3WJOA

Crystal structure of octaprenyl pyrophosphate synthase from escherichia coli with isopentenyl pyrophosphate (ipp)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
319
structure length
302
Chain Sequence
MNLEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYEGNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQMMTSLGSLKVLEVMSEAVNVIAEGEVLQLMNNYMRVIYSKTARLFEAAAQCSGILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNAVGDDLNEGKPTLPLLHAMHHGTPEQAQMIRTAIEQGNGRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQVLPDTPWREALIGLAHIAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Octaprenyl diphosphate synthase
publication title Crystal structures of ligand-bound octaprenyl pyrophosphate synthase from escherichia coli reveal the catalytic and chain-length determining mechanisms
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 121
structure length 302
sequence length 319
chains with identical sequence B
ec nomenclature ec 2.5.1.-:
pdb deposition date 2013-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3wjoA00
3KRPA 4OKMA 5IK6A 5E8HA 3TC1A 3WSBA 4EA2A 5IL8A 5IL3A 4LZ3A 4LFVF 3VJBA 4L2XF 1RTRA 4LFEA 2Q9YA 1WY0A 3VJDA 3WEKA 3LLWA 5IVGA 4KPDA 2I19A 4KPJA 3WEJA 2ONGA 5AELA 3ZMCA 3KRFA 2F94F 1VG3A 2PS6A 4KVIA 4JZBA 3LZ9A 3WEHA 3TS7A 4RNQA 3LVSA 4GAXA 4KK2A 4PVYF 1WL3A 3PDEA 1WKZA 5IMPA 4LOBA 4XQTF 4UMJA 1YYSA 4E1EA 3QKCA 5ER8A 2OGDA 3N0FA 5H9DA 3V66A 5KSXF 4PVXF 5CG5A 4KWDA 3LGZB 1HX9A 1WL2A 4HD1A 5DGSF 4F6XA 3MAVA 3VJEA 5DJRF 3SDTA 1V4HA 4NKFA 4OGUA 5IMNA 3LK5A 4H5EF 2Z4ZA 1DGPA 1V4EA 3KRFB 3N49F 5B0JA 4RXDA 2Z4XA 3M9UA 3ASXA 4DWGA 4QPFA 5HNAA 3IBAA 3SDRA 3KRAA 5ILKA 5EASA 3WCFA 2ZEVA 4DI5A 3WJNA 2E93A 3PKOA 2AZKA 2F9KF 2F8CF 3ZMBA 4N9UA 5C05A 4LUUA 4JZXA 4JVJF 5ILIA 2PS5A 3SDUA 3OABA 3S4JA 4NFIF 2F89F 5EATA 3TFNA 4LXWA 2Z4VA 3M02A 2F7MF 4RXCA 3S9VA 3WCGA 3EZ3A 1YHKA 5A0JA 4E9ZA 1N23A 5CG6A 1RQIA 1ZW5A 5DGMF 4P0WA 3RYWA 3KRAB 3NF2A 1UBWA 3VJCA 5DHIA 2Z52A 3OACB 5ILYA 3Q1OA 1WMWA 5B00A 3LDWA 4KVWA 3N3DA 3ICNA 3ACXA 2J5CA 2ZCSA 2AZLA 3NPKA 3OYRA 2E8VA 3WCHA 3OABB 4H5DF 4LLSA 2E8TA 1V4IA 4NG6A 2E92A 3WEIA 3WCAA 1HXCA 4LPHF 5IK0A 1WL0A 4WK5A 2AZJA 4P0XA 3WEGA 3ICKA 4KQSA 5I1UA 1YYRA 4QXSF 3EGTA 3ICMA 3P5RA 4LIXA 5ILHA 4DZWA 3P8LA 2Z4WA 5DZ2A 5HN7A 3P8RA 4KVYA 4LA6A 3KRPB 2Q9ZA 5A0IA 4Q23A 4JYXA 1UBVA 4MC8A 3LG5A 5A0KA 2E8WA 3Q2QA 3NRIA 3LEEA 2Z78A 3RMGA 3TFPA 3G4FA 1FPSA 3BNXA 2H8OA 2Z4YA 2Q80A 3ZL6A 2PS7A 4KVDA 4XQRF 5B02A 3KROA 4F6VA 5JV2F 4KUXA 2OPMA 3N5JF 4XQSF 3WCBA 4KQ5A 3NPRA 4RXAA 2F8ZF 3SDQA 3N46F 3DYGA 1VG7A 5ERMA 5IKHA 3W7FA 1YHLA 4GA3A 1WL1A 3ACYA 4OKZA 4NFKF 3V1VA 2AEKA 4EA1A 2ZCQA 4N1ZF 3WCJA 3KRCA 3DYHA 3N6KF 3PH7A 5DHKA 5IN8A 3PYAA 5B03A 1VG2A 1N1BA 3B7LA 3ID0A 2PS8A 3KROB 3N1VF 5B0IA 3WCMA 1KIYA 1N1ZA 2E95A 3ACWA 4JXYA 5E8KA 1HM4A 1KIZA 3Q2ZA 3LSNA 4MC0A 1N21A 5IK9A 5AFXA 2E8XA 4P0VA 3WCIA 2Z7IA 1DI1A 2E8UA 4OMHA 4FJQA 2E91A 2P1CA 4MC3A 3M0GA 1UBYA 4DWBA 4FP4A 4LZ0A 5ILZA 2E94A 3AQ0A 2F92F 4RXEA 5AYPA 3KRCB 5B01A 5JUZF 5HN9A 3UCAA 3P41A 1HM7A 3WJKA 3KB9A 2J1PA 2ZCRA 2PS4A 3LOMA 1YV5A 2OPNA 4EA0A 4H5CF 4DXJA 1V4JA 3WE9A 4K10A 5IM1A 5ERNA 3DYFA 1JFGA 2ZEUA 4LTVA 4GP1A 4DEMF 2OA6A 3QQVA 4LLTA 4LZCA 3WCCA 3MZVA 3M00A 3CC9A 3AQBB 3WSAA 5DJVF 1YYQA 1N22A 1EZFA 2AELA 1V4KA 4LPGF 5JV1F 3LJIA 2FORA 1YYTA 3VJAA 4DHDA 2Q58A 3V1XA 3LGKA 2RAHA 3ADZA 5DW7A 3TFVA 5EAUA 5ILJA 3G4DA 1RQJA 2DH4A 2ZY1A 4KKMA 3SAEA 4LA5A 5IMIA 2O1OA 3WEFA 3WCDA 1YQ7A 2FTZA 4LFGA 5HN8A 3N45F 3VJ8A 3N1WF 2ONHA 5DGNF 4E9UA 1YYUA 3M01A 3WJOA 5EROA 2AETA 2E90A 5JV0F 2Z7HA 3OACA 1PS1A 3IPIA 1JFAA 3VJ9A 5B0KA 5AHUB 3WC9A 4OMGA 5B0LA 3WCEA 3ICZA 3APZA 3BNYA 2E4OA 1VG6A 3ZCDA 4NFJF 3KBKA 4KQUA 3N5HF 4RYPA 4ZQ8A 5DIQF 3AQCB 4GP2A 3PYBA 3AE0A 5JA0F 1YJ4A 1YHMA 1N24A 3Q30A 4KFAA 3RBMA 4F62A 1N20A 4LTZA 5E8LA 2QISA 3CP6A 2Z50A 1VG4A 3EFQA 3P5PA 1HXGA 3N0GA 5IKAA 4NKEA 3LMDA 3SDVA 3N3LF 3ZOUA 2ZCOA 3CKEA 1HXAA 5DJPF 2J1OA 4NUAA 3RYEA 1UBXA 4JXNA 2EWGA 5B0MA 2VF6A 3WCLA 5ILDA
chains in the Genus database with same CATH superfamily
3KRPA 4OKMA 5IK6A 5E8HA 3TC1A 3WSBA 4EA2A 5IL8A 5IL3A 4LZ3A 4LFVF 3VJBA 4L2XF 1RTRA 4LFEA 2Q9YA 1WY0A 3VJDA 3WEKA 3LLWA 5IVGA 4KPDA 2I19A 4KPJA 3WEJA 2ONGA 5AELA 3ZMCA 3KRFA 2F94F 1VG3A 2PS6A 4KVIA 4JZBA 3LZ9A 3WEHA 3TS7A 4RNQA 3LVSA 4GAXA 4KK2A 4PVYF 1WL3A 3PDEA 1WKZA 5IMPA 4LOBA 4XQTF 4UMJA 1YYSA 4E1EA 3QKCA 5ER8A 2OGDA 3N0FA 5H9DA 3V66A 5KSXF 4PVXF 5CG5A 4KWDA 3LGZB 1HX9A 1WL2A 4HD1A 5DGSF 4F6XA 3MAVA 3VJEA 5DJRF 3SDTA 1V4HA 4NKFA 4OGUA 5IMNA 3LK5A 4H5EF 2Z4ZA 1DGPA 1V4EA 3KRFB 3N49F 5B0JA 4RXDA 2Z4XA 3M9UA 3ASXA 4DWGA 4QPFA 5HNAA 3IBAA 3SDRA 3KRAA 5ILKA 5EASA 3WCFA 2ZEVA 4DI5A 3WJNA 2E93A 3PKOA 2AZKA 2F9KF 2F8CF 3ZMBA 4N9UA 5C05A 4LUUA 4JZXA 4JVJF 5ILIA 2PS5A 3SDUA 3OABA 3S4JA 4NFIF 2F89F 5EATA 3TFNA 4LXWA 2Z4VA 3M02A 2F7MF 4RXCA 3S9VA 3WCGA 3EZ3A 1YHKA 5A0JA 4E9ZA 1N23A 5CG6A 1RQIA 1ZW5A 5DGMF 4P0WA 3RYWA 3KRAB 3NF2A 1UBWA 3VJCA 5DHIA 2Z52A 3OACB 5ILYA 3Q1OA 1WMWA 5B00A 3LDWA 4KVWA 3N3DA 3ICNA 3ACXA 2J5CA 2ZCSA 2AZLA 3NPKA 3OYRA 2E8VA 3WCHA 3OABB 4H5DF 4LLSA 2E8TA 1V4IA 4NG6A 2E92A 3WEIA 3WCAA 1HXCA 4LPHF 5IK0A 1WL0A 4WK5A 2AZJA 4P0XA 3WEGA 3ICKA 4KQSA 5I1UA 1YYRA 4QXSF 3EGTA 3ICMA 3P5RA 4LIXA 5ILHA 4DZWA 3P8LA 2Z4WA 5DZ2A 5HN7A 3P8RA 4KVYA 4LA6A 3KRPB 2Q9ZA 5A0IA 4Q23A 4JYXA 1UBVA 4MC8A 3LG5A 5A0KA 2E8WA 3Q2QA 3NRIA 3LEEA 2Z78A 3RMGA 3TFPA 3G4FA 1FPSA 3BNXA 2H8OA 2Z4YA 2Q80A 3ZL6A 2PS7A 4KVDA 4XQRF 5B02A 3KROA 4F6VA 5JV2F 4KUXA 2OPMA 3N5JF 4XQSF 3WCBA 4KQ5A 3NPRA 4RXAA 2F8ZF 3SDQA 3N46F 3DYGA 1VG7A 5ERMA 5IKHA 3W7FA 1YHLA 4GA3A 1WL1A 3ACYA 4OKZA 4NFKF 3V1VA 2AEKA 4EA1A 2ZCQA 4N1ZF 3WCJA 3KRCA 3DYHA 3N6KF 3PH7A 5DHKA 5IN8A 3PYAA 5B03A 1VG2A 1N1BA 3B7LA 3ID0A 2PS8A 3KROB 3N1VF 5B0IA 3WCMA 1KIYA 1N1ZA 2E95A 3ACWA 4JXYA 5E8KA 1HM4A 1KIZA 3Q2ZA 3LSNA 4MC0A 1N21A 5IK9A 5AFXA 2E8XA 4P0VA 3WCIA 2Z7IA 1DI1A 2E8UA 4OMHA 4FJQA 2E91A 2P1CA 4MC3A 3M0GA 1UBYA 4DWBA 4FP4A 4LZ0A 5ILZA 2E94A 3AQ0A 2F92F 4RXEA 5AYPA 3KRCB 5B01A 5JUZF 5HN9A 3UCAA 3P41A 1HM7A 3WJKA 3KB9A 2J1PA 2ZCRA 2PS4A 3LOMA 1YV5A 2OPNA 4EA0A 4H5CF 4DXJA 1V4JA 3WE9A 4K10A 5IM1A 5ERNA 3DYFA 1JFGA 2ZEUA 4LTVA 4GP1A 4DEMF 2OA6A 3QQVA 4LLTA 4LZCA 3WCCA 3MZVA 3M00A 3CC9A 3AQBB 3WSAA 5DJVF 1YYQA 1N22A 1EZFA 2AELA 1V4KA 4LPGF 5JV1F 3LJIA 2FORA 1YYTA 3VJAA 4DHDA 2Q58A 3V1XA 3LGKA 2RAHA 3ADZA 5DW7A 3TFVA 5EAUA 5ILJA 3G4DA 1RQJA 2DH4A 2ZY1A 4KKMA 3SAEA 4LA5A 5IMIA 2O1OA 3WEFA 3WCDA 1YQ7A 2FTZA 4LFGA 5HN8A 3N45F 3VJ8A 3N1WF 2ONHA 5DGNF 4E9UA 1YYUA 3M01A 3WJOA 5EROA 2AETA 2E90A 5JV0F 2Z7HA 3OACA 1PS1A 3IPIA 1JFAA 3VJ9A 5B0KA 5AHUB 3WC9A 4OMGA 5B0LA 3WCEA 3ICZA 3APZA 3BNYA 2E4OA 1VG6A 3ZCDA 4NFJF 3KBKA 4KQUA 3N5HF 4RYPA 4ZQ8A 5DIQF 3AQCB 4GP2A 3PYBA 3AE0A 5JA0F 1YJ4A 1YHMA 1N24A 3Q30A 4KFAA 3RBMA 4F62A 1N20A 4LTZA 5E8LA 2QISA 3CP6A 2Z50A 1VG4A 3EFQA 3P5PA 1HXGA 3N0GA 5IKAA 4NKEA 3LMDA 3SDVA 3N3LF 3ZOUA 2ZCOA 3CKEA 1HXAA 5DJPF 2J1OA 4NUAA 3RYEA 1UBXA 4JXNA 2EWGA 5B0MA 2VF6A 3WCLA 5ILDA
chains in the Genus database with same CATH topology
3KRPA 4OKMA 5IK6A 5E8HA 3TC1A 3WSBA 4EA2A 5IL8A 5IL3A 4LZ3A 4LFVF 3VJBA 4L2XF 1RTRA 4LFEA 2Q9YA 1WY0A 3VJDA 3WEKA 3LLWA 5IVGA 4KPDA 2I19A 4KPJA 3WEJA 2ONGA 5AELA 3ZMCA 3KRFA 2F94F 1VG3A 2PS6A 4KVIA 4JZBA 3LZ9A 3WEHA 3TS7A 4RNQA 3LVSA 4GAXA 4KK2A 4PVYF 1WL3A 3PDEA 1WKZA 5IMPA 4LOBA 4XQTF 4UMJA 1YYSA 4E1EA 3QKCA 5ER8A 2OGDA 3N0FA 5H9DA 3V66A 5KSXF 4PVXF 5CG5A 4KWDA 3LGZB 1HX9A 1WL2A 4HD1A 5DGSF 4F6XA 3MAVA 3VJEA 5DJRF 3SDTA 1V4HA 4NKFA 4OGUA 5IMNA 3LK5A 4H5EF 2Z4ZA 1DGPA 1V4EA 3KRFB 3N49F 5B0JA 4RXDA 2Z4XA 3M9UA 3ASXA 4DWGA 4QPFA 5HNAA 3IBAA 3SDRA 3KRAA 5ILKA 5EASA 3WCFA 2ZEVA 4DI5A 3WJNA 2E93A 3PKOA 2AZKA 2F9KF 2F8CF 3ZMBA 4N9UA 5C05A 4LUUA 4JZXA 4JVJF 5ILIA 2PS5A 3SDUA 3OABA 3S4JA 4NFIF 2F89F 5EATA 3TFNA 4LXWA 2Z4VA 3M02A 2F7MF 4RXCA 3S9VA 3WCGA 3EZ3A 1YHKA 5A0JA 4E9ZA 1N23A 5CG6A 1RQIA 1ZW5A 5DGMF 4P0WA 3RYWA 3KRAB 3NF2A 1UBWA 3VJCA 5DHIA 2Z52A 3OACB 5ILYA 3Q1OA 1WMWA 5B00A 3LDWA 4KVWA 3N3DA 3ICNA 3ACXA 2J5CA 2ZCSA 2AZLA 3NPKA 3OYRA 2E8VA 3WCHA 3OABB 4H5DF 4LLSA 2E8TA 1V4IA 4NG6A 2E92A 3WEIA 3WCAA 1HXCA 4LPHF 5IK0A 1WL0A 4WK5A 2AZJA 4P0XA 3WEGA 3ICKA 4KQSA 5I1UA 1YYRA 4QXSF 3EGTA 3ICMA 3P5RA 4LIXA 5ILHA 4DZWA 3P8LA 2Z4WA 5DZ2A 5HN7A 3P8RA 4KVYA 4LA6A 3KRPB 2Q9ZA 5A0IA 4Q23A 4JYXA 1UBVA 4MC8A 3LG5A 5A0KA 2E8WA 3Q2QA 3NRIA 3LEEA 2Z78A 3RMGA 3TFPA 3G4FA 1FPSA 3BNXA 2H8OA 2Z4YA 2Q80A 3ZL6A 2PS7A 4KVDA 4XQRF 5B02A 3KROA 4F6VA 5JV2F 4KUXA 2OPMA 3N5JF 4XQSF 3WCBA 4KQ5A 3NPRA 4RXAA 2F8ZF 3SDQA 3N46F 3DYGA 1VG7A 5ERMA 5IKHA 3W7FA 1YHLA 4GA3A 1WL1A 3ACYA 4OKZA 4NFKF 3V1VA 2AEKA 4EA1A 2ZCQA 4N1ZF 3WCJA 3KRCA 3DYHA 3N6KF 3PH7A 5DHKA 5IN8A 3PYAA 5B03A 1VG2A 1N1BA 3B7LA 3ID0A 2PS8A 3KROB 3N1VF 5B0IA 3WCMA 1KIYA 1N1ZA 2E95A 3ACWA 4JXYA 5E8KA 1HM4A 1KIZA 3Q2ZA 3LSNA 4MC0A 1N21A 5IK9A 5AFXA 2E8XA 4P0VA 3WCIA 2Z7IA 1DI1A 2E8UA 4OMHA 4FJQA 2E91A 2P1CA 4MC3A 3M0GA 1UBYA 4DWBA 4FP4A 4LZ0A 5ILZA 2E94A 3AQ0A 2F92F 4RXEA 5AYPA 3KRCB 5B01A 5JUZF 5HN9A 3UCAA 3P41A 1HM7A 3WJKA 3KB9A 2J1PA 2ZCRA 2PS4A 3LOMA 1YV5A 2OPNA 4EA0A 4H5CF 4DXJA 1V4JA 3WE9A 4K10A 5IM1A 5ERNA 3DYFA 1JFGA 2ZEUA 4LTVA 4GP1A 4DEMF 2OA6A 3QQVA 4LLTA 4LZCA 3WCCA 3MZVA 3M00A 3CC9A 3AQBB 3WSAA 5DJVF 1YYQA 1N22A 1EZFA 2AELA 1V4KA 4LPGF 5JV1F 3LJIA 2FORA 1YYTA 3VJAA 4DHDA 2Q58A 3V1XA 3LGKA 2RAHA 3ADZA 5DW7A 3TFVA 5EAUA 5ILJA 3G4DA 1RQJA 2DH4A 2ZY1A 4KKMA 3SAEA 4LA5A 5IMIA 2O1OA 3WEFA 3WCDA 1YQ7A 2FTZA 4LFGA 5HN8A 3N45F 3VJ8A 3N1WF 2ONHA 5DGNF 4E9UA 1YYUA 3M01A 3WJOA 5EROA 2AETA 2E90A 5JV0F 2Z7HA 3OACA 1PS1A 3IPIA 1JFAA 3VJ9A 5B0KA 5AHUB 3WC9A 4OMGA 5B0LA 3WCEA 3ICZA 3APZA 3BNYA 2E4OA 1VG6A 3ZCDA 4NFJF 3KBKA 4KQUA 3N5HF 4RYPA 4ZQ8A 5DIQF 3AQCB 4GP2A 3PYBA 3AE0A 5JA0F 1YJ4A 1YHMA 1N24A 3Q30A 4KFAA 3RBMA 4F62A 1N20A 4LTZA 5E8LA 2QISA 3CP6A 2Z50A 1VG4A 3EFQA 3P5PA 1HXGA 3N0GA 5IKAA 4NKEA 3LMDA 3SDVA 3N3LF 3ZOUA 2ZCOA 3CKEA 1HXAA 5DJPF 2J1OA 4NUAA 3RYEA 1UBXA 4JXNA 2EWGA 5B0MA 2VF6A 3WCLA 5ILDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRP A;  4OKM A;  5IK6 A;  5E8H A;  3TC1 A;  3WSB A;  4EA2 A;  5IL8 A;  5IL3 A;  4LZ3 A;  4LFV F;  3VJB A;  4L2X F;  1RTR A;  4LFE A;  2Q9Y A;  1WY0 A;  3VJD A;  3WEK A;  3LLW A;  5IVG A;  4KPD A;  2I19 A;  4KPJ A;  3WEJ A;  2ONG A;  5AEL A;  3ZMC A;  3KRF A;  2F94 F;  1VG3 A;  2PS6 A;  4KVI A;  4JZB A;  3LZ9 A;  3WEH A;  3TS7 A;  4RNQ A;  3LVS A;  4GAX A;  4KK2 A;  4PVY F;  1WL3 A;  3PDE A;  1WKZ A;  5IMP A;  4LOB A;  4XQT F;  4UMJ A;  1YYS A;  4E1E A;  3QKC A;  5ER8 A;  2OGD A;  3N0F A;  5H9D A;  3V66 A;  5KSX F;  4PVX F;  5CG5 A;  4KWD A;  3LGZ B;  1HX9 A;  1WL2 A;  4HD1 A;  5DGS F;  4F6X A;  3MAV A;  3VJE A;  5DJR F;  3SDT A;  1V4H A;  4NKF A;  4OGU A;  5IMN A;  3LK5 A;  4H5E F;  2Z4Z A;  1DGP A;  1V4E A;  3KRF B;  3N49 F;  5B0J A;  4RXD A;  2Z4X A;  3M9U A;  3ASX A;  4DWG A;  4QPF A;  5HNA A;  3IBA A;  3SDR A;  3KRA A;  5ILK A;  5EAS A;  3WCF A;  2ZEV A;  4DI5 A;  3WJN A;  2E93 A;  3PKO A;  2AZK A;  2F9K F;  2F8C F;  3ZMB A;  4N9U A;  5C05 A;  4LUU A;  4JZX A;  4JVJ F;  5ILI A;  2PS5 A;  3SDU A;  3OAB A;  3S4J A;  4NFI F;  2F89 F;  5EAT A;  3TFN A;  4LXW A;  2Z4V A;  3M02 A;  2F7M F;  4RXC A;  3S9V A;  3WCG A;  3EZ3 A;  1YHK A;  5A0J A;  4E9Z A;  1N23 A;  5CG6 A;  1RQI A;  1ZW5 A;  5DGM F;  4P0W A;  3RYW A;  3KRA B;  3NF2 A;  1UBW A;  3VJC A;  5DHI A;  2Z52 A;  3OAC B;  5ILY A;  3Q1O A;  1WMW A;  5B00 A;  3LDW A;  4KVW A;  3N3D A;  3ICN A;  3ACX A;  2J5C A;  2ZCS A;  2AZL A;  3NPK A;  3OYR A;  2E8V A;  3WCH A;  3OAB B;  4H5D F;  4LLS A;  2E8T A;  1V4I A;  4NG6 A;  2E92 A;  3WEI A;  3WCA A;  1HXC A;  4LPH F;  5IK0 A;  1WL0 A;  4WK5 A;  2AZJ A;  4P0X A;  3WEG A;  3ICK A;  4KQS A;  5I1U A;  1YYR A;  4QXS F;  3EGT A;  3ICM A;  3P5R A;  4LIX A;  5ILH A;  4DZW A;  3P8L A;  2Z4W A;  5DZ2 A;  5HN7 A;  3P8R A;  4KVY A;  4LA6 A;  3KRP B;  2Q9Z A;  5A0I A;  4Q23 A;  4JYX A;  1UBV A;  4MC8 A;  3LG5 A;  5A0K A;  2E8W A;  3Q2Q A;  3NRI A;  3LEE A;  2Z78 A;  3RMG A;  3TFP A;  3G4F A;  1FPS A;  3BNX A;  2H8O A;  2Z4Y A;  2Q80 A;  3ZL6 A;  2PS7 A;  4KVD A;  4XQR F;  5B02 A;  3KRO A;  4F6V A;  5JV2 F;  4KUX A;  2OPM A;  3N5J F;  4XQS F;  3WCB A;  4KQ5 A;  3NPR A;  4RXA A;  2F8Z F;  3SDQ A;  3N46 F;  3DYG A;  1VG7 A;  5ERM A;  5IKH A;  3W7F A;  1YHL A;  4GA3 A;  1WL1 A;  3ACY A;  4OKZ A;  4NFK F;  3V1V A;  2AEK A;  4EA1 A;  2ZCQ A;  4N1Z F;  3WCJ A;  3KRC A;  3DYH A;  3N6K F;  3PH7 A;  5DHK A;  5IN8 A;  3PYA A;  5B03 A;  1VG2 A;  1N1B A;  3B7L A;  3ID0 A;  2PS8 A;  3KRO B;  3N1V F;  5B0I A;  3WCM A;  1KIY A;  1N1Z A;  2E95 A;  3ACW A;  4JXY A;  5E8K A;  1HM4 A;  1KIZ A;  3Q2Z A;  3LSN A;  4MC0 A;  1N21 A;  5IK9 A;  5AFX A;  2E8X A;  4P0V A;  3WCI A;  2Z7I A;  1DI1 A;  2E8U A;  4OMH A;  4FJQ A;  2E91 A;  2P1C A;  4MC3 A;  3M0G A;  1UBY A;  4DWB A;  4FP4 A;  4LZ0 A;  5ILZ A;  2E94 A;  3AQ0 A;  2F92 F;  4RXE A;  5AYP A;  3KRC B;  5B01 A;  5JUZ F;  5HN9 A;  3UCA A;  3P41 A;  1HM7 A;  3WJK A;  3KB9 A;  2J1P A;  2ZCR A;  2PS4 A;  3LOM A;  1YV5 A;  2OPN A;  4EA0 A;  4H5C F;  4DXJ A;  1V4J A;  3WE9 A;  4K10 A;  5IM1 A;  5ERN A;  3DYF A;  1JFG A;  2ZEU A;  4LTV A;  4GP1 A;  4DEM F;  2OA6 A;  3QQV A;  4LLT A;  4LZC A;  3WCC A;  3MZV A;  3M00 A;  3CC9 A;  3AQB B;  3WSA A;  5DJV F;  1YYQ A;  1N22 A;  1EZF A;  2AEL A;  1V4K A;  4LPG F;  5JV1 F;  3LJI A;  2FOR A;  1YYT A;  3VJA A;  4DHD A;  2Q58 A;  3V1X A;  3LGK A;  2RAH A;  3ADZ A;  5DW7 A;  3TFV A;  5EAU A;  5ILJ A;  3G4D A;  1RQJ A;  2DH4 A;  2ZY1 A;  4KKM A;  3SAE A;  4LA5 A;  5IMI A;  2O1O A;  3WEF A;  3WCD A;  1YQ7 A;  2FTZ A;  4LFG A;  5HN8 A;  3N45 F;  3VJ8 A;  3N1W F;  2ONH A;  5DGN F;  4E9U A;  1YYU A;  3M01 A;  3WJO A;  5ERO A;  2AET A;  2E90 A;  5JV0 F;  2Z7H A;  3OAC A;  1PS1 A;  3IPI A;  1JFA A;  3VJ9 A;  5B0K A;  5AHU B;  3WC9 A;  4OMG A;  5B0L A;  3WCE A;  3ICZ A;  3APZ A;  3BNY A;  2E4O A;  1VG6 A;  3ZCD A;  4NFJ F;  3KBK A;  4KQU A;  3N5H F;  4RYP A;  4ZQ8 A;  5DIQ F;  3AQC B;  4GP2 A;  3PYB A;  3AE0 A;  5JA0 F;  1YJ4 A;  1YHM A;  1N24 A;  3Q30 A;  4KFA A;  3RBM A;  4F62 A;  1N20 A;  4LTZ A;  5E8L A;  2QIS A;  3CP6 A;  2Z50 A;  1VG4 A;  3EFQ A;  3P5P A;  1HXG A;  3N0G A;  5IKA A;  4NKE A;  3LMD A;  3SDV A;  3N3L F;  3ZOU A;  2ZCO A;  3CKE A;  1HXA A;  5DJP F;  2J1O A;  4NUA A;  3RYE A;  1UBX A;  4JXN A;  2EWG A;  5B0M A;  2VF6 A;  3WCL A;  5ILD A; 
#chains in the Genus database with same CATH topology
 3KRP A;  4OKM A;  5IK6 A;  5E8H A;  3TC1 A;  3WSB A;  4EA2 A;  5IL8 A;  5IL3 A;  4LZ3 A;  4LFV F;  3VJB A;  4L2X F;  1RTR A;  4LFE A;  2Q9Y A;  1WY0 A;  3VJD A;  3WEK A;  3LLW A;  5IVG A;  4KPD A;  2I19 A;  4KPJ A;  3WEJ A;  2ONG A;  5AEL A;  3ZMC A;  3KRF A;  2F94 F;  1VG3 A;  2PS6 A;  4KVI A;  4JZB A;  3LZ9 A;  3WEH A;  3TS7 A;  4RNQ A;  3LVS A;  4GAX A;  4KK2 A;  4PVY F;  1WL3 A;  3PDE A;  1WKZ A;  5IMP A;  4LOB A;  4XQT F;  4UMJ A;  1YYS A;  4E1E A;  3QKC A;  5ER8 A;  2OGD A;  3N0F A;  5H9D A;  3V66 A;  5KSX F;  4PVX F;  5CG5 A;  4KWD A;  3LGZ B;  1HX9 A;  1WL2 A;  4HD1 A;  5DGS F;  4F6X A;  3MAV A;  3VJE A;  5DJR F;  3SDT A;  1V4H A;  4NKF A;  4OGU A;  5IMN A;  3LK5 A;  4H5E F;  2Z4Z A;  1DGP A;  1V4E A;  3KRF B;  3N49 F;  5B0J A;  4RXD A;  2Z4X A;  3M9U A;  3ASX A;  4DWG A;  4QPF A;  5HNA A;  3IBA A;  3SDR A;  3KRA A;  5ILK A;  5EAS A;  3WCF A;  2ZEV A;  4DI5 A;  3WJN A;  2E93 A;  3PKO A;  2AZK A;  2F9K F;  2F8C F;  3ZMB A;  4N9U A;  5C05 A;  4LUU A;  4JZX A;  4JVJ F;  5ILI A;  2PS5 A;  3SDU A;  3OAB A;  3S4J A;  4NFI F;  2F89 F;  5EAT A;  3TFN A;  4LXW A;  2Z4V A;  3M02 A;  2F7M F;  4RXC A;  3S9V A;  3WCG A;  3EZ3 A;  1YHK A;  5A0J A;  4E9Z A;  1N23 A;  5CG6 A;  1RQI A;  1ZW5 A;  5DGM F;  4P0W A;  3RYW A;  3KRA B;  3NF2 A;  1UBW A;  3VJC A;  5DHI A;  2Z52 A;  3OAC B;  5ILY A;  3Q1O A;  1WMW A;  5B00 A;  3LDW A;  4KVW A;  3N3D A;  3ICN A;  3ACX A;  2J5C A;  2ZCS A;  2AZL A;  3NPK A;  3OYR A;  2E8V A;  3WCH A;  3OAB B;  4H5D F;  4LLS A;  2E8T A;  1V4I A;  4NG6 A;  2E92 A;  3WEI A;  3WCA A;  1HXC A;  4LPH F;  5IK0 A;  1WL0 A;  4WK5 A;  2AZJ A;  4P0X A;  3WEG A;  3ICK A;  4KQS A;  5I1U A;  1YYR A;  4QXS F;  3EGT A;  3ICM A;  3P5R A;  4LIX A;  5ILH A;  4DZW A;  3P8L A;  2Z4W A;  5DZ2 A;  5HN7 A;  3P8R A;  4KVY A;  4LA6 A;  3KRP B;  2Q9Z A;  5A0I A;  4Q23 A;  4JYX A;  1UBV A;  4MC8 A;  3LG5 A;  5A0K A;  2E8W A;  3Q2Q A;  3NRI A;  3LEE A;  2Z78 A;  3RMG A;  3TFP A;  3G4F A;  1FPS A;  3BNX A;  2H8O A;  2Z4Y A;  2Q80 A;  3ZL6 A;  2PS7 A;  4KVD A;  4XQR F;  5B02 A;  3KRO A;  4F6V A;  5JV2 F;  4KUX A;  2OPM A;  3N5J F;  4XQS F;  3WCB A;  4KQ5 A;  3NPR A;  4RXA A;  2F8Z F;  3SDQ A;  3N46 F;  3DYG A;  1VG7 A;  5ERM A;  5IKH A;  3W7F A;  1YHL A;  4GA3 A;  1WL1 A;  3ACY A;  4OKZ A;  4NFK F;  3V1V A;  2AEK A;  4EA1 A;  2ZCQ A;  4N1Z F;  3WCJ A;  3KRC A;  3DYH A;  3N6K F;  3PH7 A;  5DHK A;  5IN8 A;  3PYA A;  5B03 A;  1VG2 A;  1N1B A;  3B7L A;  3ID0 A;  2PS8 A;  3KRO B;  3N1V F;  5B0I A;  3WCM A;  1KIY A;  1N1Z A;  2E95 A;  3ACW A;  4JXY A;  5E8K A;  1HM4 A;  1KIZ A;  3Q2Z A;  3LSN A;  4MC0 A;  1N21 A;  5IK9 A;  5AFX A;  2E8X A;  4P0V A;  3WCI A;  2Z7I A;  1DI1 A;  2E8U A;  4OMH A;  4FJQ A;  2E91 A;  2P1C A;  4MC3 A;  3M0G A;  1UBY A;  4DWB A;  4FP4 A;  4LZ0 A;  5ILZ A;  2E94 A;  3AQ0 A;  2F92 F;  4RXE A;  5AYP A;  3KRC B;  5B01 A;  5JUZ F;  5HN9 A;  3UCA A;  3P41 A;  1HM7 A;  3WJK A;  3KB9 A;  2J1P A;  2ZCR A;  2PS4 A;  3LOM A;  1YV5 A;  2OPN A;  4EA0 A;  4H5C F;  4DXJ A;  1V4J A;  3WE9 A;  4K10 A;  5IM1 A;  5ERN A;  3DYF A;  1JFG A;  2ZEU A;  4LTV A;  4GP1 A;  4DEM F;  2OA6 A;  3QQV A;  4LLT A;  4LZC A;  3WCC A;  3MZV A;  3M00 A;  3CC9 A;  3AQB B;  3WSA A;  5DJV F;  1YYQ A;  1N22 A;  1EZF A;  2AEL A;  1V4K A;  4LPG F;  5JV1 F;  3LJI A;  2FOR A;  1YYT A;  3VJA A;  4DHD A;  2Q58 A;  3V1X A;  3LGK A;  2RAH A;  3ADZ A;  5DW7 A;  3TFV A;  5EAU A;  5ILJ A;  3G4D A;  1RQJ A;  2DH4 A;  2ZY1 A;  4KKM A;  3SAE A;  4LA5 A;  5IMI A;  2O1O A;  3WEF A;  3WCD A;  1YQ7 A;  2FTZ A;  4LFG A;  5HN8 A;  3N45 F;  3VJ8 A;  3N1W F;  2ONH A;  5DGN F;  4E9U A;  1YYU A;  3M01 A;  3WJO A;  5ERO A;  2AET A;  2E90 A;  5JV0 F;  2Z7H A;  3OAC A;  1PS1 A;  3IPI A;  1JFA A;  3VJ9 A;  5B0K A;  5AHU B;  3WC9 A;  4OMG A;  5B0L A;  3WCE A;  3ICZ A;  3APZ A;  3BNY A;  2E4O A;  1VG6 A;  3ZCD A;  4NFJ F;  3KBK A;  4KQU A;  3N5H F;  4RYP A;  4ZQ8 A;  5DIQ F;  3AQC B;  4GP2 A;  3PYB A;  3AE0 A;  5JA0 F;  1YJ4 A;  1YHM A;  1N24 A;  3Q30 A;  4KFA A;  3RBM A;  4F62 A;  1N20 A;  4LTZ A;  5E8L A;  2QIS A;  3CP6 A;  2Z50 A;  1VG4 A;  3EFQ A;  3P5P A;  1HXG A;  3N0G A;  5IKA A;  4NKE A;  3LMD A;  3SDV A;  3N3L F;  3ZOU A;  2ZCO A;  3CKE A;  1HXA A;  5DJP F;  2J1O A;  4NUA A;  3RYE A;  1UBX A;  4JXN A;  2EWG A;  5B0M A;  2VF6 A;  3WCL A;  5ILD A; 
#chains in the Genus database with same CATH homology
 3KRP A;  4OKM A;  5IK6 A;  5E8H A;  3TC1 A;  3WSB A;  4EA2 A;  5IL8 A;  5IL3 A;  4LZ3 A;  4LFV F;  3VJB A;  4L2X F;  1RTR A;  4LFE A;  2Q9Y A;  1WY0 A;  3VJD A;  3WEK A;  3LLW A;  5IVG A;  4KPD A;  2I19 A;  4KPJ A;  3WEJ A;  2ONG A;  5AEL A;  3ZMC A;  3KRF A;  2F94 F;  1VG3 A;  2PS6 A;  4KVI A;  4JZB A;  3LZ9 A;  3WEH A;  3TS7 A;  4RNQ A;  3LVS A;  4GAX A;  4KK2 A;  4PVY F;  1WL3 A;  3PDE A;  1WKZ A;  5IMP A;  4LOB A;  4XQT F;  4UMJ A;  1YYS A;  4E1E A;  3QKC A;  5ER8 A;  2OGD A;  3N0F A;  5H9D A;  3V66 A;  5KSX F;  4PVX F;  5CG5 A;  4KWD A;  3LGZ B;  1HX9 A;  1WL2 A;  4HD1 A;  5DGS F;  4F6X A;  3MAV A;  3VJE A;  5DJR F;  3SDT A;  1V4H A;  4NKF A;  4OGU A;  5IMN A;  3LK5 A;  4H5E F;  2Z4Z A;  1DGP A;  1V4E A;  3KRF B;  3N49 F;  5B0J A;  4RXD A;  2Z4X A;  3M9U A;  3ASX A;  4DWG A;  4QPF A;  5HNA A;  3IBA A;  3SDR A;  3KRA A;  5ILK A;  5EAS A;  3WCF A;  2ZEV A;  4DI5 A;  3WJN A;  2E93 A;  3PKO A;  2AZK A;  2F9K F;  2F8C F;  3ZMB A;  4N9U A;  5C05 A;  4LUU A;  4JZX A;  4JVJ F;  5ILI A;  2PS5 A;  3SDU A;  3OAB A;  3S4J A;  4NFI F;  2F89 F;  5EAT A;  3TFN A;  4LXW A;  2Z4V A;  3M02 A;  2F7M F;  4RXC A;  3S9V A;  3WCG A;  3EZ3 A;  1YHK A;  5A0J A;  4E9Z A;  1N23 A;  5CG6 A;  1RQI A;  1ZW5 A;  5DGM F;  4P0W A;  3RYW A;  3KRA B;  3NF2 A;  1UBW A;  3VJC A;  5DHI A;  2Z52 A;  3OAC B;  5ILY A;  3Q1O A;  1WMW A;  5B00 A;  3LDW A;  4KVW A;  3N3D A;  3ICN A;  3ACX A;  2J5C A;  2ZCS A;  2AZL A;  3NPK A;  3OYR A;  2E8V A;  3WCH A;  3OAB B;  4H5D F;  4LLS A;  2E8T A;  1V4I A;  4NG6 A;  2E92 A;  3WEI A;  3WCA A;  1HXC A;  4LPH F;  5IK0 A;  1WL0 A;  4WK5 A;  2AZJ A;  4P0X A;  3WEG A;  3ICK A;  4KQS A;  5I1U A;  1YYR A;  4QXS F;  3EGT A;  3ICM A;  3P5R A;  4LIX A;  5ILH A;  4DZW A;  3P8L A;  2Z4W A;  5DZ2 A;  5HN7 A;  3P8R A;  4KVY A;  4LA6 A;  3KRP B;  2Q9Z A;  5A0I A;  4Q23 A;  4JYX A;  1UBV A;  4MC8 A;  3LG5 A;  5A0K A;  2E8W A;  3Q2Q A;  3NRI A;  3LEE A;  2Z78 A;  3RMG A;  3TFP A;  3G4F A;  1FPS A;  3BNX A;  2H8O A;  2Z4Y A;  2Q80 A;  3ZL6 A;  2PS7 A;  4KVD A;  4XQR F;  5B02 A;  3KRO A;  4F6V A;  5JV2 F;  4KUX A;  2OPM A;  3N5J F;  4XQS F;  3WCB A;  4KQ5 A;  3NPR A;  4RXA A;  2F8Z F;  3SDQ A;  3N46 F;  3DYG A;  1VG7 A;  5ERM A;  5IKH A;  3W7F A;  1YHL A;  4GA3 A;  1WL1 A;  3ACY A;  4OKZ A;  4NFK F;  3V1V A;  2AEK A;  4EA1 A;  2ZCQ A;  4N1Z F;  3WCJ A;  3KRC A;  3DYH A;  3N6K F;  3PH7 A;  5DHK A;  5IN8 A;  3PYA A;  5B03 A;  1VG2 A;  1N1B A;  3B7L A;  3ID0 A;  2PS8 A;  3KRO B;  3N1V F;  5B0I A;  3WCM A;  1KIY A;  1N1Z A;  2E95 A;  3ACW A;  4JXY A;  5E8K A;  1HM4 A;  1KIZ A;  3Q2Z A;  3LSN A;  4MC0 A;  1N21 A;  5IK9 A;  5AFX A;  2E8X A;  4P0V A;  3WCI A;  2Z7I A;  1DI1 A;  2E8U A;  4OMH A;  4FJQ A;  2E91 A;  2P1C A;  4MC3 A;  3M0G A;  1UBY A;  4DWB A;  4FP4 A;  4LZ0 A;  5ILZ A;  2E94 A;  3AQ0 A;  2F92 F;  4RXE A;  5AYP A;  3KRC B;  5B01 A;  5JUZ F;  5HN9 A;  3UCA A;  3P41 A;  1HM7 A;  3WJK A;  3KB9 A;  2J1P A;  2ZCR A;  2PS4 A;  3LOM A;  1YV5 A;  2OPN A;  4EA0 A;  4H5C F;  4DXJ A;  1V4J A;  3WE9 A;  4K10 A;  5IM1 A;  5ERN A;  3DYF A;  1JFG A;  2ZEU A;  4LTV A;  4GP1 A;  4DEM F;  2OA6 A;  3QQV A;  4LLT A;  4LZC A;  3WCC A;  3MZV A;  3M00 A;  3CC9 A;  3AQB B;  3WSA A;  5DJV F;  1YYQ A;  1N22 A;  1EZF A;  2AEL A;  1V4K A;  4LPG F;  5JV1 F;  3LJI A;  2FOR A;  1YYT A;  3VJA A;  4DHD A;  2Q58 A;  3V1X A;  3LGK A;  2RAH A;  3ADZ A;  5DW7 A;  3TFV A;  5EAU A;  5ILJ A;  3G4D A;  1RQJ A;  2DH4 A;  2ZY1 A;  4KKM A;  3SAE A;  4LA5 A;  5IMI A;  2O1O A;  3WEF A;  3WCD A;  1YQ7 A;  2FTZ A;  4LFG A;  5HN8 A;  3N45 F;  3VJ8 A;  3N1W F;  2ONH A;  5DGN F;  4E9U A;  1YYU A;  3M01 A;  3WJO A;  5ERO A;  2AET A;  2E90 A;  5JV0 F;  2Z7H A;  3OAC A;  1PS1 A;  3IPI A;  1JFA A;  3VJ9 A;  5B0K A;  5AHU B;  3WC9 A;  4OMG A;  5B0L A;  3WCE A;  3ICZ A;  3APZ A;  3BNY A;  2E4O A;  1VG6 A;  3ZCD A;  4NFJ F;  3KBK A;  4KQU A;  3N5H F;  4RYP A;  4ZQ8 A;  5DIQ F;  3AQC B;  4GP2 A;  3PYB A;  3AE0 A;  5JA0 F;  1YJ4 A;  1YHM A;  1N24 A;  3Q30 A;  4KFA A;  3RBM A;  4F62 A;  1N20 A;  4LTZ A;  5E8L A;  2QIS A;  3CP6 A;  2Z50 A;  1VG4 A;  3EFQ A;  3P5P A;  1HXG A;  3N0G A;  5IKA A;  4NKE A;  3LMD A;  3SDV A;  3N3L F;  3ZOU A;  2ZCO A;  3CKE A;  1HXA A;  5DJP F;  2J1O A;  4NUA A;  3RYE A;  1UBX A;  4JXN A;  2EWG A;  5B0M A;  2VF6 A;  3WCL A;  5ILD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...