4LFEA

Crystal structure of geranylgeranyl diphosphate synthase sub1274 (target efi-509455) from streptococcus uberis 0140j with bound magnesium and isopentyl diphosphate, partially liganded complex;
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
290
structure length
274
Chain Sequence
SMDKLKKIDQTIHAFYCEKAVISEKLNEAVLYSINAGGKRIRPILFLEVIEALQIPLTESHFKAAAALEMIHTGSLIHDDLPAMDNDDYRRGQLTNHKKFDEATAILAGDSLFLDAFGMLAETDFPTDVTVDLVRSLSSASGTFGMVGGQMLDMAAEGKKLNLKNLQLIHRHKTGQLLAYPFWAAARVAQLDENLLATFLEIGMIIGLAFQVRDDILDITAKMTYPHLLGLNESYQILDESLDQAEAILRKLSDEIAFAPQKILSLIERLRLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl diphosphate synthase
publication title Crystal Structure of Geranylgeranyl Diphosphate Synthase from Streptococcus Uberis 0140J
rcsb
source organism Streptococcus uberis
total genus 109
structure length 274
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4lfeA00
4L2XF 2PS6A 4NFJF 5HN7A 4LFGA 3SDQA 1VG4A 1YYSA 3QQVA 5DW7A 4KPDA 3TFVA 5A0KA 2ZY1A 3APZA 4PVXF 3WCJA 1V4EA 2Q58A 4QXSF 1UBYA 2FORA 3CC9A 2J1PA 3LZ9A 3ACXA 3WEHA 4F62A 2E93A 4F6XA 5EROA 5CG6A 5AELA 3WCGA 5EAUA 5DZ2A 4NKFA 3ACYA 3WCFA 1N24A 1N1ZA 5B0LA 5B01A 4KQSA 3LOMA 4P0WA 5EASA 4GP1A 3KRPA 1N20A 4LZ3A 3P5RA 3TFNA 5B02A 3V66A 2AZKA 4KVYA 3S9VA 4OMHA 5DJPF 1DGPA 4N1ZF 3KRAB 5ERNA 3PYBA 1HXCA 5ER8A 4P0VA 3KRFA 2O1OA 2F92F 1YYUA 4DWBA 1VG3A 3EFQA 4RXDA 2J5CA 4WK5A 4ZQ8A 3ZMBA 4P0XA 2RAHA 3ICZA 5B0MA 5IMIA 1V4KA 3LG5A 4RXCA 3TS7A 3BNXA 3OABB 1HXAA 2F8ZF 2I19A 3PH7A 3WEIA 3ZCDA 3WEFA 2ZEUA 2OA6A 1HXGA 3ASXA 1UBVA 2ONHA 3LEEA 2PS8A 3NRIA 3P5PA 5A0JA 5IK6A 3N0GA 2Z4WA 5JV2F 2E8XA 5DJVF 3M0GA 3NPKA 5I1UA 5B00A 5E8HA 3PKOA 4DZWA 3KROA 2E91A 4KKMA 4NKEA 4LA5A 5HN8A 3WCMA 3VJCA 4GP2A 5ILIA 1RTRA 3VJAA 5CG5A 1N21A 3LGKA 4JYXA 4RNQA 5JUZF 3AQCB 3WCAA 2ZEVA 5IMPA 4E9UA 3ICKA 3S4JA 1HM7A 3EGTA 2E8WA 4XQRF 5E8LA 2PS5A 3IPIA 4DHDA 1JFAA 3N0FA 5DIQF 4OKZA 3V1VA 3NPRA 2E95A 5IL8A 3KRCA 3ZMCA 1RQIA 3Q2ZA 3N3LF 4RYPA 3MZVA 4FJQA 2H8OA 3VJ9A 3VJ8A 4KPJA 3Q2QA 5DHKA 2ZCRA 1V4JA 3LVSA 5HNAA 4H5CF 3WSBA 3M02A 4QPFA 3OACB 4E1EA 4E9ZA 4KVIA 4LIXA 5IKHA 1FPSA 2Z50A 3B7LA 3CP6A 5C05A 4LXWA 2F89F 4OKMA 2F9KF 4JXYA 3Q30A 2OPNA 5ILKA 4RXAA 3SDRA 4KFAA 4LOBA 3EZ3A 3N6KF 3WCBA 3KRPB 5B03A 4HD1A 2AETA 3LGZB 1DI1A 3PYAA 5B0JA 3WCDA 4LTVA 2OGDA 5H9DA 3WEKA 3KRAA 4LLSA 3IBAA 2QISA 5JA0F 4F6VA 3VJBA 4LZ0A 5DHIA 1YYTA 1V4HA 3WJOA 2VF6A 1N22A 5A0IA 4FP4A 5AFXA 2FTZA 3ICNA 3DYHA 3P8RA 3CKEA 3KBKA 4LFVF 4H5EF 4KWDA 4Q23A 1VG6A 2AELA 3DYGA 1WY0A 3SDTA 5E8KA 1RQJA 4LZCA 3LJIA 2PS7A 4LLTA 4DEMF 2E8TA 3ZL6A 2Q80A 3M01A 3WEGA 5ILZA 1N1BA 5JV0F 4NG6A 3KROB 4MC3A 1UBXA 5EATA 5IVGA 3RYWA 1WL0A 2Z4YA 3PDEA 3RBMA 2Z78A 5IM1A 4H5DF 4RXEA 1VG2A 3LSNA 3N5JF 4MC0A 1EZFA 1ZW5A 1YJ4A 5IK9A 4KQUA 5IN8A 3WE9A 1YYQA 4KUXA 5ILDA 4JVJF 4DXJA 3N1WF 2Z4XA 4NUAA 2AZJA 3OYRA 4K10A 1PS1A 4N9UA 3LLWA 3N46F 4DWGA 3N45F 2AZLA 2ONGA 5ILHA 3WCIA 2Z7HA 3SDVA 2Z4ZA 2OPMA 3P8LA 3WCCA 3OACA 1HX9A 5IK0A 2AEKA 1YV5A 5ERMA 1VG7A 5ILJA 4JXNA 4LPGF 2E94A 3M9UA 1HM4A 5B0IA 1UBWA 3TFPA 4DI5A 4EA0A 2E8VA 3N49F 4EA1A 3KB9A 1KIYA 4LTZA 3VJDA 3G4FA 3P41A 1KIZA 3WCEA 4KK2A 4LUUA 1YQ7A 4XQSF 1YHLA 1WL3A 5HN9A 3TC1A 3LK5A 5B0KA 3KRFB 2ZCQA 2Z52A 3ID0A 4OMGA 4LA6A 3SDUA 3RMGA 4LFEA 3QKCA 3NF2A 3OABA 5DJRF 3BNYA 2ZCSA 5ILYA 3M00A 2F8CF 4XQTF 2DH4A 3SAEA 2Q9ZA 4GAXA 1WKZA 1WL1A 1JFGA 3ICMA 3AE0A 3ACWA 3WJKA 2Q9YA 3Q1OA 3V1XA 5DGNF 5KSXF 3UCAA 4EA2A 3VJEA 4OGUA 4PVYF 3AQ0A 4GA3A 3RYEA 3ADZA 2E92A 1WMWA 2F7MF 2F94F 2J1OA 4KVWA 5AYPA 5IKAA 5IMNA 3AQBB 5IL3A 4JZBA 3N3DA 4KVDA 1YHMA 5DGSF 3N5HF 4NFKF 1N23A 4MC8A 1WL2A 1YYRA 2Z4VA 2E4OA 2ZCOA 3DYFA 2E8UA 4LPHF 4NFIF 4UMJA 1V4IA 1YHKA 3WC9A 2E90A 3LDWA 5JV1F 2PS4A 3WEJA 5DGMF 2EWGA 3WCHA 3ZOUA 2Z7IA 3KRCB 3LMDA 3WCLA 3N1VF 3WJNA 4JZXA 3G4DA 3WSAA 3W7FA 2P1CA 4KQ5A 5AHUB 3MAVA
chains in the Genus database with same CATH superfamily
4L2XF 2PS6A 4NFJF 5HN7A 4LFGA 3SDQA 1VG4A 1YYSA 3QQVA 5DW7A 4KPDA 3TFVA 5A0KA 2ZY1A 3APZA 4PVXF 3WCJA 1V4EA 2Q58A 4QXSF 1UBYA 2FORA 3CC9A 2J1PA 3LZ9A 3ACXA 3WEHA 4F62A 2E93A 4F6XA 5EROA 5CG6A 5AELA 3WCGA 5EAUA 5DZ2A 4NKFA 3ACYA 3WCFA 1N24A 1N1ZA 5B0LA 5B01A 4KQSA 3LOMA 4P0WA 5EASA 4GP1A 3KRPA 1N20A 4LZ3A 3P5RA 3TFNA 5B02A 3V66A 2AZKA 4KVYA 3S9VA 4OMHA 5DJPF 1DGPA 4N1ZF 3KRAB 5ERNA 3PYBA 1HXCA 5ER8A 4P0VA 3KRFA 2O1OA 2F92F 1YYUA 4DWBA 1VG3A 3EFQA 4RXDA 2J5CA 4WK5A 4ZQ8A 3ZMBA 4P0XA 2RAHA 3ICZA 5B0MA 5IMIA 1V4KA 3LG5A 4RXCA 3TS7A 3BNXA 3OABB 1HXAA 2F8ZF 2I19A 3PH7A 3WEIA 3ZCDA 3WEFA 2ZEUA 2OA6A 1HXGA 3ASXA 1UBVA 2ONHA 3LEEA 2PS8A 3NRIA 3P5PA 5A0JA 5IK6A 3N0GA 2Z4WA 5JV2F 2E8XA 5DJVF 3M0GA 3NPKA 5I1UA 5B00A 5E8HA 3PKOA 4DZWA 3KROA 2E91A 4KKMA 4NKEA 4LA5A 5HN8A 3WCMA 3VJCA 4GP2A 5ILIA 1RTRA 3VJAA 5CG5A 1N21A 3LGKA 4JYXA 4RNQA 5JUZF 3AQCB 3WCAA 2ZEVA 5IMPA 4E9UA 3ICKA 3S4JA 1HM7A 3EGTA 2E8WA 4XQRF 5E8LA 2PS5A 3IPIA 4DHDA 1JFAA 3N0FA 5DIQF 4OKZA 3V1VA 3NPRA 2E95A 5IL8A 3KRCA 3ZMCA 1RQIA 3Q2ZA 3N3LF 4RYPA 3MZVA 4FJQA 2H8OA 3VJ9A 3VJ8A 4KPJA 3Q2QA 5DHKA 2ZCRA 1V4JA 3LVSA 5HNAA 4H5CF 3WSBA 3M02A 4QPFA 3OACB 4E1EA 4E9ZA 4KVIA 4LIXA 5IKHA 1FPSA 2Z50A 3B7LA 3CP6A 5C05A 4LXWA 2F89F 4OKMA 2F9KF 4JXYA 3Q30A 2OPNA 5ILKA 4RXAA 3SDRA 4KFAA 4LOBA 3EZ3A 3N6KF 3WCBA 3KRPB 5B03A 4HD1A 2AETA 3LGZB 1DI1A 3PYAA 5B0JA 3WCDA 4LTVA 2OGDA 5H9DA 3WEKA 3KRAA 4LLSA 3IBAA 2QISA 5JA0F 4F6VA 3VJBA 4LZ0A 5DHIA 1YYTA 1V4HA 3WJOA 2VF6A 1N22A 5A0IA 4FP4A 5AFXA 2FTZA 3ICNA 3DYHA 3P8RA 3CKEA 3KBKA 4LFVF 4H5EF 4KWDA 4Q23A 1VG6A 2AELA 3DYGA 1WY0A 3SDTA 5E8KA 1RQJA 4LZCA 3LJIA 2PS7A 4LLTA 4DEMF 2E8TA 3ZL6A 2Q80A 3M01A 3WEGA 5ILZA 1N1BA 5JV0F 4NG6A 3KROB 4MC3A 1UBXA 5EATA 5IVGA 3RYWA 1WL0A 2Z4YA 3PDEA 3RBMA 2Z78A 5IM1A 4H5DF 4RXEA 1VG2A 3LSNA 3N5JF 4MC0A 1EZFA 1ZW5A 1YJ4A 5IK9A 4KQUA 5IN8A 3WE9A 1YYQA 4KUXA 5ILDA 4JVJF 4DXJA 3N1WF 2Z4XA 4NUAA 2AZJA 3OYRA 4K10A 1PS1A 4N9UA 3LLWA 3N46F 4DWGA 3N45F 2AZLA 2ONGA 5ILHA 3WCIA 2Z7HA 3SDVA 2Z4ZA 2OPMA 3P8LA 3WCCA 3OACA 1HX9A 5IK0A 2AEKA 1YV5A 5ERMA 1VG7A 5ILJA 4JXNA 4LPGF 2E94A 3M9UA 1HM4A 5B0IA 1UBWA 3TFPA 4DI5A 4EA0A 2E8VA 3N49F 4EA1A 3KB9A 1KIYA 4LTZA 3VJDA 3G4FA 3P41A 1KIZA 3WCEA 4KK2A 4LUUA 1YQ7A 4XQSF 1YHLA 1WL3A 5HN9A 3TC1A 3LK5A 5B0KA 3KRFB 2ZCQA 2Z52A 3ID0A 4OMGA 4LA6A 3SDUA 3RMGA 4LFEA 3QKCA 3NF2A 3OABA 5DJRF 3BNYA 2ZCSA 5ILYA 3M00A 2F8CF 4XQTF 2DH4A 3SAEA 2Q9ZA 4GAXA 1WKZA 1WL1A 1JFGA 3ICMA 3AE0A 3ACWA 3WJKA 2Q9YA 3Q1OA 3V1XA 5DGNF 5KSXF 3UCAA 4EA2A 3VJEA 4OGUA 4PVYF 3AQ0A 4GA3A 3RYEA 3ADZA 2E92A 1WMWA 2F7MF 2F94F 2J1OA 4KVWA 5AYPA 5IKAA 5IMNA 3AQBB 5IL3A 4JZBA 3N3DA 4KVDA 1YHMA 5DGSF 3N5HF 4NFKF 1N23A 4MC8A 1WL2A 1YYRA 2Z4VA 2E4OA 2ZCOA 3DYFA 2E8UA 4LPHF 4NFIF 4UMJA 1V4IA 1YHKA 3WC9A 2E90A 3LDWA 5JV1F 2PS4A 3WEJA 5DGMF 2EWGA 3WCHA 3ZOUA 2Z7IA 3KRCB 3LMDA 3WCLA 3N1VF 3WJNA 4JZXA 3G4DA 3WSAA 3W7FA 2P1CA 4KQ5A 5AHUB 3MAVA
chains in the Genus database with same CATH topology
4L2XF 2PS6A 4NFJF 5HN7A 4LFGA 3SDQA 1VG4A 1YYSA 3QQVA 5DW7A 4KPDA 3TFVA 5A0KA 2ZY1A 3APZA 4PVXF 3WCJA 1V4EA 2Q58A 4QXSF 1UBYA 2FORA 3CC9A 2J1PA 3LZ9A 3ACXA 3WEHA 4F62A 2E93A 4F6XA 5EROA 5CG6A 5AELA 3WCGA 5EAUA 5DZ2A 4NKFA 3ACYA 3WCFA 1N24A 1N1ZA 5B0LA 5B01A 4KQSA 3LOMA 4P0WA 5EASA 4GP1A 3KRPA 1N20A 4LZ3A 3P5RA 3TFNA 5B02A 3V66A 2AZKA 4KVYA 3S9VA 4OMHA 5DJPF 1DGPA 4N1ZF 3KRAB 5ERNA 3PYBA 1HXCA 5ER8A 4P0VA 3KRFA 2O1OA 2F92F 1YYUA 4DWBA 1VG3A 3EFQA 4RXDA 2J5CA 4WK5A 4ZQ8A 3ZMBA 4P0XA 2RAHA 3ICZA 5B0MA 5IMIA 1V4KA 3LG5A 4RXCA 3TS7A 3BNXA 3OABB 1HXAA 2F8ZF 2I19A 3PH7A 3WEIA 3ZCDA 3WEFA 2ZEUA 2OA6A 1HXGA 3ASXA 1UBVA 2ONHA 3LEEA 2PS8A 3NRIA 3P5PA 5A0JA 5IK6A 3N0GA 2Z4WA 5JV2F 2E8XA 5DJVF 3M0GA 3NPKA 5I1UA 5B00A 5E8HA 3PKOA 4DZWA 3KROA 2E91A 4KKMA 4NKEA 4LA5A 5HN8A 3WCMA 3VJCA 4GP2A 5ILIA 1RTRA 3VJAA 5CG5A 1N21A 3LGKA 4JYXA 4RNQA 5JUZF 3AQCB 3WCAA 2ZEVA 5IMPA 4E9UA 3ICKA 3S4JA 1HM7A 3EGTA 2E8WA 4XQRF 5E8LA 2PS5A 3IPIA 4DHDA 1JFAA 3N0FA 5DIQF 4OKZA 3V1VA 3NPRA 2E95A 5IL8A 3KRCA 3ZMCA 1RQIA 3Q2ZA 3N3LF 4RYPA 3MZVA 4FJQA 2H8OA 3VJ9A 3VJ8A 4KPJA 3Q2QA 5DHKA 2ZCRA 1V4JA 3LVSA 5HNAA 4H5CF 3WSBA 3M02A 4QPFA 3OACB 4E1EA 4E9ZA 4KVIA 4LIXA 5IKHA 1FPSA 2Z50A 3B7LA 3CP6A 5C05A 4LXWA 2F89F 4OKMA 2F9KF 4JXYA 3Q30A 2OPNA 5ILKA 4RXAA 3SDRA 4KFAA 4LOBA 3EZ3A 3N6KF 3WCBA 3KRPB 5B03A 4HD1A 2AETA 3LGZB 1DI1A 3PYAA 5B0JA 3WCDA 4LTVA 2OGDA 5H9DA 3WEKA 3KRAA 4LLSA 3IBAA 2QISA 5JA0F 4F6VA 3VJBA 4LZ0A 5DHIA 1YYTA 1V4HA 3WJOA 2VF6A 1N22A 5A0IA 4FP4A 5AFXA 2FTZA 3ICNA 3DYHA 3P8RA 3CKEA 3KBKA 4LFVF 4H5EF 4KWDA 4Q23A 1VG6A 2AELA 3DYGA 1WY0A 3SDTA 5E8KA 1RQJA 4LZCA 3LJIA 2PS7A 4LLTA 4DEMF 2E8TA 3ZL6A 2Q80A 3M01A 3WEGA 5ILZA 1N1BA 5JV0F 4NG6A 3KROB 4MC3A 1UBXA 5EATA 5IVGA 3RYWA 1WL0A 2Z4YA 3PDEA 3RBMA 2Z78A 5IM1A 4H5DF 4RXEA 1VG2A 3LSNA 3N5JF 4MC0A 1EZFA 1ZW5A 1YJ4A 5IK9A 4KQUA 5IN8A 3WE9A 1YYQA 4KUXA 5ILDA 4JVJF 4DXJA 3N1WF 2Z4XA 4NUAA 2AZJA 3OYRA 4K10A 1PS1A 4N9UA 3LLWA 3N46F 4DWGA 3N45F 2AZLA 2ONGA 5ILHA 3WCIA 2Z7HA 3SDVA 2Z4ZA 2OPMA 3P8LA 3WCCA 3OACA 1HX9A 5IK0A 2AEKA 1YV5A 5ERMA 1VG7A 5ILJA 4JXNA 4LPGF 2E94A 3M9UA 1HM4A 5B0IA 1UBWA 3TFPA 4DI5A 4EA0A 2E8VA 3N49F 4EA1A 3KB9A 1KIYA 4LTZA 3VJDA 3G4FA 3P41A 1KIZA 3WCEA 4KK2A 4LUUA 1YQ7A 4XQSF 1YHLA 1WL3A 5HN9A 3TC1A 3LK5A 5B0KA 3KRFB 2ZCQA 2Z52A 3ID0A 4OMGA 4LA6A 3SDUA 3RMGA 4LFEA 3QKCA 3NF2A 3OABA 5DJRF 3BNYA 2ZCSA 5ILYA 3M00A 2F8CF 4XQTF 2DH4A 3SAEA 2Q9ZA 4GAXA 1WKZA 1WL1A 1JFGA 3ICMA 3AE0A 3ACWA 3WJKA 2Q9YA 3Q1OA 3V1XA 5DGNF 5KSXF 3UCAA 4EA2A 3VJEA 4OGUA 4PVYF 3AQ0A 4GA3A 3RYEA 3ADZA 2E92A 1WMWA 2F7MF 2F94F 2J1OA 4KVWA 5AYPA 5IKAA 5IMNA 3AQBB 5IL3A 4JZBA 3N3DA 4KVDA 1YHMA 5DGSF 3N5HF 4NFKF 1N23A 4MC8A 1WL2A 1YYRA 2Z4VA 2E4OA 2ZCOA 3DYFA 2E8UA 4LPHF 4NFIF 4UMJA 1V4IA 1YHKA 3WC9A 2E90A 3LDWA 5JV1F 2PS4A 3WEJA 5DGMF 2EWGA 3WCHA 3ZOUA 2Z7IA 3KRCB 3LMDA 3WCLA 3N1VF 3WJNA 4JZXA 3G4DA 3WSAA 3W7FA 2P1CA 4KQ5A 5AHUB 3MAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L2X F;  2PS6 A;  4NFJ F;  5HN7 A;  4LFG A;  3SDQ A;  1VG4 A;  1YYS A;  3QQV A;  5DW7 A;  4KPD A;  3TFV A;  5A0K A;  2ZY1 A;  3APZ A;  4PVX F;  3WCJ A;  1V4E A;  2Q58 A;  4QXS F;  1UBY A;  2FOR A;  3CC9 A;  2J1P A;  3LZ9 A;  3ACX A;  3WEH A;  4F62 A;  2E93 A;  4F6X A;  5ERO A;  5CG6 A;  5AEL A;  3WCG A;  5EAU A;  5DZ2 A;  4NKF A;  3ACY A;  3WCF A;  1N24 A;  1N1Z A;  5B0L A;  5B01 A;  4KQS A;  3LOM A;  4P0W A;  5EAS A;  4GP1 A;  3KRP A;  1N20 A;  4LZ3 A;  3P5R A;  3TFN A;  5B02 A;  3V66 A;  2AZK A;  4KVY A;  3S9V A;  4OMH A;  5DJP F;  1DGP A;  4N1Z F;  3KRA B;  5ERN A;  3PYB A;  1HXC A;  5ER8 A;  4P0V A;  3KRF A;  2O1O A;  2F92 F;  1YYU A;  4DWB A;  1VG3 A;  3EFQ A;  4RXD A;  2J5C A;  4WK5 A;  4ZQ8 A;  3ZMB A;  4P0X A;  2RAH A;  3ICZ A;  5B0M A;  5IMI A;  1V4K A;  3LG5 A;  4RXC A;  3TS7 A;  3BNX A;  3OAB B;  1HXA A;  2F8Z F;  2I19 A;  3PH7 A;  3WEI A;  3ZCD A;  3WEF A;  2ZEU A;  2OA6 A;  1HXG A;  3ASX A;  1UBV A;  2ONH A;  3LEE A;  2PS8 A;  3NRI A;  3P5P A;  5A0J A;  5IK6 A;  3N0G A;  2Z4W A;  5JV2 F;  2E8X A;  5DJV F;  3M0G A;  3NPK A;  5I1U A;  5B00 A;  5E8H A;  3PKO A;  4DZW A;  3KRO A;  2E91 A;  4KKM A;  4NKE A;  4LA5 A;  5HN8 A;  3WCM A;  3VJC A;  4GP2 A;  5ILI A;  1RTR A;  3VJA A;  5CG5 A;  1N21 A;  3LGK A;  4JYX A;  4RNQ A;  5JUZ F;  3AQC B;  3WCA A;  2ZEV A;  5IMP A;  4E9U A;  3ICK A;  3S4J A;  1HM7 A;  3EGT A;  2E8W A;  4XQR F;  5E8L A;  2PS5 A;  3IPI A;  4DHD A;  1JFA A;  3N0F A;  5DIQ F;  4OKZ A;  3V1V A;  3NPR A;  2E95 A;  5IL8 A;  3KRC A;  3ZMC A;  1RQI A;  3Q2Z A;  3N3L F;  4RYP A;  3MZV A;  4FJQ A;  2H8O A;  3VJ9 A;  3VJ8 A;  4KPJ A;  3Q2Q A;  5DHK A;  2ZCR A;  1V4J A;  3LVS A;  5HNA A;  4H5C F;  3WSB A;  3M02 A;  4QPF A;  3OAC B;  4E1E A;  4E9Z A;  4KVI A;  4LIX A;  5IKH A;  1FPS A;  2Z50 A;  3B7L A;  3CP6 A;  5C05 A;  4LXW A;  2F89 F;  4OKM A;  2F9K F;  4JXY A;  3Q30 A;  2OPN A;  5ILK A;  4RXA A;  3SDR A;  4KFA A;  4LOB A;  3EZ3 A;  3N6K F;  3WCB A;  3KRP B;  5B03 A;  4HD1 A;  2AET A;  3LGZ B;  1DI1 A;  3PYA A;  5B0J A;  3WCD A;  4LTV A;  2OGD A;  5H9D A;  3WEK A;  3KRA A;  4LLS A;  3IBA A;  2QIS A;  5JA0 F;  4F6V A;  3VJB A;  4LZ0 A;  5DHI A;  1YYT A;  1V4H A;  3WJO A;  2VF6 A;  1N22 A;  5A0I A;  4FP4 A;  5AFX A;  2FTZ A;  3ICN A;  3DYH A;  3P8R A;  3CKE A;  3KBK A;  4LFV F;  4H5E F;  4KWD A;  4Q23 A;  1VG6 A;  2AEL A;  3DYG A;  1WY0 A;  3SDT A;  5E8K A;  1RQJ A;  4LZC A;  3LJI A;  2PS7 A;  4LLT A;  4DEM F;  2E8T A;  3ZL6 A;  2Q80 A;  3M01 A;  3WEG A;  5ILZ A;  1N1B A;  5JV0 F;  4NG6 A;  3KRO B;  4MC3 A;  1UBX A;  5EAT A;  5IVG A;  3RYW A;  1WL0 A;  2Z4Y A;  3PDE A;  3RBM A;  2Z78 A;  5IM1 A;  4H5D F;  4RXE A;  1VG2 A;  3LSN A;  3N5J F;  4MC0 A;  1EZF A;  1ZW5 A;  1YJ4 A;  5IK9 A;  4KQU A;  5IN8 A;  3WE9 A;  1YYQ A;  4KUX A;  5ILD A;  4JVJ F;  4DXJ A;  3N1W F;  2Z4X A;  4NUA A;  2AZJ A;  3OYR A;  4K10 A;  1PS1 A;  4N9U A;  3LLW A;  3N46 F;  4DWG A;  3N45 F;  2AZL A;  2ONG A;  5ILH A;  3WCI A;  2Z7H A;  3SDV A;  2Z4Z A;  2OPM A;  3P8L A;  3WCC A;  3OAC A;  1HX9 A;  5IK0 A;  2AEK A;  1YV5 A;  5ERM A;  1VG7 A;  5ILJ A;  4JXN A;  4LPG F;  2E94 A;  3M9U A;  1HM4 A;  5B0I A;  1UBW A;  3TFP A;  4DI5 A;  4EA0 A;  2E8V A;  3N49 F;  4EA1 A;  3KB9 A;  1KIY A;  4LTZ A;  3VJD A;  3G4F A;  3P41 A;  1KIZ A;  3WCE A;  4KK2 A;  4LUU A;  1YQ7 A;  4XQS F;  1YHL A;  1WL3 A;  5HN9 A;  3TC1 A;  3LK5 A;  5B0K A;  3KRF B;  2ZCQ A;  2Z52 A;  3ID0 A;  4OMG A;  4LA6 A;  3SDU A;  3RMG A;  4LFE A;  3QKC A;  3NF2 A;  3OAB A;  5DJR F;  3BNY A;  2ZCS A;  5ILY A;  3M00 A;  2F8C F;  4XQT F;  2DH4 A;  3SAE A;  2Q9Z A;  4GAX A;  1WKZ A;  1WL1 A;  1JFG A;  3ICM A;  3AE0 A;  3ACW A;  3WJK A;  2Q9Y A;  3Q1O A;  3V1X A;  5DGN F;  5KSX F;  3UCA A;  4EA2 A;  3VJE A;  4OGU A;  4PVY F;  3AQ0 A;  4GA3 A;  3RYE A;  3ADZ A;  2E92 A;  1WMW A;  2F7M F;  2F94 F;  2J1O A;  4KVW A;  5AYP A;  5IKA A;  5IMN A;  3AQB B;  5IL3 A;  4JZB A;  3N3D A;  4KVD A;  1YHM A;  5DGS F;  3N5H F;  4NFK F;  1N23 A;  4MC8 A;  1WL2 A;  1YYR A;  2Z4V A;  2E4O A;  2ZCO A;  3DYF A;  2E8U A;  4LPH F;  4NFI F;  4UMJ A;  1V4I A;  1YHK A;  3WC9 A;  2E90 A;  3LDW A;  5JV1 F;  2PS4 A;  3WEJ A;  5DGM F;  2EWG A;  3WCH A;  3ZOU A;  2Z7I A;  3KRC B;  3LMD A;  3WCL A;  3N1V F;  3WJN A;  4JZX A;  3G4D A;  3WSA A;  3W7F A;  2P1C A;  4KQ5 A;  5AHU B;  3MAV A; 
#chains in the Genus database with same CATH topology
 4L2X F;  2PS6 A;  4NFJ F;  5HN7 A;  4LFG A;  3SDQ A;  1VG4 A;  1YYS A;  3QQV A;  5DW7 A;  4KPD A;  3TFV A;  5A0K A;  2ZY1 A;  3APZ A;  4PVX F;  3WCJ A;  1V4E A;  2Q58 A;  4QXS F;  1UBY A;  2FOR A;  3CC9 A;  2J1P A;  3LZ9 A;  3ACX A;  3WEH A;  4F62 A;  2E93 A;  4F6X A;  5ERO A;  5CG6 A;  5AEL A;  3WCG A;  5EAU A;  5DZ2 A;  4NKF A;  3ACY A;  3WCF A;  1N24 A;  1N1Z A;  5B0L A;  5B01 A;  4KQS A;  3LOM A;  4P0W A;  5EAS A;  4GP1 A;  3KRP A;  1N20 A;  4LZ3 A;  3P5R A;  3TFN A;  5B02 A;  3V66 A;  2AZK A;  4KVY A;  3S9V A;  4OMH A;  5DJP F;  1DGP A;  4N1Z F;  3KRA B;  5ERN A;  3PYB A;  1HXC A;  5ER8 A;  4P0V A;  3KRF A;  2O1O A;  2F92 F;  1YYU A;  4DWB A;  1VG3 A;  3EFQ A;  4RXD A;  2J5C A;  4WK5 A;  4ZQ8 A;  3ZMB A;  4P0X A;  2RAH A;  3ICZ A;  5B0M A;  5IMI A;  1V4K A;  3LG5 A;  4RXC A;  3TS7 A;  3BNX A;  3OAB B;  1HXA A;  2F8Z F;  2I19 A;  3PH7 A;  3WEI A;  3ZCD A;  3WEF A;  2ZEU A;  2OA6 A;  1HXG A;  3ASX A;  1UBV A;  2ONH A;  3LEE A;  2PS8 A;  3NRI A;  3P5P A;  5A0J A;  5IK6 A;  3N0G A;  2Z4W A;  5JV2 F;  2E8X A;  5DJV F;  3M0G A;  3NPK A;  5I1U A;  5B00 A;  5E8H A;  3PKO A;  4DZW A;  3KRO A;  2E91 A;  4KKM A;  4NKE A;  4LA5 A;  5HN8 A;  3WCM A;  3VJC A;  4GP2 A;  5ILI A;  1RTR A;  3VJA A;  5CG5 A;  1N21 A;  3LGK A;  4JYX A;  4RNQ A;  5JUZ F;  3AQC B;  3WCA A;  2ZEV A;  5IMP A;  4E9U A;  3ICK A;  3S4J A;  1HM7 A;  3EGT A;  2E8W A;  4XQR F;  5E8L A;  2PS5 A;  3IPI A;  4DHD A;  1JFA A;  3N0F A;  5DIQ F;  4OKZ A;  3V1V A;  3NPR A;  2E95 A;  5IL8 A;  3KRC A;  3ZMC A;  1RQI A;  3Q2Z A;  3N3L F;  4RYP A;  3MZV A;  4FJQ A;  2H8O A;  3VJ9 A;  3VJ8 A;  4KPJ A;  3Q2Q A;  5DHK A;  2ZCR A;  1V4J A;  3LVS A;  5HNA A;  4H5C F;  3WSB A;  3M02 A;  4QPF A;  3OAC B;  4E1E A;  4E9Z A;  4KVI A;  4LIX A;  5IKH A;  1FPS A;  2Z50 A;  3B7L A;  3CP6 A;  5C05 A;  4LXW A;  2F89 F;  4OKM A;  2F9K F;  4JXY A;  3Q30 A;  2OPN A;  5ILK A;  4RXA A;  3SDR A;  4KFA A;  4LOB A;  3EZ3 A;  3N6K F;  3WCB A;  3KRP B;  5B03 A;  4HD1 A;  2AET A;  3LGZ B;  1DI1 A;  3PYA A;  5B0J A;  3WCD A;  4LTV A;  2OGD A;  5H9D A;  3WEK A;  3KRA A;  4LLS A;  3IBA A;  2QIS A;  5JA0 F;  4F6V A;  3VJB A;  4LZ0 A;  5DHI A;  1YYT A;  1V4H A;  3WJO A;  2VF6 A;  1N22 A;  5A0I A;  4FP4 A;  5AFX A;  2FTZ A;  3ICN A;  3DYH A;  3P8R A;  3CKE A;  3KBK A;  4LFV F;  4H5E F;  4KWD A;  4Q23 A;  1VG6 A;  2AEL A;  3DYG A;  1WY0 A;  3SDT A;  5E8K A;  1RQJ A;  4LZC A;  3LJI A;  2PS7 A;  4LLT A;  4DEM F;  2E8T A;  3ZL6 A;  2Q80 A;  3M01 A;  3WEG A;  5ILZ A;  1N1B A;  5JV0 F;  4NG6 A;  3KRO B;  4MC3 A;  1UBX A;  5EAT A;  5IVG A;  3RYW A;  1WL0 A;  2Z4Y A;  3PDE A;  3RBM A;  2Z78 A;  5IM1 A;  4H5D F;  4RXE A;  1VG2 A;  3LSN A;  3N5J F;  4MC0 A;  1EZF A;  1ZW5 A;  1YJ4 A;  5IK9 A;  4KQU A;  5IN8 A;  3WE9 A;  1YYQ A;  4KUX A;  5ILD A;  4JVJ F;  4DXJ A;  3N1W F;  2Z4X A;  4NUA A;  2AZJ A;  3OYR A;  4K10 A;  1PS1 A;  4N9U A;  3LLW A;  3N46 F;  4DWG A;  3N45 F;  2AZL A;  2ONG A;  5ILH A;  3WCI A;  2Z7H A;  3SDV A;  2Z4Z A;  2OPM A;  3P8L A;  3WCC A;  3OAC A;  1HX9 A;  5IK0 A;  2AEK A;  1YV5 A;  5ERM A;  1VG7 A;  5ILJ A;  4JXN A;  4LPG F;  2E94 A;  3M9U A;  1HM4 A;  5B0I A;  1UBW A;  3TFP A;  4DI5 A;  4EA0 A;  2E8V A;  3N49 F;  4EA1 A;  3KB9 A;  1KIY A;  4LTZ A;  3VJD A;  3G4F A;  3P41 A;  1KIZ A;  3WCE A;  4KK2 A;  4LUU A;  1YQ7 A;  4XQS F;  1YHL A;  1WL3 A;  5HN9 A;  3TC1 A;  3LK5 A;  5B0K A;  3KRF B;  2ZCQ A;  2Z52 A;  3ID0 A;  4OMG A;  4LA6 A;  3SDU A;  3RMG A;  4LFE A;  3QKC A;  3NF2 A;  3OAB A;  5DJR F;  3BNY A;  2ZCS A;  5ILY A;  3M00 A;  2F8C F;  4XQT F;  2DH4 A;  3SAE A;  2Q9Z A;  4GAX A;  1WKZ A;  1WL1 A;  1JFG A;  3ICM A;  3AE0 A;  3ACW A;  3WJK A;  2Q9Y A;  3Q1O A;  3V1X A;  5DGN F;  5KSX F;  3UCA A;  4EA2 A;  3VJE A;  4OGU A;  4PVY F;  3AQ0 A;  4GA3 A;  3RYE A;  3ADZ A;  2E92 A;  1WMW A;  2F7M F;  2F94 F;  2J1O A;  4KVW A;  5AYP A;  5IKA A;  5IMN A;  3AQB B;  5IL3 A;  4JZB A;  3N3D A;  4KVD A;  1YHM A;  5DGS F;  3N5H F;  4NFK F;  1N23 A;  4MC8 A;  1WL2 A;  1YYR A;  2Z4V A;  2E4O A;  2ZCO A;  3DYF A;  2E8U A;  4LPH F;  4NFI F;  4UMJ A;  1V4I A;  1YHK A;  3WC9 A;  2E90 A;  3LDW A;  5JV1 F;  2PS4 A;  3WEJ A;  5DGM F;  2EWG A;  3WCH A;  3ZOU A;  2Z7I A;  3KRC B;  3LMD A;  3WCL A;  3N1V F;  3WJN A;  4JZX A;  3G4D A;  3WSA A;  3W7F A;  2P1C A;  4KQ5 A;  5AHU B;  3MAV A; 
#chains in the Genus database with same CATH homology
 4L2X F;  2PS6 A;  4NFJ F;  5HN7 A;  4LFG A;  3SDQ A;  1VG4 A;  1YYS A;  3QQV A;  5DW7 A;  4KPD A;  3TFV A;  5A0K A;  2ZY1 A;  3APZ A;  4PVX F;  3WCJ A;  1V4E A;  2Q58 A;  4QXS F;  1UBY A;  2FOR A;  3CC9 A;  2J1P A;  3LZ9 A;  3ACX A;  3WEH A;  4F62 A;  2E93 A;  4F6X A;  5ERO A;  5CG6 A;  5AEL A;  3WCG A;  5EAU A;  5DZ2 A;  4NKF A;  3ACY A;  3WCF A;  1N24 A;  1N1Z A;  5B0L A;  5B01 A;  4KQS A;  3LOM A;  4P0W A;  5EAS A;  4GP1 A;  3KRP A;  1N20 A;  4LZ3 A;  3P5R A;  3TFN A;  5B02 A;  3V66 A;  2AZK A;  4KVY A;  3S9V A;  4OMH A;  5DJP F;  1DGP A;  4N1Z F;  3KRA B;  5ERN A;  3PYB A;  1HXC A;  5ER8 A;  4P0V A;  3KRF A;  2O1O A;  2F92 F;  1YYU A;  4DWB A;  1VG3 A;  3EFQ A;  4RXD A;  2J5C A;  4WK5 A;  4ZQ8 A;  3ZMB A;  4P0X A;  2RAH A;  3ICZ A;  5B0M A;  5IMI A;  1V4K A;  3LG5 A;  4RXC A;  3TS7 A;  3BNX A;  3OAB B;  1HXA A;  2F8Z F;  2I19 A;  3PH7 A;  3WEI A;  3ZCD A;  3WEF A;  2ZEU A;  2OA6 A;  1HXG A;  3ASX A;  1UBV A;  2ONH A;  3LEE A;  2PS8 A;  3NRI A;  3P5P A;  5A0J A;  5IK6 A;  3N0G A;  2Z4W A;  5JV2 F;  2E8X A;  5DJV F;  3M0G A;  3NPK A;  5I1U A;  5B00 A;  5E8H A;  3PKO A;  4DZW A;  3KRO A;  2E91 A;  4KKM A;  4NKE A;  4LA5 A;  5HN8 A;  3WCM A;  3VJC A;  4GP2 A;  5ILI A;  1RTR A;  3VJA A;  5CG5 A;  1N21 A;  3LGK A;  4JYX A;  4RNQ A;  5JUZ F;  3AQC B;  3WCA A;  2ZEV A;  5IMP A;  4E9U A;  3ICK A;  3S4J A;  1HM7 A;  3EGT A;  2E8W A;  4XQR F;  5E8L A;  2PS5 A;  3IPI A;  4DHD A;  1JFA A;  3N0F A;  5DIQ F;  4OKZ A;  3V1V A;  3NPR A;  2E95 A;  5IL8 A;  3KRC A;  3ZMC A;  1RQI A;  3Q2Z A;  3N3L F;  4RYP A;  3MZV A;  4FJQ A;  2H8O A;  3VJ9 A;  3VJ8 A;  4KPJ A;  3Q2Q A;  5DHK A;  2ZCR A;  1V4J A;  3LVS A;  5HNA A;  4H5C F;  3WSB A;  3M02 A;  4QPF A;  3OAC B;  4E1E A;  4E9Z A;  4KVI A;  4LIX A;  5IKH A;  1FPS A;  2Z50 A;  3B7L A;  3CP6 A;  5C05 A;  4LXW A;  2F89 F;  4OKM A;  2F9K F;  4JXY A;  3Q30 A;  2OPN A;  5ILK A;  4RXA A;  3SDR A;  4KFA A;  4LOB A;  3EZ3 A;  3N6K F;  3WCB A;  3KRP B;  5B03 A;  4HD1 A;  2AET A;  3LGZ B;  1DI1 A;  3PYA A;  5B0J A;  3WCD A;  4LTV A;  2OGD A;  5H9D A;  3WEK A;  3KRA A;  4LLS A;  3IBA A;  2QIS A;  5JA0 F;  4F6V A;  3VJB A;  4LZ0 A;  5DHI A;  1YYT A;  1V4H A;  3WJO A;  2VF6 A;  1N22 A;  5A0I A;  4FP4 A;  5AFX A;  2FTZ A;  3ICN A;  3DYH A;  3P8R A;  3CKE A;  3KBK A;  4LFV F;  4H5E F;  4KWD A;  4Q23 A;  1VG6 A;  2AEL A;  3DYG A;  1WY0 A;  3SDT A;  5E8K A;  1RQJ A;  4LZC A;  3LJI A;  2PS7 A;  4LLT A;  4DEM F;  2E8T A;  3ZL6 A;  2Q80 A;  3M01 A;  3WEG A;  5ILZ A;  1N1B A;  5JV0 F;  4NG6 A;  3KRO B;  4MC3 A;  1UBX A;  5EAT A;  5IVG A;  3RYW A;  1WL0 A;  2Z4Y A;  3PDE A;  3RBM A;  2Z78 A;  5IM1 A;  4H5D F;  4RXE A;  1VG2 A;  3LSN A;  3N5J F;  4MC0 A;  1EZF A;  1ZW5 A;  1YJ4 A;  5IK9 A;  4KQU A;  5IN8 A;  3WE9 A;  1YYQ A;  4KUX A;  5ILD A;  4JVJ F;  4DXJ A;  3N1W F;  2Z4X A;  4NUA A;  2AZJ A;  3OYR A;  4K10 A;  1PS1 A;  4N9U A;  3LLW A;  3N46 F;  4DWG A;  3N45 F;  2AZL A;  2ONG A;  5ILH A;  3WCI A;  2Z7H A;  3SDV A;  2Z4Z A;  2OPM A;  3P8L A;  3WCC A;  3OAC A;  1HX9 A;  5IK0 A;  2AEK A;  1YV5 A;  5ERM A;  1VG7 A;  5ILJ A;  4JXN A;  4LPG F;  2E94 A;  3M9U A;  1HM4 A;  5B0I A;  1UBW A;  3TFP A;  4DI5 A;  4EA0 A;  2E8V A;  3N49 F;  4EA1 A;  3KB9 A;  1KIY A;  4LTZ A;  3VJD A;  3G4F A;  3P41 A;  1KIZ A;  3WCE A;  4KK2 A;  4LUU A;  1YQ7 A;  4XQS F;  1YHL A;  1WL3 A;  5HN9 A;  3TC1 A;  3LK5 A;  5B0K A;  3KRF B;  2ZCQ A;  2Z52 A;  3ID0 A;  4OMG A;  4LA6 A;  3SDU A;  3RMG A;  4LFE A;  3QKC A;  3NF2 A;  3OAB A;  5DJR F;  3BNY A;  2ZCS A;  5ILY A;  3M00 A;  2F8C F;  4XQT F;  2DH4 A;  3SAE A;  2Q9Z A;  4GAX A;  1WKZ A;  1WL1 A;  1JFG A;  3ICM A;  3AE0 A;  3ACW A;  3WJK A;  2Q9Y A;  3Q1O A;  3V1X A;  5DGN F;  5KSX F;  3UCA A;  4EA2 A;  3VJE A;  4OGU A;  4PVY F;  3AQ0 A;  4GA3 A;  3RYE A;  3ADZ A;  2E92 A;  1WMW A;  2F7M F;  2F94 F;  2J1O A;  4KVW A;  5AYP A;  5IKA A;  5IMN A;  3AQB B;  5IL3 A;  4JZB A;  3N3D A;  4KVD A;  1YHM A;  5DGS F;  3N5H F;  4NFK F;  1N23 A;  4MC8 A;  1WL2 A;  1YYR A;  2Z4V A;  2E4O A;  2ZCO A;  3DYF A;  2E8U A;  4LPH F;  4NFI F;  4UMJ A;  1V4I A;  1YHK A;  3WC9 A;  2E90 A;  3LDW A;  5JV1 F;  2PS4 A;  3WEJ A;  5DGM F;  2EWG A;  3WCH A;  3ZOU A;  2Z7I A;  3KRC B;  3LMD A;  3WCL A;  3N1V F;  3WJN A;  4JZX A;  3G4D A;  3WSA A;  3W7F A;  2P1C A;  4KQ5 A;  5AHU B;  3MAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...