1A 4NFKF 4MC0A 4EA2A 4OKMA 3N1VF 2F7MF 4RNQA 3N3LF 4E9ZA 3WCDA 2FTZA 3EZ3A 4KKMA 4P0XA 5ILZA 3Q2QA 4RXCA 4KQSA 4NKFA 4XQSF 5ERMA 3P8LA 4WK5A 1VG7A 3TFVA 3M02A 2E8TA 5DJPF 5EROA 2E8UA 3WCLA 2FORA 5A0JA 3LVSA 3TS7A 3VJDA 5DGNF 2J1PA 3ZMBA 2ZCQA 2E95A 2I19A 4EA0A 4XQTF 4NFIF 2Z7HA 5B0MA 1DGPA 5ILJA 2AZKA 3WE9A 1VG3A 5JV0F 4JXNA 3KB9A 4H5DF 3V1XA 2Z78A 3WEGA 5B0KA 4LOBA 4E1EA 3SDQA 3N5JF 4P0VA 5B02A 4RXAA 5EASA 5DHKA 3AE0A 5ILYA 2P1CA 3PKOA 4MC8A 3N0GA 4KVWA 3NPRA 1WL2A 3ZL6A 3S9VA 5IK9A 5IMNA 5E8KA 5JA0F 3V1VA 2ONHA 5IK6A 1VG2A 1YYUA 2F8CF 1VG4A 2ZY1A 3RMGA 1RTRA 3OABA 1RQJA 4N1ZF 2PS5A 4KQ5A 3SDTA 4DZWA 1KIYA 3BNXA 5B0LA 1KIZA 3Q1OA 2AZJA 1YHMA 2AELA 2E92A 4LFVF 4GP1A 2O1OA 5IVGA 3WSBA 4LA5A 1N24A 4QPFA 1HM7A 3AQBB 4KK2A 4QXSF 5IK0A 4OMHA 3PDEA 3WCMA 5DZ2A 3VJBA 3AQ0A 3G4DA 4LFEA 2Q9ZA 4DWGA 3LGZB 4RXEA 3WCIA 3LDWA 1YYTA 3EGTA 3Q2ZA 3M9UA 3G4FA 1YYQA 4OGUA 3WEFA 3KRCA 1EZFA 1WY0A 3PH7A 4K10A 3TFNA 4F6VA 4FJQA 1ZW5A 4P0WA 3WCFA 5KSXF 4LTZA 3ACWA 3WC9A 3LK5A 3WCHA 4PVYF 2PS6A 1UBVA 1N22A 3KRAB 4OMGA 5ILHA 1HXAA 1HX9A 3KRPB 4N9UA 5DW7A 3WCBA 2Z7IA 4DXJA 5JUZF 1UBYA 3M0GA 4LLSA 4H5CF 1WL3A 3LSNA 3M00A 3CC9A 3CKEA 5B00A 1N21A 4HD1A 3WEKA 3SDUA 1V4HA 5IMIA 2PS4A 5DJVF 3WEJA 3ZCDA 3NRIA 4JZXA 3LJIA 3N5HF 3TFPA 3WJNA 3KRFA 2F9KF 2Z4XA 2DH4A 4MC3A 1V4EA 2F8ZF 5DJRF 3ACYA 3WEIA 4LZCA 2E8XA 4LIXA 5A0KA 4DWBA 1N23A 4KVYA 4EA1A 5HN7A 5B0JA 3EFQA 3OACA 5I1UA 3P5PA 3SDVA 3IPIA 2EWGA 4NFJF 5JV2F 1UBWA 3ACXA 5IL8A 3CP6A 3MZVA 2F89F 3VJ9A 5ILIA 1V4KA 4KPDA 5E8HA 3VJ8A 1YYRA 3RYEA 3ASXA 2E90A 3N1WF 1YJ4A 4DHDA 2AEKA 2OGDA 5AHUB 5ILDA 4LPGF 2Z4YA 5IM1A 3SAEA 4LPHF 1DI1A 3P41A 4FP4A 3WCAA 4LA6A 4UMJA 4KQUA 5EAUA 3PYBA 2H8OA 3QKCA 3N3DA 3OABB 3LZ9A 2ZCSA 3N0FA 5ILKA 4JVJF 1V4JA 3QQVA 4L2XF 3S4JA 4JZBA 2AZLA 3KROA 5B0IA 4KPJA 3RBMA 4RXDA 3WJKA 2PS7A 3LOMA 4GA3A 1HM4A 1N20A 3LGKA 2J5CA 3ICKA 5IL3A 5ERNA 2ZCRA 3ZMCA 3N6KF 2OPNA 5CG5A 2E8WA 4OKZA 5IN8A 1RQIA 1N1BA 5IMPA 4ZQ8A 3KRCB 3V66A 3VJAA 5EATA 2Z4VA 3WJOA 5B03A 4LZ3A 2F92F 3AQCB 4GAXA 3WCGA 2OPMA 4DEMF 2E4OA 1VG6A 3APZA 5C05A 5HNAA 3Q30A 5IKHA 3IBAA 3NPKA 3RYWA 1YV5A 4RYPA 4KUXA 3VJEA 4KFAA 5DIQF 2QISA 3DYFA 3KBKA 3SDRA 1YHKA 2Z52A 2RAHA 3N49F 2F94F 2E94A 5AYPA 5DGSF 3P5RA 4E9UA 3WCJA 4LLTA 5DHIA 4KVIA 5H9DA 4KVDA 4XQRF 3NF2A 1WL1A 1WMWA 3PYAA 2Z4WA 3BNYA 2J1OA 2ZEUA 2Z50A 4LTVA 1WL0A 1JFAA 5AELA 3LG5A 5IKAA 3LMDA 3KRFB 3ICNA 3ZOUA 3LLWA 2Q80A 2Q9YA 2E91A 2ONGA 3WCEA
chains in the Genus database with same CATH superfamily
2ZEVA 5DGMF 1FPSA 5HN9A 3WEHA 4LXWA 4JXYA 1YHLA 3OACB 4LZ0A 3WCCA 4NKEA 1N1ZA 4LUUA 2E93A 3W7FA 3B7LA 5AFXA 2PS8A 3N46F 1HXGA 4NUAA 1V4IA 3DYGA 5E8LA 3N45F 5A0IA 3ICZA 4H5EF 4F62A 4JYXA 1HXCA 3VJCA 5B01A 3OYRA 4KWDA 1YQ7A 2ZCOA 4LFGA 3MAVA 2AETA 2OA6A 3UCAA 1YYSA 3LEEA 3P8RA 5ER8A 3ID0A 4NG6A 1UBXA 3WSAA 4DI5A 4Q23A 2E8VA 3ICMA 3ADZA 2Z4ZA 4F6XA 2Q58A 5CG6A 5HN8A 3M01A 3KROB 1WKZA 2VF6A 4PVXF 3KRAA 5JV1F 4GP2A 3TC1A 3DYHA 3KRPA 1JFGA 1PS1A 4NFKF 4MC0A 4EA2A 4OKMA 3N1VF 2F7MF 4RNQA 3N3LF 4E9ZA 3WCDA 2FTZA 3EZ3A 4KKMA 4P0XA 5ILZA 3Q2QA 4RXCA 4KQSA 4NKFA 4XQSF 5ERMA 3P8LA 4WK5A 1VG7A 3TFVA 3M02A 2E8TA 5DJPF 5EROA 2E8UA 3WCLA 2FORA 5A0JA 3LVSA 3TS7A 3VJDA 5DGNF 2J1PA 3ZMBA 2ZCQA 2E95A 2I19A 4EA0A 4XQTF 4NFIF 2Z7HA 5B0MA 1DGPA 5ILJA 2AZKA 3WE9A 1VG3A 5JV0F 4JXNA 3KB9A 4H5DF 3V1XA 2Z78A 3WEGA 5B0KA 4LOBA 4E1EA 3SDQA 3N5JF 4P0VA 5B02A 4RXAA 5EASA 5DHKA 3AE0A 5ILYA 2P1CA 3PKOA 4MC8A 3N0GA 4KVWA 3NPRA 1WL2A 3ZL6A 3S9VA 5IK9A 5IMNA 5E8KA 5JA0F 3V1VA 2ONHA 5IK6A 1VG2A 1YYUA 2F8CF 1VG4A 2ZY1A 3RMGA 1RTRA 3OABA 1RQJA 4N1ZF 2PS5A 4KQ5A 3SDTA 4DZWA 1KIYA 3BNXA 5B0LA 1KIZA 3Q1OA 2AZJA 1YHMA 2AELA 2E92A 4LFVF 4GP1A 2O1OA 5IVGA 3WSBA 4LA5A 1N24A 4QPFA 1HM7A 3AQBB 4KK2A 4QXSF 5IK0A 4OMHA 3PDEA 3WCMA 5DZ2A 3VJBA 3AQ0A 3G4DA 4LFEA 2Q9ZA 4DWGA 3LGZB 4RXEA 3WCIA 3LDWA 1YYTA 3EGTA 3Q2ZA 3M9UA 3G4FA 1YYQA 4OGUA 3WEFA 3KRCA 1EZFA 1WY0A 3PH7A 4K10A 3TFNA 4F6VA 4FJQA 1ZW5A 4P0WA 3WCFA 5KSXF 4LTZA 3ACWA 3WC9A 3LK5A 3WCHA 4PVYF 2PS6A 1UBVA 1N22A 3KRAB 4OMGA 5ILHA 1HXAA 1HX9A 3KRPB 4N9UA 5DW7A 3WCBA 2Z7IA 4DXJA 5JUZF 1UBYA 3M0GA 4LLSA 4H5CF 1WL3A 3LSNA 3M00A 3CC9A 3CKEA 5B00A 1N21A 4HD1A 3WEKA 3SDUA 1V4HA 5IMIA 2PS4A 5DJVF 3WEJA 3ZCDA 3NRIA 4JZXA 3LJIA 3N5HF 3TFPA 3WJNA 3KRFA 2F9KF 2Z4XA 2DH4A 4MC3A 1V4EA 2F8ZF 5DJRF 3ACYA 3WEIA 4LZCA 2E8XA 4LIXA 5A0KA 4DWBA 1N23A 4KVYA 4EA1A 5HN7A 5B0JA 3EFQA 3OACA 5I1UA 3P5PA 3SDVA 3IPIA 2EWGA 4NFJF 5JV2F 1UBWA 3ACXA 5IL8A 3CP6A 3MZVA 2F89F 3VJ9A 5ILIA 1V4KA 4KPDA 5E8HA 3VJ8A 1YYRA 3RYEA 3ASXA 2E90A 3N1WF 1YJ4A 4DHDA 2AEKA 2OGDA 5AHUB 5ILDA 4LPGF 2Z4YA 5IM1A 3SAEA 4LPHF 1DI1A 3P41A 4FP4A 3WCAA 4LA6A 4UMJA 4KQUA 5EAUA 3PYBA 2H8OA 3QKCA 3N3DA 3OABB 3LZ9A 2ZCSA 3N0FA 5ILKA 4JVJF 1V4JA 3QQVA 4L2XF 3S4JA 4JZBA 2AZLA 3KROA 5B0IA 4KPJA 3RBMA 4RXDA 3WJKA 2PS7A 3LOMA 4GA3A 1HM4A 1N20A 3LGKA 2J5CA 3ICKA 5IL3A 5ERNA 2ZCRA 3ZMCA 3N6KF 2OPNA 5CG5A 2E8WA 4OKZA 5IN8A 1RQIA 1N1BA 5IMPA 4ZQ8A 3KRCB 3V66A 3VJAA 5EATA 2Z4VA 3WJOA 5B03A 4LZ3A 2F92F 3AQCB 4GAXA 3WCGA 2OPMA 4DEMF 2E4OA 1VG6A 3APZA 5C05A 5HNAA 3Q30A 5IKHA 3IBAA 3NPKA 3RYWA 1YV5A 4RYPA 4KUXA 3VJEA 4KFAA 5DIQF 2QISA 3DYFA 3KBKA 3SDRA 1YHKA 2Z52A 2RAHA 3N49F 2F94F 2E94A 5AYPA 5DGSF 3P5RA 4E9UA 3WCJA 4LLTA 5DHIA 4KVIA 5H9DA 4KVDA 4XQRF 3NF2A 1WL1A 1WMWA 3PYAA 2Z4WA 3BNYA 2J1OA 2ZEUA 2Z50A 4LTVA 1WL0A 1JFAA 5AELA 3LG5A 5IKAA 3LMDA 3KRFB 3ICNA 3ZOUA 3LLWA 2Q80A 2Q9YA 2E91A 2ONGA 3WCEA
chains in the Genus database with same CATH topology
2ZEVA 5DGMF 1FPSA 5HN9A 3WEHA 4LXWA 4JXYA 1YHLA 3OACB 4LZ0A 3WCCA 4NKEA 1N1ZA 4LUUA 2E93A 3W7FA 3B7LA 5AFXA 2PS8A 3N46F 1HXGA 4NUAA 1V4IA 3DYGA 5E8LA 3N45F 5A0IA 3ICZA 4H5EF 4F62A 4JYXA 1HXCA 3VJCA 5B01A 3OYRA 4KWDA 1YQ7A 2ZCOA 4LFGA 3MAVA 2AETA 2OA6A 3UCAA 1YYSA 3LEEA 3P8RA 5ER8A 3ID0A 4NG6A 1UBXA 3WSAA 4DI5A 4Q23A 2E8VA 3ICMA 3ADZA 2Z4ZA 4F6XA 2Q58A 5CG6A 5HN8A 3M01A 3KROB 1WKZA 2VF6A 4PVXF 3KRAA 5JV1F 4GP2A 3TC1A 3DYHA 3KRPA 1JFGA 1PS1A 4NFKF 4MC0A 4EA2A 4OKMA 3N1VF 2F7MF 4RNQA 3N3LF 4E9ZA 3WCDA 2FTZA 3EZ3A 4KKMA 4P0XA 5ILZA 3Q2QA 4RXCA 4KQSA 4NKFA 4XQSF 5ERMA 3P8LA 4WK5A 1VG7A 3TFVA 3M02A 2E8TA 5DJPF 5EROA 2E8UA 3WCLA 2FORA 5A0JA 3LVSA 3TS7A 3VJDA 5DGNF 2J1PA 3ZMBA 2ZCQA 2E95A 2I19A 4EA0A 4XQTF 4NFIF 2Z7HA 5B0MA 1DGPA 5ILJA 2AZKA 3WE9A 1VG3A 5JV0F 4JXNA 3KB9A 4H5DF 3V1XA 2Z78A 3WEGA 5B0KA 4LOBA 4E1EA 3SDQA 3N5JF 4P0VA 5B02A 4RXAA 5EASA 5DHKA 3AE0A 5ILYA 2P1CA 3PKOA 4MC8A 3N0GA 4KVWA 3NPRA 1WL2A 3ZL6A 3S9VA 5IK9A 5IMNA 5E8KA 5JA0F 3V1VA 2ONHA 5IK6A 1VG2A 1YYUA 2F8CF 1VG4A 2ZY1A 3RMGA 1RTRA 3OABA 1RQJA 4N1ZF 2PS5A 4KQ5A 3SDTA 4DZWA 1KIYA 3BNXA 5B0LA 1KIZA 3Q1OA 2AZJA 1YHMA 2AELA 2E92A 4LFVF 4GP1A 2O1OA 5IVGA 3WSBA 4LA5A 1N24A 4QPFA 1HM7A 3AQBB 4KK2A 4QXSF 5IK0A 4OMHA 3PDEA 3WCMA 5DZ2A 3VJBA 3AQ0A 3G4DA 4LFEA 2Q9ZA 4DWGA 3LGZB 4RXEA 3WCIA 3LDWA 1YYTA 3EGTA 3Q2ZA 3M9UA 3G4FA 1YYQA 4OGUA 3WEFA 3KRCA 1EZFA 1WY0A 3PH7A 4K10A 3TFNA 4F6VA 4FJQA 1ZW5A 4P0WA 3WCFA 5KSXF 4LTZA 3ACWA 3WC9A 3LK5A 3WCHA 4PVYF 2PS6A 1UBVA 1N22A 3KRAB 4OMGA 5ILHA 1HXAA 1HX9A 3KRPB 4N9UA 5DW7A 3WCBA 2Z7IA 4DXJA 5JUZF 1UBYA 3M0GA 4LLSA 4H5CF 1WL3A 3LSNA 3M00A 3CC9A 3CKEA 5B00A 1N21A 4HD1A 3WEKA 3SDUA 1V4HA 5IMIA 2PS4A 5DJVF 3WEJA 3ZCDA 3NRIA 4JZXA 3LJIA 3N5HF 3TFPA 3WJNA 3KRFA 2F9KF 2Z4XA 2DH4A 4MC3A 1V4EA 2F8ZF 5DJRF 3ACYA 3WEIA 4LZCA 2E8XA 4LIXA 5A0KA 4DWBA 1N23A 4KVYA 4EA1A 5HN7A 5B0JA 3EFQA 3OACA 5I1UA 3P5PA 3SDVA 3IPIA 2EWGA 4NFJF 5JV2F 1UBWA 3ACXA 5IL8A 3CP6A 3MZVA 2F89F 3VJ9A 5ILIA 1V4KA 4KPDA 5E8HA 3VJ8A 1YYRA 3RYEA 3ASXA 2E90A 3N1WF 1YJ4A 4DHDA 2AEKA 2OGDA 5AHUB 5ILDA 4LPGF 2Z4YA 5IM1A 3SAEA 4LPHF 1DI1A 3P41A 4FP4A 3WCAA 4LA6A 4UMJA 4KQUA 5EAUA 3PYBA 2H8OA 3QKCA 3N3DA 3OABB 3LZ9A 2ZCSA 3N0FA 5ILKA 4JVJF 1V4JA 3QQVA 4L2XF 3S4JA 4JZBA 2AZLA 3KROA 5B0IA 4KPJA 3RBMA 4RXDA 3WJKA 2PS7A 3LOMA 4GA3A 1HM4A 1N20A 3LGKA 2J5CA 3ICKA 5IL3A 5ERNA 2ZCRA 3ZMCA 3N6KF 2OPNA 5CG5A 2E8WA 4OKZA 5IN8A 1RQIA 1N1BA 5IMPA 4ZQ8A 3KRCB 3V66A 3VJAA 5EATA 2Z4VA 3WJOA 5B03A 4LZ3A 2F92F 3AQCB 4GAXA 3WCGA 2OPMA 4DEMF 2E4OA 1VG6A 3APZA 5C05A 5HNAA 3Q30A 5IKHA 3IBAA 3NPKA 3RYWA 1YV5A 4RYPA 4KUXA 3VJEA 4KFAA 5DIQF 2QISA 3DYFA 3KBKA 3SDRA 1YHKA 2Z52A 2RAHA 3N49F 2F94F 2E94A 5AYPA 5DGSF 3P5RA 4E9UA 3WCJA 4LLTA 5DHIA 4KVIA 5H9DA 4KVDA 4XQRF 3NF2A 1WL1A 1WMWA 3PYAA 2Z4WA 3BNYA 2J1OA 2ZEUA 2Z50A 4LTVA 1WL0A 1JFAA 5AELA 3LG5A 5IKAA 3LMDA 3KRFB 3ICNA 3ZOUA 3LLWA 2Q80A 2Q9YA 2E91A 2ONGA 3WCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEV A;  5DGM F;  1FPS A;  5HN9 A;  3WEH A;  4LXW A;  4JXY A;  1YHL A;  3OAC B;  4LZ0 A;  3WCC A;  4NKE A;  1N1Z A;  4LUU A;  2E93 A;  3W7F A;  3B7L A;  5AFX A;  2PS8 A;  3N46 F;  1HXG A;  4NUA A;  1V4I A;  3DYG A;  5E8L A;  3N45 F;  5A0I A;  3ICZ A;  4H5E F;  4F62 A;  4JYX A;  1HXC A;  3VJC A;  5B01 A;  3OYR A;  4KWD A;  1YQ7 A;  2ZCO A;  4LFG A;  3MAV A;  2AET A;  2OA6 A;  3UCA A;  1YYS A;  3LEE A;  3P8R A;  5ER8 A;  3ID0 A;  4NG6 A;  1UBX A;  3WSA A;  4DI5 A;  4Q23 A;  2E8V A;  3ICM A;  3ADZ A;  2Z4Z A;  4F6X A;  2Q58 A;  5CG6 A;  5HN8 A;  3M01 A;  3KRO B;  1WKZ A;  2VF6 A;  4PVX F;  3KRA A;  5JV1 F;  4GP2 A;  3TC1 A;  3DYH A;  3KRP A;  1JFG A;  1PS1 A;  4NFK F;  4MC0 A;  4EA2 A;  4OKM A;  3N1V F;  2F7M F;  4RNQ A;  3N3L F;  4E9Z A;  3WCD A;  2FTZ A;  3EZ3 A;  4KKM A;  4P0X A;  5ILZ A;  3Q2Q A;  4RXC A;  4KQS A;  4NKF A;  4XQS F;  5ERM A;  3P8L A;  4WK5 A;  1VG7 A;  3TFV A;  3M02 A;  2E8T A;  5DJP F;  5ERO A;  2E8U A;  3WCL A;  2FOR A;  5A0J A;  3LVS A;  3TS7 A;  3VJD A;  5DGN F;  2J1P A;  3ZMB A;  2ZCQ A;  2E95 A;  2I19 A;  4EA0 A;  4XQT F;  4NFI F;  2Z7H A;  5B0M A;  1DGP A;  5ILJ A;  2AZK A;  3WE9 A;  1VG3 A;  5JV0 F;  4JXN A;  3KB9 A;  4H5D F;  3V1X A;  2Z78 A;  3WEG A;  5B0K A;  4LOB A;  4E1E A;  3SDQ A;  3N5J F;  4P0V A;  5B02 A;  4RXA A;  5EAS A;  5DHK A;  3AE0 A;  5ILY A;  2P1C A;  3PKO A;  4MC8 A;  3N0G A;  4KVW A;  3NPR A;  1WL2 A;  3ZL6 A;  3S9V A;  5IK9 A;  5IMN A;  5E8K A;  5JA0 F;  3V1V A;  2ONH A;  5IK6 A;  1VG2 A;  1YYU A;  2F8C F;  1VG4 A;  2ZY1 A;  3RMG A;  1RTR A;  3OAB A;  1RQJ A;  4N1Z F;  2PS5 A;  4KQ5 A;  3SDT A;  4DZW A;  1KIY A;  3BNX A;  5B0L A;  1KIZ A;  3Q1O A;  2AZJ A;  1YHM A;  2AEL A;  2E92 A;  4LFV F;  4GP1 A;  2O1O A;  5IVG A;  3WSB A;  4LA5 A;  1N24 A;  4QPF A;  1HM7 A;  3AQB B;  4KK2 A;  4QXS F;  5IK0 A;  4OMH A;  3PDE A;  3WCM A;  5DZ2 A;  3VJB A;  3AQ0 A;  3G4D A;  4LFE A;  2Q9Z A;  4DWG A;  3LGZ B;  4RXE A;  3WCI A;  3LDW A;  1YYT A;  3EGT A;  3Q2Z A;  3M9U A;  3G4F A;  1YYQ A;  4OGU A;  3WEF A;  3KRC A;  1EZF A;  1WY0 A;  3PH7 A;  4K10 A;  3TFN A;  4F6V A;  4FJQ A;  1ZW5 A;  4P0W A;  3WCF A;  5KSX F;  4LTZ A;  3ACW A;  3WC9 A;  3LK5 A;  3WCH A;  4PVY F;  2PS6 A;  1UBV A;  1N22 A;  3KRA B;  4OMG A;  5ILH A;  1HXA A;  1HX9 A;  3KRP B;  4N9U A;  5DW7 A;  3WCB A;  2Z7I A;  4DXJ A;  5JUZ F;  1UBY A;  3M0G A;  4LLS A;  4H5C F;  1WL3 A;  3LSN A;  3M00 A;  3CC9 A;  3CKE A;  5B00 A;  1N21 A;  4HD1 A;  3WEK A;  3SDU A;  1V4H A;  5IMI A;  2PS4 A;  5DJV F;  3WEJ A;  3ZCD A;  3NRI A;  4JZX A;  3LJI A;  3N5H F;  3TFP A;  3WJN A;  3KRF A;  2F9K F;  2Z4X A;  2DH4 A;  4MC3 A;  1V4E A;  2F8Z F;  5DJR F;  3ACY A;  3WEI A;  4LZC A;  2E8X A;  4LIX A;  5A0K A;  4DWB A;  1N23 A;  4KVY A;  4EA1 A;  5HN7 A;  5B0J A;  3EFQ A;  3OAC A;  5I1U A;  3P5P A;  3SDV A;  3IPI A;  2EWG A;  4NFJ F;  5JV2 F;  1UBW A;  3ACX A;  5IL8 A;  3CP6 A;  3MZV A;  2F89 F;  3VJ9 A;  5ILI A;  1V4K A;  4KPD A;  5E8H A;  3VJ8 A;  1YYR A;  3RYE A;  3ASX A;  2E90 A;  3N1W F;  1YJ4 A;  4DHD A;  2AEK A;  2OGD A;  5AHU B;  5ILD A;  4LPG F;  2Z4Y A;  5IM1 A;  3SAE A;  4LPH F;  1DI1 A;  3P41 A;  4FP4 A;  3WCA A;  4LA6 A;  4UMJ A;  4KQU A;  5EAU A;  3PYB A;  2H8O A;  3QKC A;  3N3D A;  3OAB B;  3LZ9 A;  2ZCS A;  3N0F A;  5ILK A;  4JVJ F;  1V4J A;  3QQV A;  4L2X F;  3S4J A;  4JZB A;  2AZL A;  3KRO A;  5B0I A;  4KPJ A;  3RBM A;  4RXD A;  3WJK A;  2PS7 A;  3LOM A;  4GA3 A;  1HM4 A;  1N20 A;  3LGK A;  2J5C A;  3ICK A;  5IL3 A;  5ERN A;  2ZCR A;  3ZMC A;  3N6K F;  2OPN A;  5CG5 A;  2E8W A;  4OKZ A;  5IN8 A;  1RQI A;  1N1B A;  5IMP A;  4ZQ8 A;  3KRC B;  3V66 A;  3VJA A;  5EAT A;  2Z4V A;  3WJO A;  5B03 A;  4LZ3 A;  2F92 F;  3AQC B;  4GAX A;  3WCG A;  2OPM A;  4DEM F;  2E4O A;  1VG6 A;  3APZ A;  5C05 A;  5HNA A;  3Q30 A;  5IKH A;  3IBA A;  3NPK A;  3RYW A;  1YV5 A;  4RYP A;  4KUX A;  3VJE A;  4KFA A;  5DIQ F;  2QIS A;  3DYF A;  3KBK A;  3SDR A;  1YHK A;  2Z52 A;  2RAH A;  3N49 F;  2F94 F;  2E94 A;  5AYP A;  5DGS F;  3P5R A;  4E9U A;  3WCJ A;  4LLT A;  5DHI A;  4KVI A;  5H9D A;  4KVD A;  4XQR F;  3NF2 A;  1WL1 A;  1WMW A;  3PYA A;  2Z4W A;  3BNY A;  2J1O A;  2ZEU A;  2Z50 A;  4LTV A;  1WL0 A;  1JFA A;  5AEL A;  3LG5 A;  5IKA A;  3LMD A;  3KRF B;  3ICN A;  3ZOU A;  3LLW A;  2Q80 A;  2Q9Y A;  2E91 A;  2ONG A;  3WCE A; 
#chains in the Genus database with same CATH topology
 2ZEV A;  5DGM F;  1FPS A;  5HN9 A;  3WEH A;  4LXW A;  4JXY A;  1YHL A;  3OAC B;  4LZ0 A;  3WCC A;  4NKE A;  1N1Z A;  4LUU A;  2E93 A;  3W7F A;  3B7L A;  5AFX A;  2PS8 A;  3N46 F;  1HXG A;  4NUA A;  1V4I A;  3DYG A;  5E8L A;  3N45 F;  5A0I A;  3ICZ A;  4H5E F;  4F62 A;  4JYX A;  1HXC A;  3VJC A;  5B01 A;  3OYR A;  4KWD A;  1YQ7 A;  2ZCO A;  4LFG A;  3MAV A;  2AET A;  2OA6 A;  3UCA A;  1YYS A;  3LEE A;  3P8R A;  5ER8 A;  3ID0 A;  4NG6 A;  1UBX A;  3WSA A;  4DI5 A;  4Q23 A;  2E8V A;  3ICM A;  3ADZ A;  2Z4Z A;  4F6X A;  2Q58 A;  5CG6 A;  5HN8 A;  3M01 A;  3KRO B;  1WKZ A;  2VF6 A;  4PVX F;  3KRA A;  5JV1 F;  4GP2 A;  3TC1 A;  3DYH A;  3KRP A;  1JFG A;  1PS1 A;  4NFK F;  4MC0 A;  4EA2 A;  4OKM A;  3N1V F;  2F7M F;  4RNQ A;  3N3L F;  4E9Z A;  3WCD A;  2FTZ A;  3EZ3 A;  4KKM A;  4P0X A;  5ILZ A;  3Q2Q A;  4RXC A;  4KQS A;  4NKF A;  4XQS F;  5ERM A;  3P8L A;  4WK5 A;  1VG7 A;  3TFV A;  3M02 A;  2E8T A;  5DJP F;  5ERO A;  2E8U A;  3WCL A;  2FOR A;  5A0J A;  3LVS A;  3TS7 A;  3VJD A;  5DGN F;  2J1P A;  3ZMB A;  2ZCQ A;  2E95 A;  2I19 A;  4EA0 A;  4XQT F;  4NFI F;  2Z7H A;  5B0M A;  1DGP A;  5ILJ A;  2AZK A;  3WE9 A;  1VG3 A;  5JV0 F;  4JXN A;  3KB9 A;  4H5D F;  3V1X A;  2Z78 A;  3WEG A;  5B0K A;  4LOB A;  4E1E A;  3SDQ A;  3N5J F;  4P0V A;  5B02 A;  4RXA A;  5EAS A;  5DHK A;  3AE0 A;  5ILY A;  2P1C A;  3PKO A;  4MC8 A;  3N0G A;  4KVW A;  3NPR A;  1WL2 A;  3ZL6 A;  3S9V A;  5IK9 A;  5IMN A;  5E8K A;  5JA0 F;  3V1V A;  2ONH A;  5IK6 A;  1VG2 A;  1YYU A;  2F8C F;  1VG4 A;  2ZY1 A;  3RMG A;  1RTR A;  3OAB A;  1RQJ A;  4N1Z F;  2PS5 A;  4KQ5 A;  3SDT A;  4DZW A;  1KIY A;  3BNX A;  5B0L A;  1KIZ A;  3Q1O A;  2AZJ A;  1YHM A;  2AEL A;  2E92 A;  4LFV F;  4GP1 A;  2O1O A;  5IVG A;  3WSB A;  4LA5 A;  1N24 A;  4QPF A;  1HM7 A;  3AQB B;  4KK2 A;  4QXS F;  5IK0 A;  4OMH A;  3PDE A;  3WCM A;  5DZ2 A;  3VJB A;  3AQ0 A;  3G4D A;  4LFE A;  2Q9Z A;  4DWG A;  3LGZ B;  4RXE A;  3WCI A;  3LDW A;  1YYT A;  3EGT A;  3Q2Z A;  3M9U A;  3G4F A;  1YYQ A;  4OGU A;  3WEF A;  3KRC A;  1EZF A;  1WY0 A;  3PH7 A;  4K10 A;  3TFN A;  4F6V A;  4FJQ A;  1ZW5 A;  4P0W A;  3WCF A;  5KSX F;  4LTZ A;  3ACW A;  3WC9 A;  3LK5 A;  3WCH A;  4PVY F;  2PS6 A;  1UBV A;  1N22 A;  3KRA B;  4OMG A;  5ILH A;  1HXA A;  1HX9 A;  3KRP B;  4N9U A;  5DW7 A;  3WCB A;  2Z7I A;  4DXJ A;  5JUZ F;  1UBY A;  3M0G A;  4LLS A;  4H5C F;  1WL3 A;  3LSN A;  3M00 A;  3CC9 A;  3CKE A;  5B00 A;  1N21 A;  4HD1 A;  3WEK A;  3SDU A;  1V4H A;  5IMI A;  2PS4 A;  5DJV F;  3WEJ A;  3ZCD A;  3NRI A;  4JZX A;  3LJI A;  3N5H F;  3TFP A;  3WJN A;  3KRF A;  2F9K F;  2Z4X A;  2DH4 A;  4MC3 A;  1V4E A;  2F8Z F;  5DJR F;  3ACY A;  3WEI A;  4LZC A;  2E8X A;  4LIX A;  5A0K A;  4DWB A;  1N23 A;  4KVY A;  4EA1 A;  5HN7 A;  5B0J A;  3EFQ A;  3OAC A;  5I1U A;  3P5P A;  3SDV A;  3IPI A;  2EWG A;  4NFJ F;  5JV2 F;  1UBW A;  3ACX A;  5IL8 A;  3CP6 A;  3MZV A;  2F89 F;  3VJ9 A;  5ILI A;  1V4K A;  4KPD A;  5E8H A;  3VJ8 A;  1YYR A;  3RYE A;  3ASX A;  2E90 A;  3N1W F;  1YJ4 A;  4DHD A;  2AEK A;  2OGD A;  5AHU B;  5ILD A;  4LPG F;  2Z4Y A;  5IM1 A;  3SAE A;  4LPH F;  1DI1 A;  3P41 A;  4FP4 A;  3WCA A;  4LA6 A;  4UMJ A;  4KQU A;  5EAU A;  3PYB A;  2H8O A;  3QKC A;  3N3D A;  3OAB B;  3LZ9 A;  2ZCS A;  3N0F A;  5ILK A;  4JVJ F;  1V4J A;  3QQV A;  4L2X F;  3S4J A;  4JZB A;  2AZL A;  3KRO A;  5B0I A;  4KPJ A;  3RBM A;  4RXD A;  3WJK A;  2PS7 A;  3LOM A;  4GA3 A;  1HM4 A;  1N20 A;  3LGK A;  2J5C A;  3ICK A;  5IL3 A;  5ERN A;  2ZCR A;  3ZMC A;  3N6K F;  2OPN A;  5CG5 A;  2E8W A;  4OKZ A;  5IN8 A;  1RQI A;  1N1B A;  5IMP A;  4ZQ8 A;  3KRC B;  3V66 A;  3VJA A;  5EAT A;  2Z4V A;  3WJO A;  5B03 A;  4LZ3 A;  2F92 F;  3AQC B;  4GAX A;  3WCG A;  2OPM A;  4DEM F;  2E4O A;  1VG6 A;  3APZ A;  5C05 A;  5HNA A;  3Q30 A;  5IKH A;  3IBA A;  3NPK A;  3RYW A;  1YV5 A;  4RYP A;  4KUX A;  3VJE A;  4KFA A;  5DIQ F;  2QIS A;  3DYF A;  3KBK A;  3SDR A;  1YHK A;  2Z52 A;  2RAH A;  3N49 F;  2F94 F;  2E94 A;  5AYP A;  5DGS F;  3P5R A;  4E9U A;  3WCJ A;  4LLT A;  5DHI A;  4KVI A;  5H9D A;  4KVD A;  4XQR F;  3NF2 A;  1WL1 A;  1WMW A;  3PYA A;  2Z4W A;  3BNY A;  2J1O A;  2ZEU A;  2Z50 A;  4LTV A;  1WL0 A;  1JFA A;  5AEL A;  3LG5 A;  5IKA A;  3LMD A;  3KRF B;  3ICN A;  3ZOU A;  3LLW A;  2Q80 A;  2Q9Y A;  2E91 A;  2ONG A;  3WCE A; 
#chains in the Genus database with same CATH homology
 2ZEV A;  5DGM F;  1FPS A;  5HN9 A;  3WEH A;  4LXW A;  4JXY A;  1YHL A;  3OAC B;  4LZ0 A;  3WCC A;  4NKE A;  1N1Z A;  4LUU A;  2E93 A;  3W7F A;  3B7L A;  5AFX A;  2PS8 A;  3N46 F;  1HXG A;  4NUA A;  1V4I A;  3DYG A;  5E8L A;  3N45 F;  5A0I A;  3ICZ A;  4H5E F;  4F62 A;  4JYX A;  1HXC A;  3VJC A;  5B01 A;  3OYR A;  4KWD A;  1YQ7 A;  2ZCO A;  4LFG A;  3MAV A;  2AET A;  2OA6 A;  3UCA A;  1YYS A;  3LEE A;  3P8R A;  5ER8 A;  3ID0 A;  4NG6 A;  1UBX A;  3WSA A;  4DI5 A;  4Q23 A;  2E8V A;  3ICM A;  3ADZ A;  2Z4Z A;  4F6X A;  2Q58 A;  5CG6 A;  5HN8 A;  3M01 A;  3KRO B;  1WKZ A;  2VF6 A;  4PVX F;  3KRA A;  5JV1 F;  4GP2 A;  3TC1 A;  3DYH A;  3KRP A;  1JFG A;  1PS1 A;  4NFK F;  4MC0 A;  4EA2 A;  4OKM A;  3N1V F;  2F7M F;  4RNQ A;  3N3L F;  4E9Z A;  3WCD A;  2FTZ A;  3EZ3 A;  4KKM A;  4P0X A;  5ILZ A;  3Q2Q A;  4RXC A;  4KQS A;  4NKF A;  4XQS F;  5ERM A;  3P8L A;  4WK5 A;  1VG7 A;  3TFV A;  3M02 A;  2E8T A;  5DJP F;  5ERO A;  2E8U A;  3WCL A;  2FOR A;  5A0J A;  3LVS A;  3TS7 A;  3VJD A;  5DGN F;  2J1P A;  3ZMB A;  2ZCQ A;  2E95 A;  2I19 A;  4EA0 A;  4XQT F;  4NFI F;  2Z7H A;  5B0M A;  1DGP A;  5ILJ A;  2AZK A;  3WE9 A;  1VG3 A;  5JV0 F;  4JXN A;  3KB9 A;  4H5D F;  3V1X A;  2Z78 A;  3WEG A;  5B0K A;  4LOB A;  4E1E A;  3SDQ A;  3N5J F;  4P0V A;  5B02 A;  4RXA A;  5EAS A;  5DHK A;  3AE0 A;  5ILY A;  2P1C A;  3PKO A;  4MC8 A;  3N0G A;  4KVW A;  3NPR A;  1WL2 A;  3ZL6 A;  3S9V A;  5IK9 A;  5IMN A;  5E8K A;  5JA0 F;  3V1V A;  2ONH A;  5IK6 A;  1VG2 A;  1YYU A;  2F8C F;  1VG4 A;  2ZY1 A;  3RMG A;  1RTR A;  3OAB A;  1RQJ A;  4N1Z F;  2PS5 A;  4KQ5 A;  3SDT A;  4DZW A;  1KIY A;  3BNX A;  5B0L A;  1KIZ A;  3Q1O A;  2AZJ A;  1YHM A;  2AEL A;  2E92 A;  4LFV F;  4GP1 A;  2O1O A;  5IVG A;  3WSB A;  4LA5 A;  1N24 A;  4QPF A;  1HM7 A;  3AQB B;  4KK2 A;  4QXS F;  5IK0 A;  4OMH A;  3PDE A;  3WCM A;  5DZ2 A;  3VJB A;  3AQ0 A;  3G4D A;  4LFE A;  2Q9Z A;  4DWG A;  3LGZ B;  4RXE A;  3WCI A;  3LDW A;  1YYT A;  3EGT A;  3Q2Z A;  3M9U A;  3G4F A;  1YYQ A;  4OGU A;  3WEF A;  3KRC A;  1EZF A;  1WY0 A;  3PH7 A;  4K10 A;  3TFN A;  4F6V A;  4FJQ A;  1ZW5 A;  4P0W A;  3WCF A;  5KSX F;  4LTZ A;  3ACW A;  3WC9 A;  3LK5 A;  3WCH A;  4PVY F;  2PS6 A;  1UBV A;  1N22 A;  3KRA B;  4OMG A;  5ILH A;  1HXA A;  1HX9 A;  3KRP B;  4N9U A;  5DW7 A;  3WCB A;  2Z7I A;  4DXJ A;  5JUZ F;  1UBY A;  3M0G A;  4LLS A;  4H5C F;  1WL3 A;  3LSN A;  3M00 A;  3CC9 A;  3CKE A;  5B00 A;  1N21 A;  4HD1 A;  3WEK A;  3SDU A;  1V4H A;  5IMI A;  2PS4 A;  5DJV F;  3WEJ A;  3ZCD A;  3NRI A;  4JZX A;  3LJI A;  3N5H F;  3TFP A;  3WJN A;  3KRF A;  2F9K F;  2Z4X A;  2DH4 A;  4MC3 A;  1V4E A;  2F8Z F;  5DJR F;  3ACY A;  3WEI A;  4LZC A;  2E8X A;  4LIX A;  5A0K A;  4DWB A;  1N23 A;  4KVY A;  4EA1 A;  5HN7 A;  5B0J A;  3EFQ A;  3OAC A;  5I1U A;  3P5P A;  3SDV A;  3IPI A;  2EWG A;  4NFJ F;  5JV2 F;  1UBW A;  3ACX A;  5IL8 A;  3CP6 A;  3MZV A;  2F89 F;  3VJ9 A;  5ILI A;  1V4K A;  4KPD A;  5E8H A;  3VJ8 A;  1YYR A;  3RYE A;  3ASX A;  2E90 A;  3N1W F;  1YJ4 A;  4DHD A;  2AEK A;  2OGD A;  5AHU B;  5ILD A;  4LPG F;  2Z4Y A;  5IM1 A;  3SAE A;  4LPH F;  1DI1 A;  3P41 A;  4FP4 A;  3WCA A;  4LA6 A;  4UMJ A;  4KQU A;  5EAU A;  3PYB A;  2H8O A;  3QKC A;  3N3D A;  3OAB B;  3LZ9 A;  2ZCS A;  3N0F A;  5ILK A;  4JVJ F;  1V4J A;  3QQV A;  4L2X F;  3S4J A;  4JZB A;  2AZL A;  3KRO A;  5B0I A;  4KPJ A;  3RBM A;  4RXD A;  3WJK A;  2PS7 A;  3LOM A;  4GA3 A;  1HM4 A;  1N20 A;  3LGK A;  2J5C A;  3ICK A;  5IL3 A;  5ERN A;  2ZCR A;  3ZMC A;  3N6K F;  2OPN A;  5CG5 A;  2E8W A;  4OKZ A;  5IN8 A;  1RQI A;  1N1B A;  5IMP A;  4ZQ8 A;  3KRC B;  3V66 A;  3VJA A;  5EAT A;  2Z4V A;  3WJO A;  5B03 A;  4LZ3 A;  2F92 F;  3AQC B;  4GAX A;  3WCG A;  2OPM A;  4DEM F;  2E4O A;  1VG6 A;  3APZ A;  5C05 A;  5HNA A;  3Q30 A;  5IKH A;  3IBA A;  3NPK A;  3RYW A;  1YV5 A;  4RYP A;  4KUX A;  3VJE A;  4KFA A;  5DIQ F;  2QIS A;  3DYF A;  3KBK A;  3SDR A;  1YHK A;  2Z52 A;  2RAH A;  3N49 F;  2F94 F;  2E94 A;  5AYP A;  5DGS F;  3P5R A;  4E9U A;  3WCJ A;  4LLT A;  5DHI A;  4KVI A;  5H9D A;  4KVD A;  4XQR F;  3NF2 A;  1WL1 A;  1WMW A;  3PYA A;  2Z4W A;  3BNY A;  2J1O A;  2ZEU A;  2Z50 A;  4LTV A;  1WL0 A;  1JFA A;  5AEL A;  3LG5 A;  5IKA A;  3LMD A;  3KRF B;  3ICN A;  3ZOU A;  3LLW A;  2Q80 A;  2Q9Y A;  2E91 A;  2ONG A;  3WCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...