3CKEA

Crystal structure of aristolochene synthase in complex with 12,13-difluorofarnesyl diphosphate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
305
structure length
295
Chain Sequence
SLEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTLCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aristolochene synthase
publication title X-ray Crystallographic Studies of Substrate Binding to Aristolochene Synthase Suggest a Metal Ion Binding Sequence for Catalysis.
pubmed doi rcsb
source organism Aspergillus terreus
molecule tags Lyase
total genus 117
structure length 295
sequence length 305
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2008-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3ckeA00
5ILHA 2ONHA 3EZ3A 1HX9A 1WL0A 3CP6A 4NFJF 2E8UA 2E95A 3KRCA 4KKMA 5ILIA 5B0MA 5B02A 1N21A 3LLWA 1HM7A 3SDUA 2Z4YA 5B01A 3KRPB 3VJDA 4LOBA 4L2XF 1HXCA 2ZEUA 2J5CA 4RXAA 5DGNF 5IN8A 4LFGA 5DHIA 2Q58A 5E8LA 2Q9YA 3M9UA 4LLSA 3KRPA 3LMDA 3WJKA 3LDWA 1YJ4A 2ZCOA 3WEJA 5A0KA 2J1OA 4H5CF 3NF2A 3KRAA 3RBMA 1RQIA 3P8LA 4Q23A 5B0KA 5B0LA 5DGSF 4FP4A 3M02A 1FPSA 3EGTA 5ILYA 4OGUA 3RMGA 3BNXA 3OABB 3S4JA 4LFVF 3NRIA 2Z4WA 3VJBA 4DEMF 2E4OA 2Z7IA 4E9UA 1JFGA 3ACXA 3TFVA 4DI5A 4OKMA 4LXWA 5E8KA 5EROA 3KRFB 3WCFA 5HN8A 3ZL6A 3LK5A 3LG5A 1PS1A 2FTZA 1WKZA 5ER8A 3KRFA 1VG7A 5KSXF 5DGMF 4QPFA 4NG6A 3PYBA 4LUUA 4GA3A 1YYUA 4JVJF 2E8XA 5IL8A 1UBVA 2Z7HA 5AHUB 1VG2A 4KUXA 4LIXA 3AE0A 1WY0A 4GP2A 5ILJA 3V1VA 4XQTF 1HM4A 3UCAA 3ZMCA 3WCCA 3WCDA 3KB9A 4XQSF 5IK0A 2OA6A 3P5PA 2AELA 3PKOA 5H9DA 4E9ZA 2AETA 3APZA 3KBKA 2F92F 3VJCA 3WC9A 2E8TA 4NFKF 1N24A 2O1OA 4F6VA 1JFAA 2Q80A 3LGZB 2PS4A 4RXEA 4QXSF 2QISA 3IBAA 4WK5A 1VG3A 4KFAA 3ASXA 3WJOA 4N1ZF 4JXYA 3ZCDA 3M01A 5DZ2A 5IL3A 2Z4XA 2DH4A 3EFQA 1N23A 4N9UA 5HN9A 3G4FA 4NKEA 5CG6A 3WCAA 3NPKA 4F62A 3TFPA 5ERNA 4KPDA 4LA5A 1KIYA 5C05A 3VJ8A 1VG4A 5JV2F 3P41A 3Q1OA 3ICKA 2PS7A 2PS6A 3WCGA 4LFEA 2Z52A 5IMPA 4H5EF 5IKAA 1N20A 2ONGA 3M0GA 3WSBA 2Z78A 5AELA 4OMHA 5A0JA 1N22A 3S9VA 2Z50A 1N1BA 4GAXA 3OABA 3CKEA 4MC0A 3WCMA 4RYPA 2E94A 2E91A 2P1CA 3P8RA 3P5RA 4NKFA 3PH7A 4MC8A 3WCEA 4P0VA 3V66A 3DYFA 3LOMA 3LSNA 3MAVA 3WEFA 3WCIA 3G4DA 1WL1A 2PS8A 3VJEA 1EZFA 4P0XA 1UBXA 4LPGF 3OACB 4KQUA 3N6KF 5EASA 4DZWA 1HXAA 4E1EA 1V4HA 1RQJA 2F8CF 4LZ0A 3WEKA 2ZCRA 3N3DA 3WEGA 5IMNA 5HNAA 3LEEA 5DJRF 5JA0F 1DI1A 3WE9A 2VF6A 1VG6A 3LZ9A 3BNYA 4KWDA 3V1XA 3Q2QA 3AQ0A 4LTZA 1UBWA 4LTVA 5AFXA 3M00A 3N1VF 1KIZA 2RAHA 4LA6A 4KQ5A 3SAEA 4DXJA 3KROB 1YHMA 3WCHA 3SDRA 3ID0A 1WL2A 5ILZA 3N45F 4EA0A 3Q30A 4H5DF 3TC1A 4RXDA 2H8OA 1UBYA 1WMWA 2OGDA 3KROA 2F89F 3N3LF 4LLTA 3ICZA 2Q9ZA 5IMIA 3ACYA 3CC9A 4KK2A 4LZ3A 3TS7A 3WCBA 2ZEVA 5EAUA 3WSAA 4UMJA 5DW7A 4HD1A 1DGPA 3SDTA 3N49F 3LGKA 3WCJA 1YHLA 3N5JF 4P0WA 5IM1A 1ZW5A 3SDVA 2F94F 4KVYA 1V4JA 3ZMBA 3ACWA 1YV5A 3N1WF 2OPMA 3WCLA 4KVWA 4RNQA 4K10A 2AZJA 5DIQF 1YYSA 5JV1F 5JUZF 3ADZA 2EWGA 2AZKA 3ICNA 3LVSA 5I1UA 3KRAB 5AYPA 5IK6A 4KVDA 3N0FA 5EATA 2I19A 3B7LA 3MZVA 3PYAA 4ZQ8A 4GP1A 1N1ZA 5B0JA 1YYTA 3LJIA 5IVGA 4OKZA 4KQSA 3DYGA 3QKCA 2ZY1A 5B00A 3N0GA 5DHKA 2F9KF 4OMGA 3RYEA 3OYRA 2PS5A 1YYQA 3N5HF 3N46F 2F8ZF 3SDQA 5ERMA 1V4IA 3IPIA 2E93A 2F7MF 1V4KA 4JZBA 3ZOUA 4KVIA 3VJ9A 2E8VA 3AQCB 5A0IA 4LZCA 3W7FA 5ILKA 1HXGA 3Q2ZA 2AZLA 4JYXA 5IKHA 5HN7A 4MC3A 3AQBB 2AEKA 3NPRA 5DJVF 5IK9A 4KPJA 4F6XA 2OPNA 2FORA 2E8WA 4RXCA 1YYRA 3WEHA 5CG5A 3VJAA 3WJNA 2J1PA 1YHKA 3PDEA 4NFIF 2ZCSA 3OACA 5B0IA 1YQ7A 4LPHF 4PVXF 2ZCQA 4JXNA 3RYWA 4NUAA 4XQRF 2Z4ZA 5ILDA 3QQVA 4EA2A 4PVYF 2E90A 4JZXA 4EA1A 1V4EA 3WEIA 5E8HA 3TFNA 3KRCB 5B03A 5DJPF 5JV0F 3DYHA 2E92A 4DWBA 1WL3A 4FJQA 3ICMA 1RTRA 4DWGA 2Z4VA 4DHDA
chains in the Genus database with same CATH superfamily
5ILHA 2ONHA 3EZ3A 1HX9A 1WL0A 3CP6A 4NFJF 2E8UA 2E95A 3KRCA 4KKMA 5ILIA 5B0MA 5B02A 1N21A 3LLWA 1HM7A 3SDUA 2Z4YA 5B01A 3KRPB 3VJDA 4LOBA 4L2XF 1HXCA 2ZEUA 2J5CA 4RXAA 5DGNF 5IN8A 4LFGA 5DHIA 2Q58A 5E8LA 2Q9YA 3M9UA 4LLSA 3KRPA 3LMDA 3WJKA 3LDWA 1YJ4A 2ZCOA 3WEJA 5A0KA 2J1OA 4H5CF 3NF2A 3KRAA 3RBMA 1RQIA 3P8LA 4Q23A 5B0KA 5B0LA 5DGSF 4FP4A 3M02A 1FPSA 3EGTA 5ILYA 4OGUA 3RMGA 3BNXA 3OABB 3S4JA 4LFVF 3NRIA 2Z4WA 3VJBA 4DEMF 2E4OA 2Z7IA 4E9UA 1JFGA 3ACXA 3TFVA 4DI5A 4OKMA 4LXWA 5E8KA 5EROA 3KRFB 3WCFA 5HN8A 3ZL6A 3LK5A 3LG5A 1PS1A 2FTZA 1WKZA 5ER8A 3KRFA 1VG7A 5KSXF 5DGMF 4QPFA 4NG6A 3PYBA 4LUUA 4GA3A 1YYUA 4JVJF 2E8XA 5IL8A 1UBVA 2Z7HA 5AHUB 1VG2A 4KUXA 4LIXA 3AE0A 1WY0A 4GP2A 5ILJA 3V1VA 4XQTF 1HM4A 3UCAA 3ZMCA 3WCCA 3WCDA 3KB9A 4XQSF 5IK0A 2OA6A 3P5PA 2AELA 3PKOA 5H9DA 4E9ZA 2AETA 3APZA 3KBKA 2F92F 3VJCA 3WC9A 2E8TA 4NFKF 1N24A 2O1OA 4F6VA 1JFAA 2Q80A 3LGZB 2PS4A 4RXEA 4QXSF 2QISA 3IBAA 4WK5A 1VG3A 4KFAA 3ASXA 3WJOA 4N1ZF 4JXYA 3ZCDA 3M01A 5DZ2A 5IL3A 2Z4XA 2DH4A 3EFQA 1N23A 4N9UA 5HN9A 3G4FA 4NKEA 5CG6A 3WCAA 3NPKA 4F62A 3TFPA 5ERNA 4KPDA 4LA5A 1KIYA 5C05A 3VJ8A 1VG4A 5JV2F 3P41A 3Q1OA 3ICKA 2PS7A 2PS6A 3WCGA 4LFEA 2Z52A 5IMPA 4H5EF 5IKAA 1N20A 2ONGA 3M0GA 3WSBA 2Z78A 5AELA 4OMHA 5A0JA 1N22A 3S9VA 2Z50A 1N1BA 4GAXA 3OABA 3CKEA 4MC0A 3WCMA 4RYPA 2E94A 2E91A 2P1CA 3P8RA 3P5RA 4NKFA 3PH7A 4MC8A 3WCEA 4P0VA 3V66A 3DYFA 3LOMA 3LSNA 3MAVA 3WEFA 3WCIA 3G4DA 1WL1A 2PS8A 3VJEA 1EZFA 4P0XA 1UBXA 4LPGF 3OACB 4KQUA 3N6KF 5EASA 4DZWA 1HXAA 4E1EA 1V4HA 1RQJA 2F8CF 4LZ0A 3WEKA 2ZCRA 3N3DA 3WEGA 5IMNA 5HNAA 3LEEA 5DJRF 5JA0F 1DI1A 3WE9A 2VF6A 1VG6A 3LZ9A 3BNYA 4KWDA 3V1XA 3Q2QA 3AQ0A 4LTZA 1UBWA 4LTVA 5AFXA 3M00A 3N1VF 1KIZA 2RAHA 4LA6A 4KQ5A 3SAEA 4DXJA 3KROB 1YHMA 3WCHA 3SDRA 3ID0A 1WL2A 5ILZA 3N45F 4EA0A 3Q30A 4H5DF 3TC1A 4RXDA 2H8OA 1UBYA 1WMWA 2OGDA 3KROA 2F89F 3N3LF 4LLTA 3ICZA 2Q9ZA 5IMIA 3ACYA 3CC9A 4KK2A 4LZ3A 3TS7A 3WCBA 2ZEVA 5EAUA 3WSAA 4UMJA 5DW7A 4HD1A 1DGPA 3SDTA 3N49F 3LGKA 3WCJA 1YHLA 3N5JF 4P0WA 5IM1A 1ZW5A 3SDVA 2F94F 4KVYA 1V4JA 3ZMBA 3ACWA 1YV5A 3N1WF 2OPMA 3WCLA 4KVWA 4RNQA 4K10A 2AZJA 5DIQF 1YYSA 5JV1F 5JUZF 3ADZA 2EWGA 2AZKA 3ICNA 3LVSA 5I1UA 3KRAB 5AYPA 5IK6A 4KVDA 3N0FA 5EATA 2I19A 3B7LA 3MZVA 3PYAA 4ZQ8A 4GP1A 1N1ZA 5B0JA 1YYTA 3LJIA 5IVGA 4OKZA 4KQSA 3DYGA 3QKCA 2ZY1A 5B00A 3N0GA 5DHKA 2F9KF 4OMGA 3RYEA 3OYRA 2PS5A 1YYQA 3N5HF 3N46F 2F8ZF 3SDQA 5ERMA 1V4IA 3IPIA 2E93A 2F7MF 1V4KA 4JZBA 3ZOUA 4KVIA 3VJ9A 2E8VA 3AQCB 5A0IA 4LZCA 3W7FA 5ILKA 1HXGA 3Q2ZA 2AZLA 4JYXA 5IKHA 5HN7A 4MC3A 3AQBB 2AEKA 3NPRA 5DJVF 5IK9A 4KPJA 4F6XA 2OPNA 2FORA 2E8WA 4RXCA 1YYRA 3WEHA 5CG5A 3VJAA 3WJNA 2J1PA 1YHKA 3PDEA 4NFIF 2ZCSA 3OACA 5B0IA 1YQ7A 4LPHF 4PVXF 2ZCQA 4JXNA 3RYWA 4NUAA 4XQRF 2Z4ZA 5ILDA 3QQVA 4EA2A 4PVYF 2E90A 4JZXA 4EA1A 1V4EA 3WEIA 5E8HA 3TFNA 3KRCB 5B03A 5DJPF 5JV0F 3DYHA 2E92A 4DWBA 1WL3A 4FJQA 3ICMA 1RTRA 4DWGA 2Z4VA 4DHDA
chains in the Genus database with same CATH topology
5ILHA 2ONHA 3EZ3A 1HX9A 1WL0A 3CP6A 4NFJF 2E8UA 2E95A 3KRCA 4KKMA 5ILIA 5B0MA 5B02A 1N21A 3LLWA 1HM7A 3SDUA 2Z4YA 5B01A 3KRPB 3VJDA 4LOBA 4L2XF 1HXCA 2ZEUA 2J5CA 4RXAA 5DGNF 5IN8A 4LFGA 5DHIA 2Q58A 5E8LA 2Q9YA 3M9UA 4LLSA 3KRPA 3LMDA 3WJKA 3LDWA 1YJ4A 2ZCOA 3WEJA 5A0KA 2J1OA 4H5CF 3NF2A 3KRAA 3RBMA 1RQIA 3P8LA 4Q23A 5B0KA 5B0LA 5DGSF 4FP4A 3M02A 1FPSA 3EGTA 5ILYA 4OGUA 3RMGA 3BNXA 3OABB 3S4JA 4LFVF 3NRIA 2Z4WA 3VJBA 4DEMF 2E4OA 2Z7IA 4E9UA 1JFGA 3ACXA 3TFVA 4DI5A 4OKMA 4LXWA 5E8KA 5EROA 3KRFB 3WCFA 5HN8A 3ZL6A 3LK5A 3LG5A 1PS1A 2FTZA 1WKZA 5ER8A 3KRFA 1VG7A 5KSXF 5DGMF 4QPFA 4NG6A 3PYBA 4LUUA 4GA3A 1YYUA 4JVJF 2E8XA 5IL8A 1UBVA 2Z7HA 5AHUB 1VG2A 4KUXA 4LIXA 3AE0A 1WY0A 4GP2A 5ILJA 3V1VA 4XQTF 1HM4A 3UCAA 3ZMCA 3WCCA 3WCDA 3KB9A 4XQSF 5IK0A 2OA6A 3P5PA 2AELA 3PKOA 5H9DA 4E9ZA 2AETA 3APZA 3KBKA 2F92F 3VJCA 3WC9A 2E8TA 4NFKF 1N24A 2O1OA 4F6VA 1JFAA 2Q80A 3LGZB 2PS4A 4RXEA 4QXSF 2QISA 3IBAA 4WK5A 1VG3A 4KFAA 3ASXA 3WJOA 4N1ZF 4JXYA 3ZCDA 3M01A 5DZ2A 5IL3A 2Z4XA 2DH4A 3EFQA 1N23A 4N9UA 5HN9A 3G4FA 4NKEA 5CG6A 3WCAA 3NPKA 4F62A 3TFPA 5ERNA 4KPDA 4LA5A 1KIYA 5C05A 3VJ8A 1VG4A 5JV2F 3P41A 3Q1OA 3ICKA 2PS7A 2PS6A 3WCGA 4LFEA 2Z52A 5IMPA 4H5EF 5IKAA 1N20A 2ONGA 3M0GA 3WSBA 2Z78A 5AELA 4OMHA 5A0JA 1N22A 3S9VA 2Z50A 1N1BA 4GAXA 3OABA 3CKEA 4MC0A 3WCMA 4RYPA 2E94A 2E91A 2P1CA 3P8RA 3P5RA 4NKFA 3PH7A 4MC8A 3WCEA 4P0VA 3V66A 3DYFA 3LOMA 3LSNA 3MAVA 3WEFA 3WCIA 3G4DA 1WL1A 2PS8A 3VJEA 1EZFA 4P0XA 1UBXA 4LPGF 3OACB 4KQUA 3N6KF 5EASA 4DZWA 1HXAA 4E1EA 1V4HA 1RQJA 2F8CF 4LZ0A 3WEKA 2ZCRA 3N3DA 3WEGA 5IMNA 5HNAA 3LEEA 5DJRF 5JA0F 1DI1A 3WE9A 2VF6A 1VG6A 3LZ9A 3BNYA 4KWDA 3V1XA 3Q2QA 3AQ0A 4LTZA 1UBWA 4LTVA 5AFXA 3M00A 3N1VF 1KIZA 2RAHA 4LA6A 4KQ5A 3SAEA 4DXJA 3KROB 1YHMA 3WCHA 3SDRA 3ID0A 1WL2A 5ILZA 3N45F 4EA0A 3Q30A 4H5DF 3TC1A 4RXDA 2H8OA 1UBYA 1WMWA 2OGDA 3KROA 2F89F 3N3LF 4LLTA 3ICZA 2Q9ZA 5IMIA 3ACYA 3CC9A 4KK2A 4LZ3A 3TS7A 3WCBA 2ZEVA 5EAUA 3WSAA 4UMJA 5DW7A 4HD1A 1DGPA 3SDTA 3N49F 3LGKA 3WCJA 1YHLA 3N5JF 4P0WA 5IM1A 1ZW5A 3SDVA 2F94F 4KVYA 1V4JA 3ZMBA 3ACWA 1YV5A 3N1WF 2OPMA 3WCLA 4KVWA 4RNQA 4K10A 2AZJA 5DIQF 1YYSA 5JV1F 5JUZF 3ADZA 2EWGA 2AZKA 3ICNA 3LVSA 5I1UA 3KRAB 5AYPA 5IK6A 4KVDA 3N0FA 5EATA 2I19A 3B7LA 3MZVA 3PYAA 4ZQ8A 4GP1A 1N1ZA 5B0JA 1YYTA 3LJIA 5IVGA 4OKZA 4KQSA 3DYGA 3QKCA 2ZY1A 5B00A 3N0GA 5DHKA 2F9KF 4OMGA 3RYEA 3OYRA 2PS5A 1YYQA 3N5HF 3N46F 2F8ZF 3SDQA 5ERMA 1V4IA 3IPIA 2E93A 2F7MF 1V4KA 4JZBA 3ZOUA 4KVIA 3VJ9A 2E8VA 3AQCB 5A0IA 4LZCA 3W7FA 5ILKA 1HXGA 3Q2ZA 2AZLA 4JYXA 5IKHA 5HN7A 4MC3A 3AQBB 2AEKA 3NPRA 5DJVF 5IK9A 4KPJA 4F6XA 2OPNA 2FORA 2E8WA 4RXCA 1YYRA 3WEHA 5CG5A 3VJAA 3WJNA 2J1PA 1YHKA 3PDEA 4NFIF 2ZCSA 3OACA 5B0IA 1YQ7A 4LPHF 4PVXF 2ZCQA 4JXNA 3RYWA 4NUAA 4XQRF 2Z4ZA 5ILDA 3QQVA 4EA2A 4PVYF 2E90A 4JZXA 4EA1A 1V4EA 3WEIA 5E8HA 3TFNA 3KRCB 5B03A 5DJPF 5JV0F 3DYHA 2E92A 4DWBA 1WL3A 4FJQA 3ICMA 1RTRA 4DWGA 2Z4VA 4DHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILH A;  2ONH A;  3EZ3 A;  1HX9 A;  1WL0 A;  3CP6 A;  4NFJ F;  2E8U A;  2E95 A;  3KRC A;  4KKM A;  5ILI A;  5B0M A;  5B02 A;  1N21 A;  3LLW A;  1HM7 A;  3SDU A;  2Z4Y A;  5B01 A;  3KRP B;  3VJD A;  4LOB A;  4L2X F;  1HXC A;  2ZEU A;  2J5C A;  4RXA A;  5DGN F;  5IN8 A;  4LFG A;  5DHI A;  2Q58 A;  5E8L A;  2Q9Y A;  3M9U A;  4LLS A;  3KRP A;  3LMD A;  3WJK A;  3LDW A;  1YJ4 A;  2ZCO A;  3WEJ A;  5A0K A;  2J1O A;  4H5C F;  3NF2 A;  3KRA A;  3RBM A;  1RQI A;  3P8L A;  4Q23 A;  5B0K A;  5B0L A;  5DGS F;  4FP4 A;  3M02 A;  1FPS A;  3EGT A;  5ILY A;  4OGU A;  3RMG A;  3BNX A;  3OAB B;  3S4J A;  4LFV F;  3NRI A;  2Z4W A;  3VJB A;  4DEM F;  2E4O A;  2Z7I A;  4E9U A;  1JFG A;  3ACX A;  3TFV A;  4DI5 A;  4OKM A;  4LXW A;  5E8K A;  5ERO A;  3KRF B;  3WCF A;  5HN8 A;  3ZL6 A;  3LK5 A;  3LG5 A;  1PS1 A;  2FTZ A;  1WKZ A;  5ER8 A;  3KRF A;  1VG7 A;  5KSX F;  5DGM F;  4QPF A;  4NG6 A;  3PYB A;  4LUU A;  4GA3 A;  1YYU A;  4JVJ F;  2E8X A;  5IL8 A;  1UBV A;  2Z7H A;  5AHU B;  1VG2 A;  4KUX A;  4LIX A;  3AE0 A;  1WY0 A;  4GP2 A;  5ILJ A;  3V1V A;  4XQT F;  1HM4 A;  3UCA A;  3ZMC A;  3WCC A;  3WCD A;  3KB9 A;  4XQS F;  5IK0 A;  2OA6 A;  3P5P A;  2AEL A;  3PKO A;  5H9D A;  4E9Z A;  2AET A;  3APZ A;  3KBK A;  2F92 F;  3VJC A;  3WC9 A;  2E8T A;  4NFK F;  1N24 A;  2O1O A;  4F6V A;  1JFA A;  2Q80 A;  3LGZ B;  2PS4 A;  4RXE A;  4QXS F;  2QIS A;  3IBA A;  4WK5 A;  1VG3 A;  4KFA A;  3ASX A;  3WJO A;  4N1Z F;  4JXY A;  3ZCD A;  3M01 A;  5DZ2 A;  5IL3 A;  2Z4X A;  2DH4 A;  3EFQ A;  1N23 A;  4N9U A;  5HN9 A;  3G4F A;  4NKE A;  5CG6 A;  3WCA A;  3NPK A;  4F62 A;  3TFP A;  5ERN A;  4KPD A;  4LA5 A;  1KIY A;  5C05 A;  3VJ8 A;  1VG4 A;  5JV2 F;  3P41 A;  3Q1O A;  3ICK A;  2PS7 A;  2PS6 A;  3WCG A;  4LFE A;  2Z52 A;  5IMP A;  4H5E F;  5IKA A;  1N20 A;  2ONG A;  3M0G A;  3WSB A;  2Z78 A;  5AEL A;  4OMH A;  5A0J A;  1N22 A;  3S9V A;  2Z50 A;  1N1B A;  4GAX A;  3OAB A;  3CKE A;  4MC0 A;  3WCM A;  4RYP A;  2E94 A;  2E91 A;  2P1C A;  3P8R A;  3P5R A;  4NKF A;  3PH7 A;  4MC8 A;  3WCE A;  4P0V A;  3V66 A;  3DYF A;  3LOM A;  3LSN A;  3MAV A;  3WEF A;  3WCI A;  3G4D A;  1WL1 A;  2PS8 A;  3VJE A;  1EZF A;  4P0X A;  1UBX A;  4LPG F;  3OAC B;  4KQU A;  3N6K F;  5EAS A;  4DZW A;  1HXA A;  4E1E A;  1V4H A;  1RQJ A;  2F8C F;  4LZ0 A;  3WEK A;  2ZCR A;  3N3D A;  3WEG A;  5IMN A;  5HNA A;  3LEE A;  5DJR F;  5JA0 F;  1DI1 A;  3WE9 A;  2VF6 A;  1VG6 A;  3LZ9 A;  3BNY A;  4KWD A;  3V1X A;  3Q2Q A;  3AQ0 A;  4LTZ A;  1UBW A;  4LTV A;  5AFX A;  3M00 A;  3N1V F;  1KIZ A;  2RAH A;  4LA6 A;  4KQ5 A;  3SAE A;  4DXJ A;  3KRO B;  1YHM A;  3WCH A;  3SDR A;  3ID0 A;  1WL2 A;  5ILZ A;  3N45 F;  4EA0 A;  3Q30 A;  4H5D F;  3TC1 A;  4RXD A;  2H8O A;  1UBY A;  1WMW A;  2OGD A;  3KRO A;  2F89 F;  3N3L F;  4LLT A;  3ICZ A;  2Q9Z A;  5IMI A;  3ACY A;  3CC9 A;  4KK2 A;  4LZ3 A;  3TS7 A;  3WCB A;  2ZEV A;  5EAU A;  3WSA A;  4UMJ A;  5DW7 A;  4HD1 A;  1DGP A;  3SDT A;  3N49 F;  3LGK A;  3WCJ A;  1YHL A;  3N5J F;  4P0W A;  5IM1 A;  1ZW5 A;  3SDV A;  2F94 F;  4KVY A;  1V4J A;  3ZMB A;  3ACW A;  1YV5 A;  3N1W F;  2OPM A;  3WCL A;  4KVW A;  4RNQ A;  4K10 A;  2AZJ A;  5DIQ F;  1YYS A;  5JV1 F;  5JUZ F;  3ADZ A;  2EWG A;  2AZK A;  3ICN A;  3LVS A;  5I1U A;  3KRA B;  5AYP A;  5IK6 A;  4KVD A;  3N0F A;  5EAT A;  2I19 A;  3B7L A;  3MZV A;  3PYA A;  4ZQ8 A;  4GP1 A;  1N1Z A;  5B0J A;  1YYT A;  3LJI A;  5IVG A;  4OKZ A;  4KQS A;  3DYG A;  3QKC A;  2ZY1 A;  5B00 A;  3N0G A;  5DHK A;  2F9K F;  4OMG A;  3RYE A;  3OYR A;  2PS5 A;  1YYQ A;  3N5H F;  3N46 F;  2F8Z F;  3SDQ A;  5ERM A;  1V4I A;  3IPI A;  2E93 A;  2F7M F;  1V4K A;  4JZB A;  3ZOU A;  4KVI A;  3VJ9 A;  2E8V A;  3AQC B;  5A0I A;  4LZC A;  3W7F A;  5ILK A;  1HXG A;  3Q2Z A;  2AZL A;  4JYX A;  5IKH A;  5HN7 A;  4MC3 A;  3AQB B;  2AEK A;  3NPR A;  5DJV F;  5IK9 A;  4KPJ A;  4F6X A;  2OPN A;  2FOR A;  2E8W A;  4RXC A;  1YYR A;  3WEH A;  5CG5 A;  3VJA A;  3WJN A;  2J1P A;  1YHK A;  3PDE A;  4NFI F;  2ZCS A;  3OAC A;  5B0I A;  1YQ7 A;  4LPH F;  4PVX F;  2ZCQ A;  4JXN A;  3RYW A;  4NUA A;  4XQR F;  2Z4Z A;  5ILD A;  3QQV A;  4EA2 A;  4PVY F;  2E90 A;  4JZX A;  4EA1 A;  1V4E A;  3WEI A;  5E8H A;  3TFN A;  3KRC B;  5B03 A;  5DJP F;  5JV0 F;  3DYH A;  2E92 A;  4DWB A;  1WL3 A;  4FJQ A;  3ICM A;  1RTR A;  4DWG A;  2Z4V A;  4DHD A; 
#chains in the Genus database with same CATH topology
 5ILH A;  2ONH A;  3EZ3 A;  1HX9 A;  1WL0 A;  3CP6 A;  4NFJ F;  2E8U A;  2E95 A;  3KRC A;  4KKM A;  5ILI A;  5B0M A;  5B02 A;  1N21 A;  3LLW A;  1HM7 A;  3SDU A;  2Z4Y A;  5B01 A;  3KRP B;  3VJD A;  4LOB A;  4L2X F;  1HXC A;  2ZEU A;  2J5C A;  4RXA A;  5DGN F;  5IN8 A;  4LFG A;  5DHI A;  2Q58 A;  5E8L A;  2Q9Y A;  3M9U A;  4LLS A;  3KRP A;  3LMD A;  3WJK A;  3LDW A;  1YJ4 A;  2ZCO A;  3WEJ A;  5A0K A;  2J1O A;  4H5C F;  3NF2 A;  3KRA A;  3RBM A;  1RQI A;  3P8L A;  4Q23 A;  5B0K A;  5B0L A;  5DGS F;  4FP4 A;  3M02 A;  1FPS A;  3EGT A;  5ILY A;  4OGU A;  3RMG A;  3BNX A;  3OAB B;  3S4J A;  4LFV F;  3NRI A;  2Z4W A;  3VJB A;  4DEM F;  2E4O A;  2Z7I A;  4E9U A;  1JFG A;  3ACX A;  3TFV A;  4DI5 A;  4OKM A;  4LXW A;  5E8K A;  5ERO A;  3KRF B;  3WCF A;  5HN8 A;  3ZL6 A;  3LK5 A;  3LG5 A;  1PS1 A;  2FTZ A;  1WKZ A;  5ER8 A;  3KRF A;  1VG7 A;  5KSX F;  5DGM F;  4QPF A;  4NG6 A;  3PYB A;  4LUU A;  4GA3 A;  1YYU A;  4JVJ F;  2E8X A;  5IL8 A;  1UBV A;  2Z7H A;  5AHU B;  1VG2 A;  4KUX A;  4LIX A;  3AE0 A;  1WY0 A;  4GP2 A;  5ILJ A;  3V1V A;  4XQT F;  1HM4 A;  3UCA A;  3ZMC A;  3WCC A;  3WCD A;  3KB9 A;  4XQS F;  5IK0 A;  2OA6 A;  3P5P A;  2AEL A;  3PKO A;  5H9D A;  4E9Z A;  2AET A;  3APZ A;  3KBK A;  2F92 F;  3VJC A;  3WC9 A;  2E8T A;  4NFK F;  1N24 A;  2O1O A;  4F6V A;  1JFA A;  2Q80 A;  3LGZ B;  2PS4 A;  4RXE A;  4QXS F;  2QIS A;  3IBA A;  4WK5 A;  1VG3 A;  4KFA A;  3ASX A;  3WJO A;  4N1Z F;  4JXY A;  3ZCD A;  3M01 A;  5DZ2 A;  5IL3 A;  2Z4X A;  2DH4 A;  3EFQ A;  1N23 A;  4N9U A;  5HN9 A;  3G4F A;  4NKE A;  5CG6 A;  3WCA A;  3NPK A;  4F62 A;  3TFP A;  5ERN A;  4KPD A;  4LA5 A;  1KIY A;  5C05 A;  3VJ8 A;  1VG4 A;  5JV2 F;  3P41 A;  3Q1O A;  3ICK A;  2PS7 A;  2PS6 A;  3WCG A;  4LFE A;  2Z52 A;  5IMP A;  4H5E F;  5IKA A;  1N20 A;  2ONG A;  3M0G A;  3WSB A;  2Z78 A;  5AEL A;  4OMH A;  5A0J A;  1N22 A;  3S9V A;  2Z50 A;  1N1B A;  4GAX A;  3OAB A;  3CKE A;  4MC0 A;  3WCM A;  4RYP A;  2E94 A;  2E91 A;  2P1C A;  3P8R A;  3P5R A;  4NKF A;  3PH7 A;  4MC8 A;  3WCE A;  4P0V A;  3V66 A;  3DYF A;  3LOM A;  3LSN A;  3MAV A;  3WEF A;  3WCI A;  3G4D A;  1WL1 A;  2PS8 A;  3VJE A;  1EZF A;  4P0X A;  1UBX A;  4LPG F;  3OAC B;  4KQU A;  3N6K F;  5EAS A;  4DZW A;  1HXA A;  4E1E A;  1V4H A;  1RQJ A;  2F8C F;  4LZ0 A;  3WEK A;  2ZCR A;  3N3D A;  3WEG A;  5IMN A;  5HNA A;  3LEE A;  5DJR F;  5JA0 F;  1DI1 A;  3WE9 A;  2VF6 A;  1VG6 A;  3LZ9 A;  3BNY A;  4KWD A;  3V1X A;  3Q2Q A;  3AQ0 A;  4LTZ A;  1UBW A;  4LTV A;  5AFX A;  3M00 A;  3N1V F;  1KIZ A;  2RAH A;  4LA6 A;  4KQ5 A;  3SAE A;  4DXJ A;  3KRO B;  1YHM A;  3WCH A;  3SDR A;  3ID0 A;  1WL2 A;  5ILZ A;  3N45 F;  4EA0 A;  3Q30 A;  4H5D F;  3TC1 A;  4RXD A;  2H8O A;  1UBY A;  1WMW A;  2OGD A;  3KRO A;  2F89 F;  3N3L F;  4LLT A;  3ICZ A;  2Q9Z A;  5IMI A;  3ACY A;  3CC9 A;  4KK2 A;  4LZ3 A;  3TS7 A;  3WCB A;  2ZEV A;  5EAU A;  3WSA A;  4UMJ A;  5DW7 A;  4HD1 A;  1DGP A;  3SDT A;  3N49 F;  3LGK A;  3WCJ A;  1YHL A;  3N5J F;  4P0W A;  5IM1 A;  1ZW5 A;  3SDV A;  2F94 F;  4KVY A;  1V4J A;  3ZMB A;  3ACW A;  1YV5 A;  3N1W F;  2OPM A;  3WCL A;  4KVW A;  4RNQ A;  4K10 A;  2AZJ A;  5DIQ F;  1YYS A;  5JV1 F;  5JUZ F;  3ADZ A;  2EWG A;  2AZK A;  3ICN A;  3LVS A;  5I1U A;  3KRA B;  5AYP A;  5IK6 A;  4KVD A;  3N0F A;  5EAT A;  2I19 A;  3B7L A;  3MZV A;  3PYA A;  4ZQ8 A;  4GP1 A;  1N1Z A;  5B0J A;  1YYT A;  3LJI A;  5IVG A;  4OKZ A;  4KQS A;  3DYG A;  3QKC A;  2ZY1 A;  5B00 A;  3N0G A;  5DHK A;  2F9K F;  4OMG A;  3RYE A;  3OYR A;  2PS5 A;  1YYQ A;  3N5H F;  3N46 F;  2F8Z F;  3SDQ A;  5ERM A;  1V4I A;  3IPI A;  2E93 A;  2F7M F;  1V4K A;  4JZB A;  3ZOU A;  4KVI A;  3VJ9 A;  2E8V A;  3AQC B;  5A0I A;  4LZC A;  3W7F A;  5ILK A;  1HXG A;  3Q2Z A;  2AZL A;  4JYX A;  5IKH A;  5HN7 A;  4MC3 A;  3AQB B;  2AEK A;  3NPR A;  5DJV F;  5IK9 A;  4KPJ A;  4F6X A;  2OPN A;  2FOR A;  2E8W A;  4RXC A;  1YYR A;  3WEH A;  5CG5 A;  3VJA A;  3WJN A;  2J1P A;  1YHK A;  3PDE A;  4NFI F;  2ZCS A;  3OAC A;  5B0I A;  1YQ7 A;  4LPH F;  4PVX F;  2ZCQ A;  4JXN A;  3RYW A;  4NUA A;  4XQR F;  2Z4Z A;  5ILD A;  3QQV A;  4EA2 A;  4PVY F;  2E90 A;  4JZX A;  4EA1 A;  1V4E A;  3WEI A;  5E8H A;  3TFN A;  3KRC B;  5B03 A;  5DJP F;  5JV0 F;  3DYH A;  2E92 A;  4DWB A;  1WL3 A;  4FJQ A;  3ICM A;  1RTR A;  4DWG A;  2Z4V A;  4DHD A; 
#chains in the Genus database with same CATH homology
 5ILH A;  2ONH A;  3EZ3 A;  1HX9 A;  1WL0 A;  3CP6 A;  4NFJ F;  2E8U A;  2E95 A;  3KRC A;  4KKM A;  5ILI A;  5B0M A;  5B02 A;  1N21 A;  3LLW A;  1HM7 A;  3SDU A;  2Z4Y A;  5B01 A;  3KRP B;  3VJD A;  4LOB A;  4L2X F;  1HXC A;  2ZEU A;  2J5C A;  4RXA A;  5DGN F;  5IN8 A;  4LFG A;  5DHI A;  2Q58 A;  5E8L A;  2Q9Y A;  3M9U A;  4LLS A;  3KRP A;  3LMD A;  3WJK A;  3LDW A;  1YJ4 A;  2ZCO A;  3WEJ A;  5A0K A;  2J1O A;  4H5C F;  3NF2 A;  3KRA A;  3RBM A;  1RQI A;  3P8L A;  4Q23 A;  5B0K A;  5B0L A;  5DGS F;  4FP4 A;  3M02 A;  1FPS A;  3EGT A;  5ILY A;  4OGU A;  3RMG A;  3BNX A;  3OAB B;  3S4J A;  4LFV F;  3NRI A;  2Z4W A;  3VJB A;  4DEM F;  2E4O A;  2Z7I A;  4E9U A;  1JFG A;  3ACX A;  3TFV A;  4DI5 A;  4OKM A;  4LXW A;  5E8K A;  5ERO A;  3KRF B;  3WCF A;  5HN8 A;  3ZL6 A;  3LK5 A;  3LG5 A;  1PS1 A;  2FTZ A;  1WKZ A;  5ER8 A;  3KRF A;  1VG7 A;  5KSX F;  5DGM F;  4QPF A;  4NG6 A;  3PYB A;  4LUU A;  4GA3 A;  1YYU A;  4JVJ F;  2E8X A;  5IL8 A;  1UBV A;  2Z7H A;  5AHU B;  1VG2 A;  4KUX A;  4LIX A;  3AE0 A;  1WY0 A;  4GP2 A;  5ILJ A;  3V1V A;  4XQT F;  1HM4 A;  3UCA A;  3ZMC A;  3WCC A;  3WCD A;  3KB9 A;  4XQS F;  5IK0 A;  2OA6 A;  3P5P A;  2AEL A;  3PKO A;  5H9D A;  4E9Z A;  2AET A;  3APZ A;  3KBK A;  2F92 F;  3VJC A;  3WC9 A;  2E8T A;  4NFK F;  1N24 A;  2O1O A;  4F6V A;  1JFA A;  2Q80 A;  3LGZ B;  2PS4 A;  4RXE A;  4QXS F;  2QIS A;  3IBA A;  4WK5 A;  1VG3 A;  4KFA A;  3ASX A;  3WJO A;  4N1Z F;  4JXY A;  3ZCD A;  3M01 A;  5DZ2 A;  5IL3 A;  2Z4X A;  2DH4 A;  3EFQ A;  1N23 A;  4N9U A;  5HN9 A;  3G4F A;  4NKE A;  5CG6 A;  3WCA A;  3NPK A;  4F62 A;  3TFP A;  5ERN A;  4KPD A;  4LA5 A;  1KIY A;  5C05 A;  3VJ8 A;  1VG4 A;  5JV2 F;  3P41 A;  3Q1O A;  3ICK A;  2PS7 A;  2PS6 A;  3WCG A;  4LFE A;  2Z52 A;  5IMP A;  4H5E F;  5IKA A;  1N20 A;  2ONG A;  3M0G A;  3WSB A;  2Z78 A;  5AEL A;  4OMH A;  5A0J A;  1N22 A;  3S9V A;  2Z50 A;  1N1B A;  4GAX A;  3OAB A;  3CKE A;  4MC0 A;  3WCM A;  4RYP A;  2E94 A;  2E91 A;  2P1C A;  3P8R A;  3P5R A;  4NKF A;  3PH7 A;  4MC8 A;  3WCE A;  4P0V A;  3V66 A;  3DYF A;  3LOM A;  3LSN A;  3MAV A;  3WEF A;  3WCI A;  3G4D A;  1WL1 A;  2PS8 A;  3VJE A;  1EZF A;  4P0X A;  1UBX A;  4LPG F;  3OAC B;  4KQU A;  3N6K F;  5EAS A;  4DZW A;  1HXA A;  4E1E A;  1V4H A;  1RQJ A;  2F8C F;  4LZ0 A;  3WEK A;  2ZCR A;  3N3D A;  3WEG A;  5IMN A;  5HNA A;  3LEE A;  5DJR F;  5JA0 F;  1DI1 A;  3WE9 A;  2VF6 A;  1VG6 A;  3LZ9 A;  3BNY A;  4KWD A;  3V1X A;  3Q2Q A;  3AQ0 A;  4LTZ A;  1UBW A;  4LTV A;  5AFX A;  3M00 A;  3N1V F;  1KIZ A;  2RAH A;  4LA6 A;  4KQ5 A;  3SAE A;  4DXJ A;  3KRO B;  1YHM A;  3WCH A;  3SDR A;  3ID0 A;  1WL2 A;  5ILZ A;  3N45 F;  4EA0 A;  3Q30 A;  4H5D F;  3TC1 A;  4RXD A;  2H8O A;  1UBY A;  1WMW A;  2OGD A;  3KRO A;  2F89 F;  3N3L F;  4LLT A;  3ICZ A;  2Q9Z A;  5IMI A;  3ACY A;  3CC9 A;  4KK2 A;  4LZ3 A;  3TS7 A;  3WCB A;  2ZEV A;  5EAU A;  3WSA A;  4UMJ A;  5DW7 A;  4HD1 A;  1DGP A;  3SDT A;  3N49 F;  3LGK A;  3WCJ A;  1YHL A;  3N5J F;  4P0W A;  5IM1 A;  1ZW5 A;  3SDV A;  2F94 F;  4KVY A;  1V4J A;  3ZMB A;  3ACW A;  1YV5 A;  3N1W F;  2OPM A;  3WCL A;  4KVW A;  4RNQ A;  4K10 A;  2AZJ A;  5DIQ F;  1YYS A;  5JV1 F;  5JUZ F;  3ADZ A;  2EWG A;  2AZK A;  3ICN A;  3LVS A;  5I1U A;  3KRA B;  5AYP A;  5IK6 A;  4KVD A;  3N0F A;  5EAT A;  2I19 A;  3B7L A;  3MZV A;  3PYA A;  4ZQ8 A;  4GP1 A;  1N1Z A;  5B0J A;  1YYT A;  3LJI A;  5IVG A;  4OKZ A;  4KQS A;  3DYG A;  3QKC A;  2ZY1 A;  5B00 A;  3N0G A;  5DHK A;  2F9K F;  4OMG A;  3RYE A;  3OYR A;  2PS5 A;  1YYQ A;  3N5H F;  3N46 F;  2F8Z F;  3SDQ A;  5ERM A;  1V4I A;  3IPI A;  2E93 A;  2F7M F;  1V4K A;  4JZB A;  3ZOU A;  4KVI A;  3VJ9 A;  2E8V A;  3AQC B;  5A0I A;  4LZC A;  3W7F A;  5ILK A;  1HXG A;  3Q2Z A;  2AZL A;  4JYX A;  5IKH A;  5HN7 A;  4MC3 A;  3AQB B;  2AEK A;  3NPR A;  5DJV F;  5IK9 A;  4KPJ A;  4F6X A;  2OPN A;  2FOR A;  2E8W A;  4RXC A;  1YYR A;  3WEH A;  5CG5 A;  3VJA A;  3WJN A;  2J1P A;  1YHK A;  3PDE A;  4NFI F;  2ZCS A;  3OAC A;  5B0I A;  1YQ7 A;  4LPH F;  4PVX F;  2ZCQ A;  4JXN A;  3RYW A;  4NUA A;  4XQR F;  2Z4Z A;  5ILD A;  3QQV A;  4EA2 A;  4PVY F;  2E90 A;  4JZX A;  4EA1 A;  1V4E A;  3WEI A;  5E8H A;  3TFN A;  3KRC B;  5B03 A;  5DJP F;  5JV0 F;  3DYH A;  2E92 A;  4DWB A;  1WL3 A;  4FJQ A;  3ICM A;  1RTR A;  4DWG A;  2Z4V A;  4DHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...