3CKEA

Crystal structure of aristolochene synthase in complex with 12,13-difluorofarnesyl diphosphate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
305
structure length
295
Chain Sequence
SLEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTLCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Aristolochene synthase
publication title X-ray Crystallographic Studies of Substrate Binding to Aristolochene Synthase Suggest a Metal Ion Binding Sequence for Catalysis.
pubmed doi rcsb
source organism Aspergillus terreus
total genus 117
structure length 295
sequence length 305
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2008-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3ckeA00
3LJIA 3M00A 4MC0A 3Q1OA 2F8CF 5DHKA 1N24A 4DWBA 2E90A 1HXGA 5DZ2A 5DGSF 1RQJA 3AQBB 3NPKA 2E8XA 2P1CA 3CKEA 1YV5A 2E4OA 4LTZA 2ONGA 4LIXA 3WCEA 2F8ZF 4NFKF 5AYPA 4DI5A 3KB9A 4DEMF 3PYAA 3ZL6A 2Z4YA 1N21A 4EA0A 1EZFA 3M0GA 5DW7A 2E8UA 5IVGA 3OABA 5JUZF 3W7FA 4LFGA 3OACA 4MC3A 3G4FA 3N3LF 3EGTA 2J5CA 3VJ9A 3CC9A 3N46F 3WCAA 3WEJA 3WCHA 3VJCA 2H8OA 4LZCA 3B7LA 5ILDA 3LGKA 5DGNF 3KRAB 1YJ4A 3TFVA 1RQIA 5EAUA 4LTVA 1ZW5A 4LXWA 1UBVA 2ZY1A 3Q30A 4LPHF 4H5DF 1V4KA 3ZCDA 2E93A 3PKOA 3WCDA 3ACYA 4LZ3A 4KWDA 3V1VA 3KRFA 3NPRA 4LFVF 3WEHA 3SDRA 2I19A 4MC8A 3SDVA 5B0LA 3WEFA 4H5CF 1DI1A 2E8TA 5DJVF 3Q2ZA 3SDQA 3LMDA 4Q23A 4DXJA 3TFPA 4LLSA 4EA1A 4KVIA 2Z52A 2AZLA 1V4JA 2OGDA 1WL3A 5AFXA 4LA6A 5B00A 5DJRF 3P41A 3KRAA 2Q9ZA 5B03A 4F62A 3WE9A 3BNYA 5HNAA 3LDWA 1DGPA 3M9UA 4PVXF 3UCAA 3LK5A 5IK6A 1YYTA 2PS4A 3WJKA 5H9DA 5B0MA 2OPNA 1YYRA 4JZXA 1VG3A 2AETA 3N5HF 1HM4A 3EZ3A 4H5EF 4LOBA 3P8LA 4RXCA 4P0VA 3SDUA 5I1UA 4KVDA 3N6KF 1RTRA 3ZOUA 3WSBA 3P8RA 4JXYA 5ILKA 3MZVA 1WKZA 2PS8A 4PVYF 1HXCA 5IMPA 5EATA 3ICZA 4GA3A 3KRFB 1V4IA 5IK9A 2DH4A 3TFNA 1FPSA 3NF2A 1YHKA 5DGMF 3N49F 2PS7A 4KVYA 2OA6A 5B0JA 3V1XA 5HN7A 3DYFA 3LZ9A 3P5RA 4NKFA 1N1ZA 3WCBA 1YYUA 3PYBA 5IL3A 3WSAA 2Z50A 4KUXA 3KRPB 5EROA 4FP4A 3WCCA 2ZCOA 4LUUA 1YYSA 4LA5A 4XQRF 5IMNA 4KKMA 5CG5A 1WY0A 5DHIA 4KQ5A 3N5JF 4ZQ8A 4KQSA 5IMIA 4OKZA 5HN8A 2F94F 3ZMCA 3SAEA 2E8VA 2E95A 1YYQA 3KROB 3MAVA 4F6XA 4RXDA 5JV1F 4OMHA 4UMJA 3VJEA 2Z4VA 5E8HA 4GAXA 5EASA 2Q9YA 4RNQA 3OYRA 3N0GA 4GP1A 3LLWA 2ZEVA 2E94A 1WL1A 4E9UA 5E8KA 3ADZA 5C05A 3RMGA 3WJNA 5A0IA 4NFJF 5IL8A 5ILHA 1JFAA 3BNXA 3KRPA 2RAHA 3WCMA 2OPMA 2AEKA 3QQVA 1JFGA 5ILIA 5ERMA 3N1VF 3SDTA 3ICKA 1PS1A 3S9VA 4RXEA 4LZ0A 3RBMA 4DWGA 4EA2A 3P5PA 3AQ0A 3RYWA 1KIZA 4NG6A 5ILZA 1WL2A 4KVWA 4JXNA 4QPFA 2QISA 3KROA 2Z78A 4HD1A 5IK0A 5ERNA 3ID0A 3PH7A 3ICNA 2AELA 4KFAA 2PS6A 4RYPA 4DHDA 2E91A 2Z4WA 3WCFA 2Z4ZA 4WK5A 1WMWA 1YHLA 2Z7HA 3DYGA 1VG2A 3N45F 3ACWA 3WEKA 3LGZB 3VJAA 3WEGA 4E1EA 2F9KF 1VG4A 3ZMBA 4KPDA 1WL0A 1UBXA 3LG5A 3TS7A 3N1WF 4K10A 5B02A 3S4JA 2VF6A 4JYXA 3AQCB 3QKCA 5ILJA 3KRCB 3G4DA 3NRIA 1HXAA 3WEIA 2ONHA 3M02A 3WCLA 4KQUA 5IM1A 4XQSF 2F7MF 3DYHA 5DIQF 1N22A 2J1PA 2AZKA 3IPIA 3VJDA 2E8WA 5B0IA 4OKMA 4FJQA 5IKAA 4NKEA 3LSNA 2E92A 3LVSA 5HN9A 5KSXF 5A0KA 4QXSF 4NUAA 5IKHA 4N9UA 2O1OA 1YHMA 2ZEUA 5JA0F 4RXAA 2ZCRA 5B0KA 2PS5A 5DJPF 5ER8A 3WCGA 3WJOA 3LOMA 2J1OA 1N1BA 4KK2A 3VJ8A 4DZWA 2Z7IA 3N3DA 1VG7A 5E8LA 3CP6A 4P0WA 4JZBA 4OGUA 3KRCA 1UBWA 3VJBA 4OMGA 4P0XA 4F6VA 3ASXA 3LEEA 3WCJA 3EFQA 5IN8A 4L2XF 1V4HA 1VG6A 3N0FA 5A0JA 4GP2A 3Q2QA 2F89F 3PDEA 3ICMA 2FORA 3V66A 3IBAA 2FTZA 2AZJA 2ZCQA 4E9ZA 4N1ZF 1UBYA 4KPJA 5JV0F 4XQTF 3TC1A 3ACXA 5JV2F 3WCIA 1HX9A 1V4EA 2ZCSA 2Q80A 4LPGF 1HM7A 4NFIF 4LFEA 1YQ7A 5AELA 2Z4XA 2F92F 2Q58A 3M01A 3RYEA 2EWGA 3OABB 4LLTA 3OACB 1KIYA 5AHUB 5B01A 3APZA 3AE0A 5ILYA 4JVJF 1N20A 5CG6A 3KBKA 1N23A 3WC9A
chains in the Genus database with same CATH superfamily
3LJIA 3M00A 4MC0A 3Q1OA 2F8CF 5DHKA 1N24A 4DWBA 2E90A 1HXGA 5DZ2A 5DGSF 1RQJA 3AQBB 3NPKA 2E8XA 2P1CA 3CKEA 1YV5A 2E4OA 4LTZA 2ONGA 4LIXA 3WCEA 2F8ZF 4NFKF 5AYPA 4DI5A 3KB9A 4DEMF 3PYAA 3ZL6A 2Z4YA 1N21A 4EA0A 1EZFA 3M0GA 5DW7A 2E8UA 5IVGA 3OABA 5JUZF 3W7FA 4LFGA 3OACA 4MC3A 3G4FA 3N3LF 3EGTA 2J5CA 3VJ9A 3CC9A 3N46F 3WCAA 3WEJA 3WCHA 3VJCA 2H8OA 4LZCA 3B7LA 5ILDA 3LGKA 5DGNF 3KRAB 1YJ4A 3TFVA 1RQIA 5EAUA 4LTVA 1ZW5A 4LXWA 1UBVA 2ZY1A 3Q30A 4LPHF 4H5DF 1V4KA 3ZCDA 2E93A 3PKOA 3WCDA 3ACYA 4LZ3A 4KWDA 3V1VA 3KRFA 3NPRA 4LFVF 3WEHA 3SDRA 2I19A 4MC8A 3SDVA 5B0LA 3WEFA 4H5CF 1DI1A 2E8TA 5DJVF 3Q2ZA 3SDQA 3LMDA 4Q23A 4DXJA 3TFPA 4LLSA 4EA1A 4KVIA 2Z52A 2AZLA 1V4JA 2OGDA 1WL3A 5AFXA 4LA6A 5B00A 5DJRF 3P41A 3KRAA 2Q9ZA 5B03A 4F62A 3WE9A 3BNYA 5HNAA 3LDWA 1DGPA 3M9UA 4PVXF 3UCAA 3LK5A 5IK6A 1YYTA 2PS4A 3WJKA 5H9DA 5B0MA 2OPNA 1YYRA 4JZXA 1VG3A 2AETA 3N5HF 1HM4A 3EZ3A 4H5EF 4LOBA 3P8LA 4RXCA 4P0VA 3SDUA 5I1UA 4KVDA 3N6KF 1RTRA 3ZOUA 3WSBA 3P8RA 4JXYA 5ILKA 3MZVA 1WKZA 2PS8A 4PVYF 1HXCA 5IMPA 5EATA 3ICZA 4GA3A 3KRFB 1V4IA 5IK9A 2DH4A 3TFNA 1FPSA 3NF2A 1YHKA 5DGMF 3N49F 2PS7A 4KVYA 2OA6A 5B0JA 3V1XA 5HN7A 3DYFA 3LZ9A 3P5RA 4NKFA 1N1ZA 3WCBA 1YYUA 3PYBA 5IL3A 3WSAA 2Z50A 4KUXA 3KRPB 5EROA 4FP4A 3WCCA 2ZCOA 4LUUA 1YYSA 4LA5A 4XQRF 5IMNA 4KKMA 5CG5A 1WY0A 5DHIA 4KQ5A 3N5JF 4ZQ8A 4KQSA 5IMIA 4OKZA 5HN8A 2F94F 3ZMCA 3SAEA 2E8VA 2E95A 1YYQA 3KROB 3MAVA 4F6XA 4RXDA 5JV1F 4OMHA 4UMJA 3VJEA 2Z4VA 5E8HA 4GAXA 5EASA 2Q9YA 4RNQA 3OYRA 3N0GA 4GP1A 3LLWA 2ZEVA 2E94A 1WL1A 4E9UA 5E8KA 3ADZA 5C05A 3RMGA 3WJNA 5A0IA 4NFJF 5IL8A 5ILHA 1JFAA 3BNXA 3KRPA 2RAHA 3WCMA 2OPMA 2AEKA 3QQVA 1JFGA 5ILIA 5ERMA 3N1VF 3SDTA 3ICKA 1PS1A 3S9VA 4RXEA 4LZ0A 3RBMA 4DWGA 4EA2A 3P5PA 3AQ0A 3RYWA 1KIZA 4NG6A 5ILZA 1WL2A 4KVWA 4JXNA 4QPFA 2QISA 3KROA 2Z78A 4HD1A 5IK0A 5ERNA 3ID0A 3PH7A 3ICNA 2AELA 4KFAA 2PS6A 4RYPA 4DHDA 2E91A 2Z4WA 3WCFA 2Z4ZA 4WK5A 1WMWA 1YHLA 2Z7HA 3DYGA 1VG2A 3N45F 3ACWA 3WEKA 3LGZB 3VJAA 3WEGA 4E1EA 2F9KF 1VG4A 3ZMBA 4KPDA 1WL0A 1UBXA 3LG5A 3TS7A 3N1WF 4K10A 5B02A 3S4JA 2VF6A 4JYXA 3AQCB 3QKCA 5ILJA 3KRCB 3G4DA 3NRIA 1HXAA 3WEIA 2ONHA 3M02A 3WCLA 4KQUA 5IM1A 4XQSF 2F7MF 3DYHA 5DIQF 1N22A 2J1PA 2AZKA 3IPIA 3VJDA 2E8WA 5B0IA 4OKMA 4FJQA 5IKAA 4NKEA 3LSNA 2E92A 3LVSA 5HN9A 5KSXF 5A0KA 4QXSF 4NUAA 5IKHA 4N9UA 2O1OA 1YHMA 2ZEUA 5JA0F 4RXAA 2ZCRA 5B0KA 2PS5A 5DJPF 5ER8A 3WCGA 3WJOA 3LOMA 2J1OA 1N1BA 4KK2A 3VJ8A 4DZWA 2Z7IA 3N3DA 1VG7A 5E8LA 3CP6A 4P0WA 4JZBA 4OGUA 3KRCA 1UBWA 3VJBA 4OMGA 4P0XA 4F6VA 3ASXA 3LEEA 3WCJA 3EFQA 5IN8A 4L2XF 1V4HA 1VG6A 3N0FA 5A0JA 4GP2A 3Q2QA 2F89F 3PDEA 3ICMA 2FORA 3V66A 3IBAA 2FTZA 2AZJA 2ZCQA 4E9ZA 4N1ZF 1UBYA 4KPJA 5JV0F 4XQTF 3TC1A 3ACXA 5JV2F 3WCIA 1HX9A 1V4EA 2ZCSA 2Q80A 4LPGF 1HM7A 4NFIF 4LFEA 1YQ7A 5AELA 2Z4XA 2F92F 2Q58A 3M01A 3RYEA 2EWGA 3OABB 4LLTA 3OACB 1KIYA 5AHUB 5B01A 3APZA 3AE0A 5ILYA 4JVJF 1N20A 5CG6A 3KBKA 1N23A 3WC9A
chains in the Genus database with same CATH topology
3LJIA 3M00A 4MC0A 3Q1OA 2F8CF 5DHKA 1N24A 4DWBA 2E90A 1HXGA 5DZ2A 5DGSF 1RQJA 3AQBB 3NPKA 2E8XA 2P1CA 3CKEA 1YV5A 2E4OA 4LTZA 2ONGA 4LIXA 3WCEA 2F8ZF 4NFKF 5AYPA 4DI5A 3KB9A 4DEMF 3PYAA 3ZL6A 2Z4YA 1N21A 4EA0A 1EZFA 3M0GA 5DW7A 2E8UA 5IVGA 3OABA 5JUZF 3W7FA 4LFGA 3OACA 4MC3A 3G4FA 3N3LF 3EGTA 2J5CA 3VJ9A 3CC9A 3N46F 3WCAA 3WEJA 3WCHA 3VJCA 2H8OA 4LZCA 3B7LA 5ILDA 3LGKA 5DGNF 3KRAB 1YJ4A 3TFVA 1RQIA 5EAUA 4LTVA 1ZW5A 4LXWA 1UBVA 2ZY1A 3Q30A 4LPHF 4H5DF 1V4KA 3ZCDA 2E93A 3PKOA 3WCDA 3ACYA 4LZ3A 4KWDA 3V1VA 3KRFA 3NPRA 4LFVF 3WEHA 3SDRA 2I19A 4MC8A 3SDVA 5B0LA 3WEFA 4H5CF 1DI1A 2E8TA 5DJVF 3Q2ZA 3SDQA 3LMDA 4Q23A 4DXJA 3TFPA 4LLSA 4EA1A 4KVIA 2Z52A 2AZLA 1V4JA 2OGDA 1WL3A 5AFXA 4LA6A 5B00A 5DJRF 3P41A 3KRAA 2Q9ZA 5B03A 4F62A 3WE9A 3BNYA 5HNAA 3LDWA 1DGPA 3M9UA 4PVXF 3UCAA 3LK5A 5IK6A 1YYTA 2PS4A 3WJKA 5H9DA 5B0MA 2OPNA 1YYRA 4JZXA 1VG3A 2AETA 3N5HF 1HM4A 3EZ3A 4H5EF 4LOBA 3P8LA 4RXCA 4P0VA 3SDUA 5I1UA 4KVDA 3N6KF 1RTRA 3ZOUA 3WSBA 3P8RA 4JXYA 5ILKA 3MZVA 1WKZA 2PS8A 4PVYF 1HXCA 5IMPA 5EATA 3ICZA 4GA3A 3KRFB 1V4IA 5IK9A 2DH4A 3TFNA 1FPSA 3NF2A 1YHKA 5DGMF 3N49F 2PS7A 4KVYA 2OA6A 5B0JA 3V1XA 5HN7A 3DYFA 3LZ9A 3P5RA 4NKFA 1N1ZA 3WCBA 1YYUA 3PYBA 5IL3A 3WSAA 2Z50A 4KUXA 3KRPB 5EROA 4FP4A 3WCCA 2ZCOA 4LUUA 1YYSA 4LA5A 4XQRF 5IMNA 4KKMA 5CG5A 1WY0A 5DHIA 4KQ5A 3N5JF 4ZQ8A 4KQSA 5IMIA 4OKZA 5HN8A 2F94F 3ZMCA 3SAEA 2E8VA 2E95A 1YYQA 3KROB 3MAVA 4F6XA 4RXDA 5JV1F 4OMHA 4UMJA 3VJEA 2Z4VA 5E8HA 4GAXA 5EASA 2Q9YA 4RNQA 3OYRA 3N0GA 4GP1A 3LLWA 2ZEVA 2E94A 1WL1A 4E9UA 5E8KA 3ADZA 5C05A 3RMGA 3WJNA 5A0IA 4NFJF 5IL8A 5ILHA 1JFAA 3BNXA 3KRPA 2RAHA 3WCMA 2OPMA 2AEKA 3QQVA 1JFGA 5ILIA 5ERMA 3N1VF 3SDTA 3ICKA 1PS1A 3S9VA 4RXEA 4LZ0A 3RBMA 4DWGA 4EA2A 3P5PA 3AQ0A 3RYWA 1KIZA 4NG6A 5ILZA 1WL2A 4KVWA 4JXNA 4QPFA 2QISA 3KROA 2Z78A 4HD1A 5IK0A 5ERNA 3ID0A 3PH7A 3ICNA 2AELA 4KFAA 2PS6A 4RYPA 4DHDA 2E91A 2Z4WA 3WCFA 2Z4ZA 4WK5A 1WMWA 1YHLA 2Z7HA 3DYGA 1VG2A 3N45F 3ACWA 3WEKA 3LGZB 3VJAA 3WEGA 4E1EA 2F9KF 1VG4A 3ZMBA 4KPDA 1WL0A 1UBXA 3LG5A 3TS7A 3N1WF 4K10A 5B02A 3S4JA 2VF6A 4JYXA 3AQCB 3QKCA 5ILJA 3KRCB 3G4DA 3NRIA 1HXAA 3WEIA 2ONHA 3M02A 3WCLA 4KQUA 5IM1A 4XQSF 2F7MF 3DYHA 5DIQF 1N22A 2J1PA 2AZKA 3IPIA 3VJDA 2E8WA 5B0IA 4OKMA 4FJQA 5IKAA 4NKEA 3LSNA 2E92A 3LVSA 5HN9A 5KSXF 5A0KA 4QXSF 4NUAA 5IKHA 4N9UA 2O1OA 1YHMA 2ZEUA 5JA0F 4RXAA 2ZCRA 5B0KA 2PS5A 5DJPF 5ER8A 3WCGA 3WJOA 3LOMA 2J1OA 1N1BA 4KK2A 3VJ8A 4DZWA 2Z7IA 3N3DA 1VG7A 5E8LA 3CP6A 4P0WA 4JZBA 4OGUA 3KRCA 1UBWA 3VJBA 4OMGA 4P0XA 4F6VA 3ASXA 3LEEA 3WCJA 3EFQA 5IN8A 4L2XF 1V4HA 1VG6A 3N0FA 5A0JA 4GP2A 3Q2QA 2F89F 3PDEA 3ICMA 2FORA 3V66A 3IBAA 2FTZA 2AZJA 2ZCQA 4E9ZA 4N1ZF 1UBYA 4KPJA 5JV0F 4XQTF 3TC1A 3ACXA 5JV2F 3WCIA 1HX9A 1V4EA 2ZCSA 2Q80A 4LPGF 1HM7A 4NFIF 4LFEA 1YQ7A 5AELA 2Z4XA 2F92F 2Q58A 3M01A 3RYEA 2EWGA 3OABB 4LLTA 3OACB 1KIYA 5AHUB 5B01A 3APZA 3AE0A 5ILYA 4JVJF 1N20A 5CG6A 3KBKA 1N23A 3WC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJI A;  3M00 A;  4MC0 A;  3Q1O A;  2F8C F;  5DHK A;  1N24 A;  4DWB A;  2E90 A;  1HXG A;  5DZ2 A;  5DGS F;  1RQJ A;  3AQB B;  3NPK A;  2E8X A;  2P1C A;  3CKE A;  1YV5 A;  2E4O A;  4LTZ A;  2ONG A;  4LIX A;  3WCE A;  2F8Z F;  4NFK F;  5AYP A;  4DI5 A;  3KB9 A;  4DEM F;  3PYA A;  3ZL6 A;  2Z4Y A;  1N21 A;  4EA0 A;  1EZF A;  3M0G A;  5DW7 A;  2E8U A;  5IVG A;  3OAB A;  5JUZ F;  3W7F A;  4LFG A;  3OAC A;  4MC3 A;  3G4F A;  3N3L F;  3EGT A;  2J5C A;  3VJ9 A;  3CC9 A;  3N46 F;  3WCA A;  3WEJ A;  3WCH A;  3VJC A;  2H8O A;  4LZC A;  3B7L A;  5ILD A;  3LGK A;  5DGN F;  3KRA B;  1YJ4 A;  3TFV A;  1RQI A;  5EAU A;  4LTV A;  1ZW5 A;  4LXW A;  1UBV A;  2ZY1 A;  3Q30 A;  4LPH F;  4H5D F;  1V4K A;  3ZCD A;  2E93 A;  3PKO A;  3WCD A;  3ACY A;  4LZ3 A;  4KWD A;  3V1V A;  3KRF A;  3NPR A;  4LFV F;  3WEH A;  3SDR A;  2I19 A;  4MC8 A;  3SDV A;  5B0L A;  3WEF A;  4H5C F;  1DI1 A;  2E8T A;  5DJV F;  3Q2Z A;  3SDQ A;  3LMD A;  4Q23 A;  4DXJ A;  3TFP A;  4LLS A;  4EA1 A;  4KVI A;  2Z52 A;  2AZL A;  1V4J A;  2OGD A;  1WL3 A;  5AFX A;  4LA6 A;  5B00 A;  5DJR F;  3P41 A;  3KRA A;  2Q9Z A;  5B03 A;  4F62 A;  3WE9 A;  3BNY A;  5HNA A;  3LDW A;  1DGP A;  3M9U A;  4PVX F;  3UCA A;  3LK5 A;  5IK6 A;  1YYT A;  2PS4 A;  3WJK A;  5H9D A;  5B0M A;  2OPN A;  1YYR A;  4JZX A;  1VG3 A;  2AET A;  3N5H F;  1HM4 A;  3EZ3 A;  4H5E F;  4LOB A;  3P8L A;  4RXC A;  4P0V A;  3SDU A;  5I1U A;  4KVD A;  3N6K F;  1RTR A;  3ZOU A;  3WSB A;  3P8R A;  4JXY A;  5ILK A;  3MZV A;  1WKZ A;  2PS8 A;  4PVY F;  1HXC A;  5IMP A;  5EAT A;  3ICZ A;  4GA3 A;  3KRF B;  1V4I A;  5IK9 A;  2DH4 A;  3TFN A;  1FPS A;  3NF2 A;  1YHK A;  5DGM F;  3N49 F;  2PS7 A;  4KVY A;  2OA6 A;  5B0J A;  3V1X A;  5HN7 A;  3DYF A;  3LZ9 A;  3P5R A;  4NKF A;  1N1Z A;  3WCB A;  1YYU A;  3PYB A;  5IL3 A;  3WSA A;  2Z50 A;  4KUX A;  3KRP B;  5ERO A;  4FP4 A;  3WCC A;  2ZCO A;  4LUU A;  1YYS A;  4LA5 A;  4XQR F;  5IMN A;  4KKM A;  5CG5 A;  1WY0 A;  5DHI A;  4KQ5 A;  3N5J F;  4ZQ8 A;  4KQS A;  5IMI A;  4OKZ A;  5HN8 A;  2F94 F;  3ZMC A;  3SAE A;  2E8V A;  2E95 A;  1YYQ A;  3KRO B;  3MAV A;  4F6X A;  4RXD A;  5JV1 F;  4OMH A;  4UMJ A;  3VJE A;  2Z4V A;  5E8H A;  4GAX A;  5EAS A;  2Q9Y A;  4RNQ A;  3OYR A;  3N0G A;  4GP1 A;  3LLW A;  2ZEV A;  2E94 A;  1WL1 A;  4E9U A;  5E8K A;  3ADZ A;  5C05 A;  3RMG A;  3WJN A;  5A0I A;  4NFJ F;  5IL8 A;  5ILH A;  1JFA A;  3BNX A;  3KRP A;  2RAH A;  3WCM A;  2OPM A;  2AEK A;  3QQV A;  1JFG A;  5ILI A;  5ERM A;  3N1V F;  3SDT A;  3ICK A;  1PS1 A;  3S9V A;  4RXE A;  4LZ0 A;  3RBM A;  4DWG A;  4EA2 A;  3P5P A;  3AQ0 A;  3RYW A;  1KIZ A;  4NG6 A;  5ILZ A;  1WL2 A;  4KVW A;  4JXN A;  4QPF A;  2QIS A;  3KRO A;  2Z78 A;  4HD1 A;  5IK0 A;  5ERN A;  3ID0 A;  3PH7 A;  3ICN A;  2AEL A;  4KFA A;  2PS6 A;  4RYP A;  4DHD A;  2E91 A;  2Z4W A;  3WCF A;  2Z4Z A;  4WK5 A;  1WMW A;  1YHL A;  2Z7H A;  3DYG A;  1VG2 A;  3N45 F;  3ACW A;  3WEK A;  3LGZ B;  3VJA A;  3WEG A;  4E1E A;  2F9K F;  1VG4 A;  3ZMB A;  4KPD A;  1WL0 A;  1UBX A;  3LG5 A;  3TS7 A;  3N1W F;  4K10 A;  5B02 A;  3S4J A;  2VF6 A;  4JYX A;  3AQC B;  3QKC A;  5ILJ A;  3KRC B;  3G4D A;  3NRI A;  1HXA A;  3WEI A;  2ONH A;  3M02 A;  3WCL A;  4KQU A;  5IM1 A;  4XQS F;  2F7M F;  3DYH A;  5DIQ F;  1N22 A;  2J1P A;  2AZK A;  3IPI A;  3VJD A;  2E8W A;  5B0I A;  4OKM A;  4FJQ A;  5IKA A;  4NKE A;  3LSN A;  2E92 A;  3LVS A;  5HN9 A;  5KSX F;  5A0K A;  4QXS F;  4NUA A;  5IKH A;  4N9U A;  2O1O A;  1YHM A;  2ZEU A;  5JA0 F;  4RXA A;  2ZCR A;  5B0K A;  2PS5 A;  5DJP F;  5ER8 A;  3WCG A;  3WJO A;  3LOM A;  2J1O A;  1N1B A;  4KK2 A;  3VJ8 A;  4DZW A;  2Z7I A;  3N3D A;  1VG7 A;  5E8L A;  3CP6 A;  4P0W A;  4JZB A;  4OGU A;  3KRC A;  1UBW A;  3VJB A;  4OMG A;  4P0X A;  4F6V A;  3ASX A;  3LEE A;  3WCJ A;  3EFQ A;  5IN8 A;  4L2X F;  1V4H A;  1VG6 A;  3N0F A;  5A0J A;  4GP2 A;  3Q2Q A;  2F89 F;  3PDE A;  3ICM A;  2FOR A;  3V66 A;  3IBA A;  2FTZ A;  2AZJ A;  2ZCQ A;  4E9Z A;  4N1Z F;  1UBY A;  4KPJ A;  5JV0 F;  4XQT F;  3TC1 A;  3ACX A;  5JV2 F;  3WCI A;  1HX9 A;  1V4E A;  2ZCS A;  2Q80 A;  4LPG F;  1HM7 A;  4NFI F;  4LFE A;  1YQ7 A;  5AEL A;  2Z4X A;  2F92 F;  2Q58 A;  3M01 A;  3RYE A;  2EWG A;  3OAB B;  4LLT A;  3OAC B;  1KIY A;  5AHU B;  5B01 A;  3APZ A;  3AE0 A;  5ILY A;  4JVJ F;  1N20 A;  5CG6 A;  3KBK A;  1N23 A;  3WC9 A; 
#chains in the Genus database with same CATH topology
 3LJI A;  3M00 A;  4MC0 A;  3Q1O A;  2F8C F;  5DHK A;  1N24 A;  4DWB A;  2E90 A;  1HXG A;  5DZ2 A;  5DGS F;  1RQJ A;  3AQB B;  3NPK A;  2E8X A;  2P1C A;  3CKE A;  1YV5 A;  2E4O A;  4LTZ A;  2ONG A;  4LIX A;  3WCE A;  2F8Z F;  4NFK F;  5AYP A;  4DI5 A;  3KB9 A;  4DEM F;  3PYA A;  3ZL6 A;  2Z4Y A;  1N21 A;  4EA0 A;  1EZF A;  3M0G A;  5DW7 A;  2E8U A;  5IVG A;  3OAB A;  5JUZ F;  3W7F A;  4LFG A;  3OAC A;  4MC3 A;  3G4F A;  3N3L F;  3EGT A;  2J5C A;  3VJ9 A;  3CC9 A;  3N46 F;  3WCA A;  3WEJ A;  3WCH A;  3VJC A;  2H8O A;  4LZC A;  3B7L A;  5ILD A;  3LGK A;  5DGN F;  3KRA B;  1YJ4 A;  3TFV A;  1RQI A;  5EAU A;  4LTV A;  1ZW5 A;  4LXW A;  1UBV A;  2ZY1 A;  3Q30 A;  4LPH F;  4H5D F;  1V4K A;  3ZCD A;  2E93 A;  3PKO A;  3WCD A;  3ACY A;  4LZ3 A;  4KWD A;  3V1V A;  3KRF A;  3NPR A;  4LFV F;  3WEH A;  3SDR A;  2I19 A;  4MC8 A;  3SDV A;  5B0L A;  3WEF A;  4H5C F;  1DI1 A;  2E8T A;  5DJV F;  3Q2Z A;  3SDQ A;  3LMD A;  4Q23 A;  4DXJ A;  3TFP A;  4LLS A;  4EA1 A;  4KVI A;  2Z52 A;  2AZL A;  1V4J A;  2OGD A;  1WL3 A;  5AFX A;  4LA6 A;  5B00 A;  5DJR F;  3P41 A;  3KRA A;  2Q9Z A;  5B03 A;  4F62 A;  3WE9 A;  3BNY A;  5HNA A;  3LDW A;  1DGP A;  3M9U A;  4PVX F;  3UCA A;  3LK5 A;  5IK6 A;  1YYT A;  2PS4 A;  3WJK A;  5H9D A;  5B0M A;  2OPN A;  1YYR A;  4JZX A;  1VG3 A;  2AET A;  3N5H F;  1HM4 A;  3EZ3 A;  4H5E F;  4LOB A;  3P8L A;  4RXC A;  4P0V A;  3SDU A;  5I1U A;  4KVD A;  3N6K F;  1RTR A;  3ZOU A;  3WSB A;  3P8R A;  4JXY A;  5ILK A;  3MZV A;  1WKZ A;  2PS8 A;  4PVY F;  1HXC A;  5IMP A;  5EAT A;  3ICZ A;  4GA3 A;  3KRF B;  1V4I A;  5IK9 A;  2DH4 A;  3TFN A;  1FPS A;  3NF2 A;  1YHK A;  5DGM F;  3N49 F;  2PS7 A;  4KVY A;  2OA6 A;  5B0J A;  3V1X A;  5HN7 A;  3DYF A;  3LZ9 A;  3P5R A;  4NKF A;  1N1Z A;  3WCB A;  1YYU A;  3PYB A;  5IL3 A;  3WSA A;  2Z50 A;  4KUX A;  3KRP B;  5ERO A;  4FP4 A;  3WCC A;  2ZCO A;  4LUU A;  1YYS A;  4LA5 A;  4XQR F;  5IMN A;  4KKM A;  5CG5 A;  1WY0 A;  5DHI A;  4KQ5 A;  3N5J F;  4ZQ8 A;  4KQS A;  5IMI A;  4OKZ A;  5HN8 A;  2F94 F;  3ZMC A;  3SAE A;  2E8V A;  2E95 A;  1YYQ A;  3KRO B;  3MAV A;  4F6X A;  4RXD A;  5JV1 F;  4OMH A;  4UMJ A;  3VJE A;  2Z4V A;  5E8H A;  4GAX A;  5EAS A;  2Q9Y A;  4RNQ A;  3OYR A;  3N0G A;  4GP1 A;  3LLW A;  2ZEV A;  2E94 A;  1WL1 A;  4E9U A;  5E8K A;  3ADZ A;  5C05 A;  3RMG A;  3WJN A;  5A0I A;  4NFJ F;  5IL8 A;  5ILH A;  1JFA A;  3BNX A;  3KRP A;  2RAH A;  3WCM A;  2OPM A;  2AEK A;  3QQV A;  1JFG A;  5ILI A;  5ERM A;  3N1V F;  3SDT A;  3ICK A;  1PS1 A;  3S9V A;  4RXE A;  4LZ0 A;  3RBM A;  4DWG A;  4EA2 A;  3P5P A;  3AQ0 A;  3RYW A;  1KIZ A;  4NG6 A;  5ILZ A;  1WL2 A;  4KVW A;  4JXN A;  4QPF A;  2QIS A;  3KRO A;  2Z78 A;  4HD1 A;  5IK0 A;  5ERN A;  3ID0 A;  3PH7 A;  3ICN A;  2AEL A;  4KFA A;  2PS6 A;  4RYP A;  4DHD A;  2E91 A;  2Z4W A;  3WCF A;  2Z4Z A;  4WK5 A;  1WMW A;  1YHL A;  2Z7H A;  3DYG A;  1VG2 A;  3N45 F;  3ACW A;  3WEK A;  3LGZ B;  3VJA A;  3WEG A;  4E1E A;  2F9K F;  1VG4 A;  3ZMB A;  4KPD A;  1WL0 A;  1UBX A;  3LG5 A;  3TS7 A;  3N1W F;  4K10 A;  5B02 A;  3S4J A;  2VF6 A;  4JYX A;  3AQC B;  3QKC A;  5ILJ A;  3KRC B;  3G4D A;  3NRI A;  1HXA A;  3WEI A;  2ONH A;  3M02 A;  3WCL A;  4KQU A;  5IM1 A;  4XQS F;  2F7M F;  3DYH A;  5DIQ F;  1N22 A;  2J1P A;  2AZK A;  3IPI A;  3VJD A;  2E8W A;  5B0I A;  4OKM A;  4FJQ A;  5IKA A;  4NKE A;  3LSN A;  2E92 A;  3LVS A;  5HN9 A;  5KSX F;  5A0K A;  4QXS F;  4NUA A;  5IKH A;  4N9U A;  2O1O A;  1YHM A;  2ZEU A;  5JA0 F;  4RXA A;  2ZCR A;  5B0K A;  2PS5 A;  5DJP F;  5ER8 A;  3WCG A;  3WJO A;  3LOM A;  2J1O A;  1N1B A;  4KK2 A;  3VJ8 A;  4DZW A;  2Z7I A;  3N3D A;  1VG7 A;  5E8L A;  3CP6 A;  4P0W A;  4JZB A;  4OGU A;  3KRC A;  1UBW A;  3VJB A;  4OMG A;  4P0X A;  4F6V A;  3ASX A;  3LEE A;  3WCJ A;  3EFQ A;  5IN8 A;  4L2X F;  1V4H A;  1VG6 A;  3N0F A;  5A0J A;  4GP2 A;  3Q2Q A;  2F89 F;  3PDE A;  3ICM A;  2FOR A;  3V66 A;  3IBA A;  2FTZ A;  2AZJ A;  2ZCQ A;  4E9Z A;  4N1Z F;  1UBY A;  4KPJ A;  5JV0 F;  4XQT F;  3TC1 A;  3ACX A;  5JV2 F;  3WCI A;  1HX9 A;  1V4E A;  2ZCS A;  2Q80 A;  4LPG F;  1HM7 A;  4NFI F;  4LFE A;  1YQ7 A;  5AEL A;  2Z4X A;  2F92 F;  2Q58 A;  3M01 A;  3RYE A;  2EWG A;  3OAB B;  4LLT A;  3OAC B;  1KIY A;  5AHU B;  5B01 A;  3APZ A;  3AE0 A;  5ILY A;  4JVJ F;  1N20 A;  5CG6 A;  3KBK A;  1N23 A;  3WC9 A; 
#chains in the Genus database with same CATH homology
 3LJI A;  3M00 A;  4MC0 A;  3Q1O A;  2F8C F;  5DHK A;  1N24 A;  4DWB A;  2E90 A;  1HXG A;  5DZ2 A;  5DGS F;  1RQJ A;  3AQB B;  3NPK A;  2E8X A;  2P1C A;  3CKE A;  1YV5 A;  2E4O A;  4LTZ A;  2ONG A;  4LIX A;  3WCE A;  2F8Z F;  4NFK F;  5AYP A;  4DI5 A;  3KB9 A;  4DEM F;  3PYA A;  3ZL6 A;  2Z4Y A;  1N21 A;  4EA0 A;  1EZF A;  3M0G A;  5DW7 A;  2E8U A;  5IVG A;  3OAB A;  5JUZ F;  3W7F A;  4LFG A;  3OAC A;  4MC3 A;  3G4F A;  3N3L F;  3EGT A;  2J5C A;  3VJ9 A;  3CC9 A;  3N46 F;  3WCA A;  3WEJ A;  3WCH A;  3VJC A;  2H8O A;  4LZC A;  3B7L A;  5ILD A;  3LGK A;  5DGN F;  3KRA B;  1YJ4 A;  3TFV A;  1RQI A;  5EAU A;  4LTV A;  1ZW5 A;  4LXW A;  1UBV A;  2ZY1 A;  3Q30 A;  4LPH F;  4H5D F;  1V4K A;  3ZCD A;  2E93 A;  3PKO A;  3WCD A;  3ACY A;  4LZ3 A;  4KWD A;  3V1V A;  3KRF A;  3NPR A;  4LFV F;  3WEH A;  3SDR A;  2I19 A;  4MC8 A;  3SDV A;  5B0L A;  3WEF A;  4H5C F;  1DI1 A;  2E8T A;  5DJV F;  3Q2Z A;  3SDQ A;  3LMD A;  4Q23 A;  4DXJ A;  3TFP A;  4LLS A;  4EA1 A;  4KVI A;  2Z52 A;  2AZL A;  1V4J A;  2OGD A;  1WL3 A;  5AFX A;  4LA6 A;  5B00 A;  5DJR F;  3P41 A;  3KRA A;  2Q9Z A;  5B03 A;  4F62 A;  3WE9 A;  3BNY A;  5HNA A;  3LDW A;  1DGP A;  3M9U A;  4PVX F;  3UCA A;  3LK5 A;  5IK6 A;  1YYT A;  2PS4 A;  3WJK A;  5H9D A;  5B0M A;  2OPN A;  1YYR A;  4JZX A;  1VG3 A;  2AET A;  3N5H F;  1HM4 A;  3EZ3 A;  4H5E F;  4LOB A;  3P8L A;  4RXC A;  4P0V A;  3SDU A;  5I1U A;  4KVD A;  3N6K F;  1RTR A;  3ZOU A;  3WSB A;  3P8R A;  4JXY A;  5ILK A;  3MZV A;  1WKZ A;  2PS8 A;  4PVY F;  1HXC A;  5IMP A;  5EAT A;  3ICZ A;  4GA3 A;  3KRF B;  1V4I A;  5IK9 A;  2DH4 A;  3TFN A;  1FPS A;  3NF2 A;  1YHK A;  5DGM F;  3N49 F;  2PS7 A;  4KVY A;  2OA6 A;  5B0J A;  3V1X A;  5HN7 A;  3DYF A;  3LZ9 A;  3P5R A;  4NKF A;  1N1Z A;  3WCB A;  1YYU A;  3PYB A;  5IL3 A;  3WSA A;  2Z50 A;  4KUX A;  3KRP B;  5ERO A;  4FP4 A;  3WCC A;  2ZCO A;  4LUU A;  1YYS A;  4LA5 A;  4XQR F;  5IMN A;  4KKM A;  5CG5 A;  1WY0 A;  5DHI A;  4KQ5 A;  3N5J F;  4ZQ8 A;  4KQS A;  5IMI A;  4OKZ A;  5HN8 A;  2F94 F;  3ZMC A;  3SAE A;  2E8V A;  2E95 A;  1YYQ A;  3KRO B;  3MAV A;  4F6X A;  4RXD A;  5JV1 F;  4OMH A;  4UMJ A;  3VJE A;  2Z4V A;  5E8H A;  4GAX A;  5EAS A;  2Q9Y A;  4RNQ A;  3OYR A;  3N0G A;  4GP1 A;  3LLW A;  2ZEV A;  2E94 A;  1WL1 A;  4E9U A;  5E8K A;  3ADZ A;  5C05 A;  3RMG A;  3WJN A;  5A0I A;  4NFJ F;  5IL8 A;  5ILH A;  1JFA A;  3BNX A;  3KRP A;  2RAH A;  3WCM A;  2OPM A;  2AEK A;  3QQV A;  1JFG A;  5ILI A;  5ERM A;  3N1V F;  3SDT A;  3ICK A;  1PS1 A;  3S9V A;  4RXE A;  4LZ0 A;  3RBM A;  4DWG A;  4EA2 A;  3P5P A;  3AQ0 A;  3RYW A;  1KIZ A;  4NG6 A;  5ILZ A;  1WL2 A;  4KVW A;  4JXN A;  4QPF A;  2QIS A;  3KRO A;  2Z78 A;  4HD1 A;  5IK0 A;  5ERN A;  3ID0 A;  3PH7 A;  3ICN A;  2AEL A;  4KFA A;  2PS6 A;  4RYP A;  4DHD A;  2E91 A;  2Z4W A;  3WCF A;  2Z4Z A;  4WK5 A;  1WMW A;  1YHL A;  2Z7H A;  3DYG A;  1VG2 A;  3N45 F;  3ACW A;  3WEK A;  3LGZ B;  3VJA A;  3WEG A;  4E1E A;  2F9K F;  1VG4 A;  3ZMB A;  4KPD A;  1WL0 A;  1UBX A;  3LG5 A;  3TS7 A;  3N1W F;  4K10 A;  5B02 A;  3S4J A;  2VF6 A;  4JYX A;  3AQC B;  3QKC A;  5ILJ A;  3KRC B;  3G4D A;  3NRI A;  1HXA A;  3WEI A;  2ONH A;  3M02 A;  3WCL A;  4KQU A;  5IM1 A;  4XQS F;  2F7M F;  3DYH A;  5DIQ F;  1N22 A;  2J1P A;  2AZK A;  3IPI A;  3VJD A;  2E8W A;  5B0I A;  4OKM A;  4FJQ A;  5IKA A;  4NKE A;  3LSN A;  2E92 A;  3LVS A;  5HN9 A;  5KSX F;  5A0K A;  4QXS F;  4NUA A;  5IKH A;  4N9U A;  2O1O A;  1YHM A;  2ZEU A;  5JA0 F;  4RXA A;  2ZCR A;  5B0K A;  2PS5 A;  5DJP F;  5ER8 A;  3WCG A;  3WJO A;  3LOM A;  2J1O A;  1N1B A;  4KK2 A;  3VJ8 A;  4DZW A;  2Z7I A;  3N3D A;  1VG7 A;  5E8L A;  3CP6 A;  4P0W A;  4JZB A;  4OGU A;  3KRC A;  1UBW A;  3VJB A;  4OMG A;  4P0X A;  4F6V A;  3ASX A;  3LEE A;  3WCJ A;  3EFQ A;  5IN8 A;  4L2X F;  1V4H A;  1VG6 A;  3N0F A;  5A0J A;  4GP2 A;  3Q2Q A;  2F89 F;  3PDE A;  3ICM A;  2FOR A;  3V66 A;  3IBA A;  2FTZ A;  2AZJ A;  2ZCQ A;  4E9Z A;  4N1Z F;  1UBY A;  4KPJ A;  5JV0 F;  4XQT F;  3TC1 A;  3ACX A;  5JV2 F;  3WCI A;  1HX9 A;  1V4E A;  2ZCS A;  2Q80 A;  4LPG F;  1HM7 A;  4NFI F;  4LFE A;  1YQ7 A;  5AEL A;  2Z4X A;  2F92 F;  2Q58 A;  3M01 A;  3RYE A;  2EWG A;  3OAB B;  4LLT A;  3OAC B;  1KIY A;  5AHU B;  5B01 A;  3APZ A;  3AE0 A;  5ILY A;  4JVJ F;  1N20 A;  5CG6 A;  3KBK A;  1N23 A;  3WC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...